HHsearch alignment for GI: 254780709 and conserved domain: cd03109

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms. The enzyme catalyzes formation of the ureido ring of dethiobiotin from (7R,8S)-7,8-diaminononanoic acid (DAPA) and carbon dioxide. The enzyme utilizes carbon dioxide instead of hydrogen carbonate as substrate and is dependent on ATP and divalent metal ions as cofactors.
Probab=97.19  E-value=0.016  Score=38.07  Aligned_cols=116  Identities=19%  Similarity=0.225  Sum_probs=72.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             44444247899999998522674267743451245688999997530353212235866124542289999651487599
Q gi|254780709|r  119 VNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLI  198 (321)
Q Consensus       119 ~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~Dvvl  198 (321)
T Consensus         7 dT~VGKT~vt~~l~~~l~~~G~~v~~~-----KPv--------------------------------------~t~D~vl   43 (134)
T cd03109           7 GTDIGKTVATAILARALKEKGYRVAPL-----KPV--------------------------------------QTYDFVL   43 (134)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEE-----CHH--------------------------------------HCCCEEE
T ss_conf             888768999999999999779917787-----566--------------------------------------7279899


Q ss_pred             EECCCCC--CCH-HHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--HHHHHHH-HHHHHCCCCEEEEECCCCCCCH
Q ss_conf             8654333--211-57789999899876302223430112310233522--5778999-8764358976999654578706
Q gi|254780709|r  199 IDTAGRL--HNN-SILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--NALRQVE-MFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       199 iDTAGR~--~~~-~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--~~~~~a~-~F~~~~~~~g~I~TKlD~ta~~  272 (321)
T Consensus        44 VEGaGG~~vPl~~~~~~~Dl---~~~l~-------~pvIlV~~~~LG~INhtlLt~eal~~~gi~v~G~i~N~~~~~~~~  113 (134)
T cd03109          44 VEGAGGLCVPLKEDFTNADV---AKELN-------LPAILVTSAGLGSINHAFLTIEAARIKGIILNGVLGNVIVEKEGL  113 (134)
T ss_pred             EECCCCEEECCCCCCCHHHH---HHHHC-------CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHH
T ss_conf             98897746003898629999---99709-------998999778878589999999999987992889999467997106


Q ss_pred             --HHHHHHHHHHCCCEE
Q ss_conf             --999999999769889
Q gi|254780709|r  273 --GGLIPIVVTHKIPVY  287 (321)
Q Consensus       273 --G~~ls~~~~~~~Pi~  287 (321)
T Consensus       114 ~~~N~~~I~~~t~vPvL  130 (134)
T cd03109         114 ATLNVETIERLTGIPVL  130 (134)
T ss_pred             HHHHHHHHHHHHCCCEE
T ss_conf             78759999997499977