HHsearch alignment for GI: 254780709 and conserved domain: cd03265

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.94  E-value=0.0085  Score=39.93  Aligned_cols=39  Identities=28%  Similarity=0.396  Sum_probs=29.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             412311354444424789999999852267426774345
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
T Consensus        26 Gei~gllGpNGAGKSTll~~i~Gl~~p~~G~i~i~G~~~   64 (220)
T cd03265          26 GEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHDV   64 (220)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEC
T ss_conf             839999999987199999999769788962899999998