Query         gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 321
No_of_seqs    173 out of 3692
Neff          6.6 
Searched_HMMs 39220
Date          Sun May 29 20:26:45 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780709.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00064 ftsY signal recognit 100.0       0       0  734.6  26.6  272   40-311     1-284 (284)
  2 TIGR00959 ffh signal recogniti 100.0       0       0  733.1  26.6  289   21-316     1-307 (439)
  3 PRK10416 cell division protein 100.0       0       0  717.2  34.2  309    6-315   190-499 (499)
  4 COG0552 FtsY Signal recognitio 100.0       0       0  690.2  30.2  310    3-312    23-340 (340)
  5 PRK10867 signal recognition pa 100.0       0       0  664.7  30.7  290   21-317     2-301 (453)
  6 PRK00771 signal recognition pa 100.0       0       0  647.5  30.3  285   20-317     2-295 (433)
  7 COG0541 Ffh Signal recognition 100.0       0       0  645.3  31.2  290   21-317     2-300 (451)
  8 TIGR01425 SRP54_euk signal rec 100.0       0       0  594.1  22.1  292   21-318     2-322 (453)
  9 KOG0780 consensus              100.0       0       0  555.8  25.1  290   22-318     4-302 (483)
 10 PRK06731 flhF flagellar biosyn 100.0       0       0  512.5  27.9  254   44-312    13-268 (270)
 11 PRK12726 flagellar biosynthesi 100.0       0       0  482.3  24.3  241   53-314   159-401 (407)
 12 PRK12723 flagellar biosynthesi 100.0       0       0  445.5  28.4  265   39-318   104-377 (388)
 13 pfam00448 SRP54 SRP54-type pro 100.0       0       0  455.5  20.1  196  111-312     1-196 (196)
 14 KOG0781 consensus              100.0       0       0  450.6  23.7  284   22-311   274-586 (587)
 15 PRK12724 flagellar biosynthesi 100.0       0       0  441.5  24.8  265   43-318   154-422 (432)
 16 PRK05703 flhF flagellar biosyn 100.0       0       0  421.0  29.3  286   11-318   118-408 (412)
 17 PRK06995 flhF flagellar biosyn 100.0       0       0  408.5  28.6  286   11-316    82-372 (404)
 18 cd03115 SRP The signal recogni 100.0       0       0  401.9  17.6  173  112-290     1-173 (173)
 19 PRK11889 flhF flagellar biosyn 100.0       0       0  390.0  24.6  250   47-312   181-434 (436)
 20 COG1419 FlhF Flagellar GTP-bin 100.0       0       0  384.3  25.5  218   85-318   180-401 (407)
 21 PRK12727 flagellar biosynthesi 100.0       0       0  369.3  26.2  274   14-310   260-537 (557)
 22 TIGR03499 FlhF flagellar biosy 100.0 3.5E-31 8.9E-36  239.2  18.2  175   14-203   106-282 (282)
 23 PRK09841 cryptic autophosphory  98.9 4.7E-08 1.2E-12   76.9  13.3  149  108-269   528-706 (726)
 24 cd00550 ArsA_ATPase Oxyanion-t  98.9 5.8E-08 1.5E-12   76.2  11.9   38  112-149     1-38  (254)
 25 cd03114 ArgK-like The function  98.8 6.3E-08 1.6E-12   76.0  10.3  137  113-267     1-148 (148)
 26 PHA02518 ParA-like protein; Pr  98.8 2.6E-07 6.7E-12   71.6  13.3  145  120-288    10-166 (211)
 27 PRK11519 tyrosine kinase; Prov  98.8 3.7E-07 9.3E-12   70.6  13.4  149  108-269   523-701 (720)
 28 pfam02374 ArsA_ATPase Anion-tr  98.8 2.7E-07 6.9E-12   71.5  12.6   38  112-149     2-39  (304)
 29 pfam02881 SRP54_N SRP54-type p  98.8 5.4E-08 1.4E-12   76.4   9.0   76   17-92      1-77  (77)
