HHsearch alignment for GI: 254780709 and conserved domain: cd00880

>cd00880 Era_like Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=97.41  E-value=0.004  Score=42.21  Aligned_cols=145  Identities=23%  Similarity=0.339  Sum_probs=73.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             13544444247899999998522674267743451245688999997530353212235866124542289999651487
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVD  195 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~D  195 (321)
T Consensus         1 ivG~~N~GKStL~N~L~------~~~~~~vs~----------------~~gt---T----~~~~~~~~~-----~~~~~~   46 (163)
T cd00880           1 LFGRTNAGKSSLLNALL------GQEVAIVSP----------------VPGT---T----TDPVEYVWE-----LGPLGP   46 (163)
T ss_pred             CCCCCCCCHHHHHHHHH------CCCCCEECC----------------CCCE---E----CCCEEEEEE-----ECCCCE
T ss_conf             91979989999999995------899610169----------------8998---6----564589999-----547865


Q ss_pred             EEEEECCCCCCCHHHHHHHH-HHHHHHHHCCCCCCCCEEEEECCCCCCHHHHH--HHHHHHHHCCCCEEEEECCCCCCCH
Q ss_conf             59986543332115778999-98998763022234301123102335225778--9998764358976999654578706
Q gi|254780709|r  196 VLIIDTAGRLHNNSILMAGI-GKMIRVLKRLDPHAPHSVLQVLDATTGQNALR--QVEMFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       196 vvliDTAGR~~~~~~lm~EL-~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~--~a~~F~~~~~~~g~I~TKlD~ta~~  272 (321)
T Consensus        47 i~lvDtpG~~~~~~-~~~~~~~~~~~~~~-----~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p~i~v~NK~D~~~~~  120 (163)
T cd00880          47 VVLIDTPGIDEAGG-LGREREELARRVLE-----RADLILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDLLPEE  120 (163)
T ss_pred             EEEEECCCCCCCCC-HHHHHHHHHHHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECEECCCHH
T ss_conf             99972798522231-01689999999998-----6898999987899975566999999997197427885342067878


Q ss_pred             --HHHHH-----HHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             --99999-----99997698899975--898132555
Q gi|254780709|r  273 --GGLIP-----IVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       273 --G~~ls-----~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
T Consensus       121 ~~~~~~~~~~~~~~~~~~~~i~~iSA~~g~gi~~L~~  157 (163)
T cd00880         121 EEEELLELRLLILLLLLGLPVIAVSALTGEGIDELRE  157 (163)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHH
T ss_conf             9999999999998767998599997898979999999