HHsearch alignment for GI: 254780709 and conserved domain: cd02037

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.
Probab=98.35  E-value=7.7e-06  Score=61.29  Aligned_cols=143  Identities=23%  Similarity=0.312  Sum_probs=85.6

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             31135444442478999999985226742677434512456889999975303532-12235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus         3 ~v~s~kggvgkst~~~~la~~l~~~g~~v~~~d~di~gps-------------ip~~~rGp~---~~~~i~q~l~~~~w~   66 (169)
T cd02037           3 AVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDADIYGPS-------------IPKMWRGPM---KMGAIKQFLTDVDWG   66 (169)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-------------CCEEEECHH---HHHHHHHHHHHCCCC
T ss_conf             9974999881999999999999987997899971379997-------------550120473---899999999852546


Q ss_pred             CCCEEEEECC-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHHHHHH-CCCCEEEEEC
Q ss_conf             4875998654-33321157789999899876302223430112310233522-----577899987643-5897699965
Q gi|254780709|r  193 KVDVLIIDTA-GRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEMFHAV-AGTTGLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTA-GR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~F~~~-~~~~g~I~TK  265 (321)
T Consensus        67 ~lDyLIID~PPGtg--D~~l-----t~~~~~------~~d~~IvV---TTP~~~s~~Da~r~i~~~~~~~i~i~GvVeNM  130 (169)
T cd02037          67 ELDYLVIDMPPGTG--DEHL-----TLAQSL------PIDGAVIV---TTPQEVALDDVRKAIDMFKKVNIPILGVVENM  130 (169)
T ss_pred             CCCEEEEECCCCCC--HHHH-----HHHHHC------CCCCEEEE---ECCCHHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             67889996899987--0778-----798750------56747999---46958899999999999997599707999879


Q ss_pred             CC----C--C----CCHHHHHHHHHHHCCCEEEEE
Q ss_conf             45----7--8----706999999999769889997
Q gi|254780709|r  266 MD----G--T----ARGGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       266 lD----~--t----a~~G~~ls~~~~~~~Pi~fig  290 (321)
T Consensus       131 s~~~c~~c~~~~~ifg~~~~~~la~~~~i~--~Lg  163 (169)
T cd02037         131 SYFVCPHCGKKIYIFGKGGGEKLAEELGVP--LLG  163 (169)
T ss_pred             CCCCCCCCCCEEECCCCCHHHHHHHHHCCC--EEE
T ss_conf             666079999735278884499999995999--898