 30 cd02035 ArsA ArsA ATPase funct  98.7 3.1E-07 7.8E-12   71.1  11.7  144  113-267     1-181 (217)
 31 pfam07015 VirC1 VirC1 protein.  98.7 6.6E-08 1.7E-12   75.8   8.2  159  113-295     3-180 (231)
 32 cd02117 NifH_like This family   98.7 1.2E-06 3.1E-11   66.9  13.8  162  113-287     2-206 (212)
 33 PRK13849 putative crown gall t  98.7 1.1E-07 2.7E-12   74.4   8.1  160  113-295     3-180 (231)
 34 PRK09435 arginine/ornithine tr  98.7 2.1E-06 5.5E-11   65.2  14.7  173  108-299    46-245 (325)
 35 pfam01656 CbiA CobQ/CobB/MinD/  98.7 9.8E-07 2.5E-11   67.6  12.7  157  116-287     4-198 (212)
 36 COG0378 HypB Ni2+-binding GTPa  98.6 1.1E-07 2.9E-12   74.2   6.9  172  107-301     8-195 (202)
 37 pfam00142 Fer4_NifH 4Fe-4S iro  98.6 9.7E-07 2.5E-11   67.6  11.4  164  113-290     2-206 (269)
 38 pfam03308 ArgK ArgK protein. T  98.6 7.4E-06 1.9E-10   61.4  15.2  172  108-301    26-224 (267)
 39 smart00382 AAA ATPases associa  98.6 5.5E-07 1.4E-11   69.4   9.3   97  111-213     2-98  (148)
 40 TIGR03371 cellulose_yhjQ cellu  98.5 3.6E-06 9.1E-11   63.7  12.4  159  113-286     3-200 (246)
 41 TIGR03018 pepcterm_TyrKin exop  98.5 7.4E-06 1.9E-10   61.4  13.9  141  108-263    32-206 (207)
 42 TIGR03029 EpsG chain length de  98.5 3.4E-06 8.7E-11   63.8  12.0  143  110-265   102-274 (274)
 43 pfam09140 MipZ ATPase MipZ. Mi  98.5 6.3E-07 1.6E-11   68.9   8.0   85  121-206    11-111 (261)
 44 cd02040 NifH NifH gene encodes  98.5 5.3E-06 1.3E-10   62.4  12.7  165  112-290     2-207 (270)
 45 COG1703 ArgK Putative periplas  98.5 8.8E-06 2.2E-10   60.9  13.5  147  106-274    46-204 (323)
 46 cd02032 Bchl_like This family   98.5 1.5E-05 3.9E-10   59.2  14.5  156  113-288     2-201 (267)
 47 cd02036 MinD Bacterial cell di  98.4   3E-06 7.8E-11   64.1  10.0  140  114-287     2-147 (179)
 48 PRK10818 cell division inhibit  98.4 5.5E-06 1.4E-10   62.3  10.4  151  113-277     4-195 (270)
 49 TIGR01007 eps_fam capsular exo  98.4 5.9E-06 1.5E-10   62.1  10.4  145  111-269    19-196 (207)
 50 pfam02492 cobW CobW/HypB/UreG,  98.4 4.6E-06 1.2E-10   62.9   9.7  143  113-270     2-151 (174)
 51 PRK13768 GTPase; Provisional    98.4 4.5E-06 1.1E-10   62.9   9.6  170  111-299     2-239 (253)
 52 cd03110 Fer4_NifH_child This p  98.3 1.8E-05 4.7E-10   58.6  12.3  156  114-290     3-176 (179)
 53 cd02037 MRP-like MRP (Multiple  98.3 7.7E-06   2E-10   61.3  10.4  143  114-290     3-163 (169)
 54 PRK13231 nitrogenase reductase  98.3   2E-05   5E-10   58.4  12.2  158  113-287     4-199 (264)
 55 COG0003 ArsA Predicted ATPase   98.3 1.8E-06 4.6E-11   65.8   6.8   39  111-149     2-40  (322)
 56 TIGR01420 pilT_fam twitching m  98.3 2.5E-07 6.4E-12   71.7   2.4  196   26-252    45-244 (350)
 57 PRK11131 ATP-dependent RNA hel  98.3 0.00041 1.1E-08   49.2  18.5  132  113-254    91-239 (1295)
 58 PRK13235 nifH nitrogenase redu  98.3 2.1E-05 5.5E-10   58.2  11.8  166  113-289     3-209 (274)
 59 cd02042 ParA ParA and ParB of   98.3 1.4E-06 3.6E-11   66.5   5.2   47  120-209     9-55  (104)
 60 cd02038 FleN-like FleN is a me  98.3 3.3E-05 8.4E-10   56.9  12.0  124  116-291     5-137 (139)
 61 PRK13233 nifH nitrogenase redu  98.3   6E-05 1.5E-09   55.0  13.3  165  111-287     2-208 (275)
 62 CHL00072 chlL photochlorophyll  98.2 0.00018 4.6E-09   51.7  15.5  182  113-314     2-247 (271)
