HHsearch alignment for GI: 254780709 and conserved domain: cd04158

>cd04158 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=96.57  E-value=0.0086  Score=39.90  Aligned_cols=147  Identities=18%  Similarity=0.252  Sum_probs=75.2

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
T Consensus         2 IlilGl~~sGKTtil~~l~----~~~----------~~~-------------~~pT~G~~~----~~i--------~~~~   42 (169)
T cd04158           2 VVTLGLDGAGKTTILFKLK----QDE----------FMQ-------------PIPTIGFNV----ETV--------EYKN   42 (169)
T ss_pred             EEEECCCCCCHHHHHHHHH----CCC----------CCC-------------CCCCCCCCE----EEE--------EECC
T ss_conf             9999989998899999995----799----------689-------------778688166----999--------9898


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHHHHC---CCCE----EEEEC
Q ss_conf             875998654333211577899998998763022234301123102335225778999-876435---8976----99965
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFHAVA---GTTG----LIMTK  265 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~~~~---~~~g----~I~TK  265 (321)
T Consensus        43 ~~l~iwD~gG~~~~-r~~----------w~~Yy~-~~~~iIfVvDssd-~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK  109 (169)
T cd04158          43 LKFTIWDVGGKHKL-RPL----------WKHYYL-NTQAVVFVVDSSH-RDRVSEAHSELAKLLTEKELRDALLLIFANK  109 (169)
T ss_pred             EEEEEEECCCCCCC-CHH----------HHHHCC-CCCEEEEEEECCH-HHHHHHHHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             89999989997244-636----------787555-7627999998630-6779999999999971275379849999735


Q ss_pred             CCCC-C----CHHHHHHHHHH-HCCCEEEEE----CCCCCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             4578-7----06999999999-769889997----58981325557789999987286564
Q gi|254780709|r  266 MDGT-A----RGGGLIPIVVT-HKIPVYFLG----VGEGINDLEPFVAKDFSAVITGCLDY  316 (321)
Q Consensus       266 lD~t-a----~~G~~ls~~~~-~~~Pi~fig----~Ge~i~Dl~~f~~~~~~~~llG~gd~  316 (321)
T Consensus       110 ~Dl~~~~~~~ei~~~l~l~~~~~~~~~~i~~~SA~tG~Gi~e~----~~WL~~~ii~~~~~  166 (169)
T cd04158         110 QDVAGALSVEEMTELLSLHKLCCGRSWYIQGCDARSGMGLYEG----LDWLSRQLVAAGVL  166 (169)
T ss_pred             CCCCCCCCHHHHHHHHCCHHHCCCCCEEEEEEECCCCCCHHHH----HHHHHHHHHHCCCC
T ss_conf             5677798999999985705452699629995557279598999----99999999865786