>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.

Probab=97.56 E-value=0.0016 Score=45.07 Aligned_cols=91 Identities=15% Similarity=0.219 Sum_probs=52.6 Q ss_pred CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH Q ss_conf 41231135444442478999999985-22674267743451245688999997530353212235866124542289999 Q gi|254780709|r 111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189 (321) Q Consensus 111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a 189 (321) T Consensus 13 G~L~vi~a~~g~GKS~~~~~la~~~a~~~g~~V~~~SlEm~~~--~~~~R~~s~~~~i~~~~i~~~~~~~~~-~~~~~~~ 89 (242) T cd00984 13 GDLIIIAARPSMGKTAFALNIAENIAKKQGKPVLFFSLEMSKE--QLLQRLLASESGISLSKLRTGSLSDED-WERLAEA 89 (242) T ss_pred CCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHH--HHHHHHHHHHHCCCHHHHHCCCCCHHH-HHHHHHH T ss_conf 8189999689999999999999999997799599993335388--999999999829774553026522799-9999999 Q ss_pred H--HHCCCEEEEECCCC Q ss_conf 6--51487599865433 Q gi|254780709|r 190 Q--AKKVDVLIIDTAGR 204 (321) Q Consensus 190 ~--~~~~DvvliDTAGR 204 (321) T Consensus 90 ~~~~~~~~l~i~d~~~~ 106 (242) T cd00984 90 IGELKELPIYIDDSSSL 106 (242) T ss_pred HHHHCCCCEEEECCCCC T ss_conf 99861698899669999

HHsearch alignment for GI: 254780709 and conserved domain: cd00984