HHsearch alignment for GI: 254780709 and conserved domain: cd01884

>cd01884 EF_Tu EF-Tu subfamily. This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts. It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors. The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family. EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=96.48  E-value=0.0061  Score=40.97  Aligned_cols=152  Identities=15%  Similarity=0.173  Sum_probs=77.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-HCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             311354444424789999999852267426774345124568899999753-0353212235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR-TSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~-~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus         5 i~iiGHVDhGKTTL~~~l~~~~~~~~~~~~~~~------~~~D~~~~--EreRGiTI~-------~~~~~~------~~~   63 (195)
T cd01884           5 VGTIGHVDHGKTTLTAAITKVLAKKGGAKFKKY------DEIDKAPE--EKARGITIN-------TAHVEY------ETA   63 (195)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCC------HHCCCCHH--HHCCCCCCC-------CEEEEE------ECC
T ss_conf             999960588698999999998866344441120------01005466--650588614-------418999------608


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHH--HHCCCCEE-E-EECCC
Q ss_conf             4875998654333211577899998998763022234301123102335225778999-876--43589769-9-96545
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFH--AVAGTTGL-I-MTKMD  267 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~--~~~~~~g~-I-~TKlD  267 (321)
T Consensus        64 ~~~~~~IDtPGH~--d--F~~~~i---~g~~-----~~D~aiLVVdA~eGv~--~QT~eh~~la~~lgi~~iiV~iNK~D  129 (195)
T cd01884          64 NRHYAHVDCPGHA--D--YIKNMI---TGAA-----QMDGAILVVSATDGPM--PQTREHLLLARQVGVPYIVVFLNKAD  129 (195)
T ss_pred             CEEEEECCCCCHH--H--HHHHHH---HHHH-----HCCEEEEEEECCCCCC--HHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             8169962689607--7--888998---6351-----1362689985277874--78999999999809996279996877


Q ss_pred             CCCCHH-------HHHHHHHHHC-----CCEEEEEC--CCCCCCCCC
Q ss_conf             787069-------9999999976-----98899975--898132555
Q gi|254780709|r  268 GTARGG-------GLIPIVVTHK-----IPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       268 ~ta~~G-------~~ls~~~~~~-----~Pi~fig~--Ge~i~Dl~~  300 (321)
T Consensus       130 ~~~~~~~~~~v~~ei~~~l~~~g~~~~~~p~ip~Sa~~g~~~~~~~~  176 (195)
T cd01884         130 MVDDEELLELVEMEVRELLSKYGFDGDNTPIVRGSALKALEGDDPNK  176 (195)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEHHHHHCCCCCCC
T ss_conf             89878999999999999998429995568299977387535788875