HHsearch alignment for GI: 254780709 and conserved domain: cd00154

>cd00154 Rab Rab family. Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide di
Probab=96.12  E-value=0.08  Score=33.13  Aligned_cols=139  Identities=20%  Similarity=0.321  Sum_probs=69.9

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus         2 Ki~vvG~~~vGKTsli~~~~~~~f~~~---------------------~~~Tig~d~~~~~-------~~~------~~~   47 (159)
T cd00154           2 KIVLIGDSGVGKTSLLLRFVDGKFDEN---------------------YKSTIGVDFKSKT-------IEI------DGK   47 (159)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCCC---------------------CCCCCCEEEEEEE-------EEE------CCE
T ss_conf             899999699689999999970999998---------------------4886664799999-------999------999


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH----HHHCC--CC-EEEEEC
Q ss_conf             487599865433321157789999899876302223430112310233522577899987----64358--97-699965
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF----HAVAG--TT-GLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F----~~~~~--~~-g~I~TK  265 (321)
T Consensus        48 ~~~l~iwDt~G~e--------~~~~l~~~---~~-~~~d~~ilv~d~~~-~~Sf~~~~~~~~~i~~~~~~~~~iilvgnK  114 (159)
T cd00154          48 TVKLQIWDTAGQE--------RFRSITPS---YY-RGAHGAILVYDITN-RESFENLDKWLKELKEYAPENIPIILVGNK  114 (159)
T ss_pred             EEEEEEEECCCCH--------HHHHHHHH---HH-HHCCEEEEECCCCC-HHHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             9999999789826--------57788999---97-54127567244898-899999999999999868988826999974


Q ss_pred             CCCC-C---CHHHHHHHHHHHCCCEEEEEC--CCCCCCC
Q ss_conf             4578-7---069999999997698899975--8981325
Q gi|254780709|r  266 MDGT-A---RGGGLIPIVVTHKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       266 lD~t-a---~~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl  298 (321)
T Consensus       115 ~DL~~~~~v~~~~~~~~a~~~~~~~~e~SAk~~~~i~~~  153 (159)
T cd00154         115 IDLEDQRQVSTEEAQQFAKENGLLFFETSAKTGENVEEL  153 (159)
T ss_pred             CCCHHCCCCCHHHHHHHHHHCCCEEEEECCCCCCCHHHH
T ss_conf             563011689999999999986997999876888198999