HHsearch alignment for GI: 254780709 and conserved domain: cd04149

>cd04149 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed t
Probab=96.64  E-value=0.011  Score=39.22  Aligned_cols=137  Identities=19%  Similarity=0.262  Sum_probs=69.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
T Consensus         6 ~kk~~kililG~~~sGKTsil~~l~-----~~~~~~~----------------------~pTvg~----~~~~~------   48 (168)
T cd04149           6 GNKEMRILMLGLDAAGKTTILYKLK-----LGQSVTT----------------------IPTVGF----NVETV------   48 (168)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHH-----CCCCCCC----------------------CCCCCC----EEEEE------
T ss_conf             7888899999999999899999996-----6998760----------------------262670----07999------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHCC---CC----
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899-98764358---97----
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVAG---TT----  259 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~~---~~----  259 (321)
T Consensus        49 --~~~~~~l~iwD~~Gqe~~r-~l~----------~~y~~-~~~~iifVvDstd~~-~~~~~~~~l~~~l~~~~~~~~pi  113 (168)
T cd04149          49 --TYKNVKFNVWDVGGQDKIR-PLW----------RHYYT-GTQGLIFVVDSADRD-RIDEARQELHRIINDREMRDALL  113 (168)
T ss_pred             --EECCEEEEEEECCCCCCCC-CHH----------HHHCC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHHCHHHCCCEE
T ss_conf             --9898899999899997466-065----------76437-886689998377678-99999999999971452279869


Q ss_pred             EEEEECCCCC-CCH----HHHHHHHHHHCCCEEEEE----CCCCCC
Q ss_conf             6999654578-706----999999999769889997----589813
Q gi|254780709|r  260 GLIMTKMDGT-ARG----GGLIPIVVTHKIPVYFLG----VGEGIN  296 (321)
Q Consensus       260 g~I~TKlD~t-a~~----G~~ls~~~~~~~Pi~fig----~Ge~i~  296 (321)
T Consensus       114 lI~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gv~  159 (168)
T cd04149         114 LVFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLY  159 (168)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHCHHHHHCCCCEEEEEECCCCCCHH
T ss_conf             9999756677788999999997876551798099980687896979