HHsearch alignment for GI: 254780709 and conserved domain: cd01876

>cd01876 YihA_EngB The YihA (EngB) subfamily. This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control. YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting). Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis. The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=97.19  E-value=0.008  Score=40.11  Aligned_cols=148  Identities=16%  Similarity=0.245  Sum_probs=73.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
T Consensus         2 IaivG~pN~GKSTL~N~L~~-----~~~~~~vs-~------------------~~gtTr----~i~--~~~-------~~   44 (170)
T cd01876           2 IAFAGRSNVGKSSLINALTN-----RKKLARTS-K------------------TPGKTQ----LIN--FFN-------VN   44 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHC-----CCCEEEEE-C------------------CCCEEE----EEE--EEE-------EC
T ss_conf             89998999999999999968-----99627860-7------------------897785----205--885-------38


Q ss_pred             CCEEEEECCCC--CCCHHHHHHHH-HHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHH-CCCCEEEEECCC
Q ss_conf             87599865433--32115778999-98998763022234301123102335225--77899987643-589769996545
Q gi|254780709|r  194 VDVLIIDTAGR--LHNNSILMAGI-GKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAV-AGTTGLIMTKMD  267 (321)
Q Consensus       194 ~DvvliDTAGR--~~~~~~lm~EL-~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~-~~~~g~I~TKlD  267 (321)
T Consensus        45 ~~~~~vDtPG~g~~~~~~~~~~~~~~~~~~~l~~~~--~~~~vi~viD~~~~~~~~d~~i~~~l~~~~kp-~iiVlNKiD  121 (170)
T cd01876          45 DKFRLVDLPGYGYAKVSKEVKEKWGKLIEEYLENRE--NLKGVVLLIDSRHGPTEIDLEMLDWLEELGIP-FLVVLTKAD  121 (170)
T ss_pred             CEEEEEECCCCHHCCCCHHHHHHHHHHHHHHHHHHH--HHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEEEEE
T ss_conf             779999657840101687799999999999998406--33499999963223748689999999876998-799998675


Q ss_pred             CCCCHHH--HH-HHHHH-----HCCCEEEEEC--CCCCCCCCCC
Q ss_conf             7870699--99-99999-----7698899975--8981325557
Q gi|254780709|r  268 GTARGGG--LI-PIVVT-----HKIPVYFLGV--GEGINDLEPF  301 (321)
Q Consensus       268 ~ta~~G~--~l-s~~~~-----~~~Pi~fig~--Ge~i~Dl~~f  301 (321)
T Consensus       122 lv~~~~~~~~~~~~~~~l~~~~~~~~ii~iSA~~g~gi~~L~~~  165 (170)
T cd01876         122 KLKKSELAKALKEIKKELKLFEIDPPIILFSSLKGQGIDELRAL  165 (170)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             37877899999999998742179983999988999779999999