HHsearch alignment for GI: 254780709 and conserved domain: cd04128

>cd04128 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are
Probab=95.77  E-value=0.13  Score=31.56  Aligned_cols=149  Identities=18%  Similarity=0.201  Sum_probs=80.0

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus         2 KivlvGd~~VGKTsLi~rf~~~~F~~~y~~---------------------Tig~d~~~k~i~-----v--------~~~   47 (182)
T cd04128           2 KIGLLGDAQIGKTSLMVKYVEGEFDEDYIQ---------------------TLGVNFMEKTIS-----I--------RGT   47 (182)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCC---------------------CCEEEEEEEEEE-----E--------CCE
T ss_conf             899999999898999999953999999888---------------------733898999999-----9--------999


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHC------CCCEEEEECC
Q ss_conf             4875998654333211577899998998763022234301123102335225778999876435------8976999654
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVA------GTTGLIMTKM  266 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~------~~~g~I~TKl  266 (321)
T Consensus        48 ~v~l~iwDtaGqe--------~f~~~~~~---y~~-~a~~~ilvfDit~-~~Sf~~~~~w~~~i~~~~~~~~~ilVGnK~  114 (182)
T cd04128          48 EITFSIWDLGGQR--------EFINMLPL---VCN-DAVAILFMFDLTR-KSTLNSIKEWYRQARGFNKTAIPILVGTKY  114 (182)
T ss_pred             EEEEEEEECCCCH--------HHHHHHHH---HHC-CCCEEEEEEECCC-HHHHHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             9999998677648--------78999999---864-7878999997899-899998999999999768999889999866


Q ss_pred             CC------CCCH---HHHHHHHHHHCCCEEEEEC--CCCCCCCCCCCHHHHHHHHCC
Q ss_conf             57------8706---9999999997698899975--898132555778999998728
Q gi|254780709|r  267 DG------TARG---GGLIPIVVTHKIPVYFLGV--GEGINDLEPFVAKDFSAVITG  312 (321)
Q Consensus       267 D~------ta~~---G~~ls~~~~~~~Pi~fig~--Ge~i~Dl~~f~~~~~~~~llG  312 (321)
T Consensus       115 DL~~~~~~~~~~~~~~~~~~~a~~~~~~f~etSAk~~~nV~e~----F~~i~~~i~~  167 (182)
T cd04128         115 DLFADLPPEEQEEITKQARKYAKAMKAPLIFCSTSHSINVQKI----FKIVLAKAFD  167 (182)
T ss_pred             CCCCCCCCHHEEHHHHHHHHHHHHCCCEEEEEECCCCCCHHHH----HHHHHHHHHC
T ss_conf             3556556223102489999999984998999947999798999----9999999966