 63 PRK09361 radB DNA repair and r  98.2 1.5E-05 3.8E-10   59.3  10.0   92  111-203    23-117 (224)
 64 PRK00090 bioD dithiobiotin syn  98.2 0.00016   4E-09   52.1  15.1  174  113-300     1-206 (223)
 65 PRK13232 nifH nitrogenase redu  98.2 3.2E-05 8.1E-10   57.0  11.3  161  113-286     3-204 (273)
 66 COG1192 Soj ATPases involved i  98.2 7.1E-06 1.8E-10   61.6   7.2   42  111-152     2-45  (259)
 67 KOG0924 consensus               98.2 1.9E-05 4.8E-10   58.6   9.4  155  112-278   372-553 (1042)
 68 pfam06564 YhjQ YhjQ protein. T  98.2 3.6E-05 9.1E-10   56.6  10.7  149  113-281     3-189 (244)
 69 PRK13185 chlL protochlorophyll  98.2 0.00015 3.9E-09   52.1  13.9  186  112-315     3-249 (269)
 70 PRK13705 plasmid-partitioning   98.2 4.2E-06 1.1E-10   63.2   5.6   43  108-150   103-147 (388)
 71 PRK11670 putative ATPase; Prov  98.2 9.1E-05 2.3E-09   53.8  12.4  163  111-291   107-312 (369)
 72 COG1643 HrpA HrpA-like helicas  98.1 4.3E-05 1.1E-09   56.0  10.5  134  112-254    66-216 (845)
 73 TIGR00750 lao LAO/AO transport  98.1 1.9E-05 4.7E-10   58.6   8.5  143  108-269    35-195 (333)
 74 CHL00175 minD septum-site dete  98.1 7.7E-05   2E-09   54.3  11.5  163  112-290    14-212 (279)
 75 cd01983 Fer4_NifH The Fer4_Nif  98.1 3.9E-06   1E-10   63.3   4.7   50  113-210     1-50  (99)
 76 pfam00009 GTP_EFTU Elongation   98.1 5.2E-05 1.3E-09   55.5  10.3  155  112-300     4-177 (185)
 77 pfam03029 ATP_bind_1 Conserved  98.1 1.9E-05 4.8E-10   58.5   8.0  137  116-270     1-168 (234)
 78 PRK01077 cobyrinic acid a,c-di  98.1 0.00012 3.1E-09   52.9  11.8  163  113-299     5-185 (451)
 79 cd04163 Era Era subfamily.  Er  98.1 0.00016 4.1E-09   52.1  12.4  147  113-300     5-162 (168)
 80 PRK09401 reverse gyrase; Revie  98.1 1.7E-05 4.4E-10   58.8   7.5   57  113-169    95-152 (1176)
 81 PRK13230 nitrogenase reductase  98.1 6.5E-05 1.6E-09   54.8  10.4   38  113-150     3-40  (292)
 82 PHA02519 plasmid partition pro  98.1 9.2E-06 2.4E-10   60.7   5.8   42  108-149   103-146 (387)
 83 COG1341 Predicted GTPase or GT  98.0 3.9E-05   1E-09   56.3   8.8  120  108-239    70-210 (398)
 84 PRK03003 engA GTP-binding prot  98.0 0.00026 6.5E-09   50.6  12.7  171   86-299   188-374 (474)
 85 PRK10463 hydrogenase nickel in  98.0 5.9E-05 1.5E-09   55.1   9.3  167  109-298   102-280 (290)
 86 cd01878 HflX HflX subfamily.    98.0  0.0004   1E-08   49.3  13.5  147  113-300    43-198 (204)
 87 KOG0922 consensus               98.0 7.9E-05   2E-09   54.2   9.7  159  112-282    67-252 (674)
 88 KOG1805 consensus               98.0 3.7E-05 9.4E-10   56.5   7.4   52  114-168   688-739 (1100)
 89 COG3640 CooC CO dehydrogenase   98.0 0.00014 3.5E-09   52.5  10.3  170  113-311     2-229 (255)
 90 TIGR03348 VI_IcmF type VI secr  97.9 3.8E-05 9.6E-10   56.5   6.9  133  113-278   113-265 (1169)
 91 PRK06067 flagellar accessory p  97.9 5.9E-05 1.5E-09   55.1   7.6   94  110-203    31-137 (241)
 92 pfam06745 KaiC KaiC. This fami  97.9 0.00052 1.3E-08   48.5  12.5   56  110-169    18-74  (231)
 93 pfam06414 Zeta_toxin Zeta toxi  97.9 7.3E-05 1.9E-09   54.4   8.0  103  107-216     8-113 (191)
 94 COG0455 flhG Antiactivator of   97.9 0.00055 1.4E-08   48.3  12.3  164  111-291     2-204 (262)
