>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=97.08 E-value=0.0018 Score=44.63 Aligned_cols=142 Identities=20% Similarity=0.194 Sum_probs=79.9 Q ss_pred EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC Q ss_conf 31135444442478999999985226742677434512456889999975303532122358661245422899996514 Q gi|254780709|r 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193 (321) Q Consensus 114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~ 193 (321) T Consensus 2 i~iigH~~aGKTtL~E~lL~~~g~i-----------~~~G~V~~g~t~~D~~~~E~~R---g---iSi-~s~~~~~~w~~ 63 (268) T cd04170 2 IALVGHSGSGKTTLAEALLYATGAI-----------DRLGSVEDGTTVSDYDPEEIKR---K---MSI-STSVAPLEWKG 63 (268) T ss_pred EEEEECCCCCHHHHHHHHHHHCCCC-----------CCCCCCCCCCCCCCCCHHHHHC---C---CCE-ECCEEEEEECC T ss_conf 8999089999899999999966996-----------6576545897357787889867---9---675-13557888899 Q ss_pred CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHHHHCCCCEEEEECCCC Q ss_conf 875998654333211577899998998763022234301123102335225-----778999876435897699965457 Q gi|254780709|r 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFHAVAGTTGLIMTKMDG 268 (321) Q Consensus 194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~~~~~~~g~I~TKlD~ 268 (321) T Consensus 64 ~~inliDTPG~--~--DF~~e~~~aL~v--------~D~Av~Vida~~GVe~~T~~~w~~~~~~~--iP-~i~fINKmDr 128 (268) T cd04170 64 HKINLIDTPGY--A--DFVGETRAALRA--------ADAALVVVSAQSGVEVGTEKLWEFADEAG--IP-RIIFINKMDR 128 (268) T ss_pred EEEEEEECCCC--H--HHHHHHHHHHCC--------CCEEEEEECCCCCHHHHHHHHHHHHHHCC--CC-EEEEEECCCC T ss_conf 79999869897--5--799999998404--------78399994187547687999999999859--99-8999978787 Q ss_pred -CCCHHH-HHHHHHHHCCCEEE Q ss_conf -870699-99999997698899 Q gi|254780709|r 269 -TARGGG-LIPIVVTHKIPVYF 288 (321) Q Consensus 269 -ta~~G~-~ls~~~~~~~Pi~f 288 (321) T Consensus 129 ~~ad~~~~l~~i~~~lg~~~vp 150 (268) T cd04170 129 ERADFDKTLAALQEAFGRPVVP 150 (268) T ss_pred CCCCHHHHHHHHHHHHCCCEEE T ss_conf 8996477999999986898499

HHsearch alignment for GI: 254780709 and conserved domain: cd04170