HHsearch alignment for GI: 254780709 and conserved domain: cd04166

>cd04166 CysN_ATPS CysN_ATPS subfamily. CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes. ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate. CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family. CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP. CysN is an example of lateral gene transfer followed by acquisition of new function. In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=95.98  E-value=0.1  Score=32.38  Aligned_cols=153  Identities=18%  Similarity=0.236  Sum_probs=73.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---------CCCCC-CCCHHHHH
Q ss_conf             311354444424789999999852267426774345124568899999753035321---------22358-66124542
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---------CSEIG-SDAAALAY  183 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---------~~~~~-~dp~~v~~  183 (321)
T Consensus         2 ~vv~GHVD~GKSTL~g~LL~~~g~i------------~~~~~~~~~~~~~~~~~~~~~~a~~lD~~~~ErerGiTId~~~   69 (208)
T cd04166           2 FLTCGSVDDGKSTLIGRLLYDSKSI------------FEDQLAALESKSCGTGGEPLDLALLVDGLQAEREQGITIDVAY   69 (208)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCC------------CHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCCEEEEE
T ss_conf             6999748898889999999982996------------7899999998875416763000343468687882697941058


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH---HHHHHCCCCE
Q ss_conf             2899996514875998654333211577899998998763022234301123102335225778999---8764358976
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE---MFHAVAGTTG  260 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~---~F~~~~~~~g  260 (321)
T Consensus        70 ---~~f~~~~~~~~iiDtPGH----~dfi~nmi---~gas-----~aD~ailVVda~~G~~--~QT~eh~~~~~~lgi~~  132 (208)
T cd04166          70 ---RYFSTPKRKFIIADTPGH----EQYTRNMV---TGAS-----TADLAILLVDARKGVL--EQTRRHSYILSLLGIRH  132 (208)
T ss_pred             ---EEEEECCCEEEEEECCCC----HHHHHHHH---HHHH-----HCCEEEEEEECCCCCC--HHHHHHHHHHHHCCCCE
T ss_conf             ---999819926999878962----88999999---9986-----3774799997588872--78999999999749983


Q ss_pred             EE--EECCCCCC----CHHHHH----HHHHHHC-CCEEEEEC----CCCC
Q ss_conf             99--96545787----069999----9999976-98899975----8981
Q gi|254780709|r  261 LI--MTKMDGTA----RGGGLI----PIVVTHK-IPVYFLGV----GEGI  295 (321)
Q Consensus       261 ~I--~TKlD~ta----~~G~~l----s~~~~~~-~Pi~fig~----Ge~i  295 (321)
T Consensus       133 iIv~vNKmD~v~~~e~~f~~i~~~~~~~l~~~~~~~~~~IPiSa~~GdNi  182 (208)
T cd04166         133 VVVAVNKMDLVDYSEEVFEEIVADYLAFAAKLGIEDITFIPISALDGDNV  182 (208)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCC
T ss_conf             99999885768999899999999999999974998871998126778887