 95 COG0467 RAD55 RecA-superfamily  97.9 0.00017 4.3E-09   51.9   9.7  147  111-267    23-194 (260)
 96 cd00009 AAA The AAA+ (ATPases   97.9 9.5E-05 2.4E-09   53.6   8.4   79  110-205    18-96  (151)
 97 cd01394 radB RadB. The archaea  97.9 0.00042 1.1E-08   49.1  11.2   93  111-203    19-113 (218)
 98 PRK12374 putative dithiobiotin  97.8  0.0028 7.1E-08   43.3  15.3  180  114-309     5-214 (231)
 99 COG0489 Mrp ATPases involved i  97.8 0.00044 1.1E-08   49.0  11.2   51  110-160    56-107 (265)
100 PRK06526 transposase; Provisio  97.8 0.00019 4.9E-09   51.5   9.3  153   45-227    34-190 (254)
101 cd01120 RecA-like_NTPases RecA  97.8 0.00017 4.5E-09   51.8   8.9   95  113-207     1-99  (165)
102 PRK13236 nitrogenase reductase  97.8  0.0013 3.3E-08   45.7  13.1  168  109-288     4-212 (295)
103 PRK09183 transposase/IS protei  97.8 0.00029 7.5E-09   50.2   9.8  154   45-227    37-194 (258)
104 COG2805 PilT Tfp pilus assembl  97.8 0.00016 4.1E-09   52.0   8.4   94  112-224   126-219 (353)
105 PRK04220 2-phosphoglycerate ki  97.8 0.00018 4.5E-09   51.7   8.7  237   48-318    21-300 (306)
106 pfam03796 DnaB_C DnaB-like hel  97.8 0.00047 1.2E-08   48.8  10.8   90  111-204    19-112 (186)
107 PRK05291 trmE tRNA modificatio  97.8 0.00025 6.5E-09   50.6   9.3  162   87-302   195-362 (445)
108 PRK09302 circadian clock prote  97.8 0.00019   5E-09   51.5   8.5   90  110-203   265-366 (501)
109 PRK13234 nifH nitrogenase redu  97.8  0.0025 6.4E-08   43.6  14.0  164  111-289     4-211 (293)
110 TIGR02397 dnaX_nterm DNA polym  97.8 0.00014 3.5E-09   52.5   7.5   96  109-241    34-154 (363)
111 PRK08533 flagellar accessory p  97.8 0.00037 9.6E-09   49.5   9.7   95  110-204    23-128 (230)
112 TIGR01967 DEAH_box_HrpA ATP-de  97.8  0.0025 6.5E-08   43.6  13.9  205   15-255     3-235 (1320)
113 cd01122 GP4d_helicase GP4d_hel  97.8 0.00055 1.4E-08   48.3  10.5   58  111-170    30-88  (271)
114 TIGR03346 chaperone_ClpB ATP-d  97.8  0.0031 7.9E-08   43.0  14.3  129  107-246   590-722 (852)
115 cd01895 EngA2 EngA2 subfamily.  97.7 0.00061 1.5E-08   48.0  10.4  151  111-300     2-168 (174)
116 cd01131 PilT Pilus retraction   97.7  0.0001 2.7E-09   53.4   6.4   79  112-200     2-81  (198)
117 cd02034 CooC The accessory pro  97.7 0.00011 2.8E-09   53.2   6.4   80  114-202     2-95  (116)
118 PRK11664 ATP-dependent RNA hel  97.7 0.00047 1.2E-08   48.8   9.6  131  113-257    22-169 (812)
119 TIGR03574 selen_PSTK L-seryl-t  97.7 5.9E-05 1.5E-09   55.1   4.9   92  113-221     1-92  (249)
120 cd04164 trmE TrmE (MnmE, ThdF,  97.7 0.00091 2.3E-08   46.7  11.0  144  114-300     4-150 (157)
121 PRK07133 DNA polymerase III su  97.7 0.00017 4.4E-09   51.8   7.1  116  109-243    38-158 (718)
122 COG1110 Reverse gyrase [DNA re  97.7 0.00019 4.9E-09   51.5   7.2  177  113-291    99-344 (1187)
123 TIGR01054 rgy reverse gyrase;   97.7 0.00011 2.8E-09   53.2   5.8   90  113-203   101-195 (1843)
124 PRK10875 recD exonuclease V su  97.7 0.00077   2E-08   47.2  10.2  114  112-239   163-296 (607)
125 cd02028 UMPK_like Uridine mono  97.7 4.8E-05 1.2E-09   55.7   4.0   40  113-152     1-40  (179)
126 COG1618 Predicted nucleotide k  97.7 5.6E-05 1.4E-09   55.2   4.2  102  111-214     5-121 (179)
