HHsearch alignment for GI: 254780709 and conserved domain: cd00009

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.89  E-value=9.5e-05  Score=53.64  Aligned_cols=79  Identities=23%  Similarity=0.282  Sum_probs=55.3

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
T Consensus        18 ~~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~~~   80 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHF-----------------LVRLLFELA   80 (151)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEHHHCCHHHHHHHHHHHH-----------------HHHHHHHHH
T ss_conf             998089989999886599999999712137982785477704677775760577-----------------889899999


Q ss_pred             HHHCCCEEEEECCCCC
Q ss_conf             6514875998654333
Q gi|254780709|r  190 QAKKVDVLIIDTAGRL  205 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~  205 (321)
T Consensus        81 ~~~~~~vl~iDEi~~l   96 (151)
T cd00009          81 EKAKPGVLFIDEIDSL   96 (151)
T ss_pred             HHCCCCEEEEECHHHC
T ss_conf             9769986982016655