HHsearch alignment for GI: 254780709 and conserved domain: cd01983

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=98.11  E-value=3.9e-06  Score=63.33  Aligned_cols=50  Identities=38%  Similarity=0.567  Sum_probs=44.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus         1 ~i~~~~~kGvGKTT~a~~La~~la~~g~~Vl~vD----------------------------------------------   34 (99)
T cd01983           1 VIVVTGKGGVGKTTLAANLAAALAKRGKRVLLID----------------------------------------------   34 (99)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC----------------------------------------------
T ss_conf             9898589977689999999999998899699986----------------------------------------------


Q ss_pred             CCCEEEEECCCCCCCHHH
Q ss_conf             487599865433321157
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSI  210 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~  210 (321)
T Consensus        35 --d~iiiD~~~~~~~~~~   50 (99)
T cd01983          35 --DYVLIDTPPGLGLLVL   50 (99)
T ss_pred             --CCEEECCCCCCCHHHH
T ss_conf             --7178858998884689