HHsearch alignment for GI: 254780709 and conserved domain: cd01121

>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=97.19  E-value=0.0037  Score=42.51  Aligned_cols=88  Identities=25%  Similarity=0.415  Sum_probs=65.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC--CCCCCCCCCHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532--1223586612454228999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF--VCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~--~~~~~~~dp~~v~~~a~~~  188 (321)
T Consensus        82 GSvvLlgGePGIGKSTLLLQia~~la~~~~~vLYvSGE----ES~~QIk~RA~RLg~~~~~l~l~set~le----~Il~~  153 (372)
T cd01121          82 GSVILIGGDPGIGKSTLLLQVAARLAKRGGKVLYVSGE----ESPEQIKLRADRLGISTENLYLLAETNLE----DILAS  153 (372)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECH----HHHHHHHHHHHHHCCCCCCCEEEECCCHH----HHHHH
T ss_conf             71799825998868899999999998639938998245----67899998999858788772788435699----99999


Q ss_pred             HHHHCCCEEEEECCCCCC
Q ss_conf             965148759986543332
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLH  206 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~  206 (321)
T Consensus       154 i~~~kP~~lIIDSIQT~~  171 (372)
T cd01121         154 IEELKPDLVIIDSIQTVY  171 (372)
T ss_pred             HHHHCCCEEEEECHHHCC
T ss_conf             997199889995622020