127 COG4240 Predicted kinase [Gene  97.7 0.00078   2E-08   47.2  10.0   57  107-163    46-103 (300)
128 PRK00784 cobyric acid synthase  97.7  0.0024   6E-08   43.8  12.5  179  113-299     5-232 (492)
129 PRK04328 hypothetical protein;  97.7  0.0015 3.8E-08   45.3  11.4   56  110-169    23-78  (250)
130 PRK05541 adenylylsulfate kinas  97.6 5.3E-05 1.4E-09   55.4   3.8   46  107-152     3-48  (176)
131 COG2804 PulE Type II secretory  97.6   8E-05 2.1E-09   54.1   4.6   77  111-201   258-335 (500)
132 pfam01591 6PF2K 6-phosphofruct  97.6  0.0088 2.2E-07   39.9  15.0  180  107-313     9-219 (223)
133 PRK06647 DNA polymerase III su  97.6 0.00084 2.1E-08   47.0   9.7  120  109-244    36-161 (560)
134 TIGR03015 pepcterm_ATPase puta  97.6 0.00063 1.6E-08   47.9   8.9  143  110-269    42-195 (269)
135 PRK00093 engA GTP-binding prot  97.6  0.0019   5E-08   44.4  11.4  171   86-300   152-338 (438)
136 PRK05896 DNA polymerase III su  97.6  0.0012   3E-08   46.0  10.3  121  108-245    35-162 (613)
137 PRK07270 DNA polymerase III su  97.6  0.0081 2.1E-07   40.1  14.4  106  109-244    35-160 (557)
138 PRK08181 transposase; Validate  97.6 0.00079   2E-08   47.2   9.0  152   46-227    42-198 (269)
139 cd00984 DnaB_C DnaB helicase C  97.6  0.0016   4E-08   45.1  10.4   91  111-204    13-106 (242)
140 cd01124 KaiC KaiC is a circadi  97.6 0.00048 1.2E-08   48.7   7.7   52  114-169     2-53  (187)
141 PRK11537 putative GTP-binding   97.5  0.0089 2.3E-07   39.8  13.9  174  112-294     5-190 (317)
142 COG3523 IcmF Type VI protein s  97.5 0.00061 1.5E-08   48.0   7.9  123  114-271   128-271 (1188)
143 cd01887 IF2_eIF5B IF2/eIF5B (i  97.5 0.00095 2.4E-08   46.6   8.9  142  113-300     2-159 (168)
144 PRK10787 DNA-binding ATP-depen  97.5   0.012 3.1E-07   38.9  17.7  168   44-215   249-485 (784)
145 TIGR01968 minD_bact septum sit  97.5 8.8E-05 2.3E-09   53.9   3.4   45  117-168     8-52  (272)
146 pfam01583 APS_kinase Adenylyls  97.5 0.00011 2.7E-09   53.3   3.7   43  110-152     1-43  (157)
147 cd00881 GTP_translation_factor  97.5  0.0047 1.2E-07   41.7  12.1  148  114-298     2-178 (189)
148 PRK06674 DNA polymerase III su  97.5  0.0039 9.8E-08   42.3  11.7   28  109-136    36-63  (563)
149 PRK13896 cobyrinic acid a,c-di  97.5  0.0041   1E-07   42.2  11.8  171  114-313     4-187 (432)
150 TIGR03345 VI_ClpV1 type VI sec  97.5  0.0047 1.2E-07   41.7  12.0  127  108-246   592-723 (852)
151 pfam08433 KTI12 Chromatin asso  97.5 0.00022 5.6E-09   51.1   5.0   74  114-201     2-76  (266)
152 PRK08451 DNA polymerase III su  97.5 0.00091 2.3E-08   46.8   8.1  118  108-242    33-156 (523)
153 PRK06696 uridine kinase; Valid  97.4 0.00016 4.1E-09   52.0   4.0   47  108-154    23-69  (227)
154 pfam03266 DUF265 Protein of un  97.4 0.00036 9.1E-09   49.6   5.8  116  114-238     2-133 (168)
155 smart00487 DEXDc DEAD-like hel  97.4   0.003 7.7E-08   43.1  10.6  132  112-253    25-182 (201)
156 cd04165 GTPBP1_like GTPBP1-lik  97.4  0.0013 3.4E-08   45.6   8.7  134  114-272     2-154 (224)
157 cd03112 CobW_like The function  97.4  0.0013 3.2E-08   45.8   8.6  146  113-267     2-157 (158)
158 pfam00154 RecA recA bacterial   97.4  0.0025 6.4E-08   43.6  10.1   95  112-214    53-151 (322)
159 KOG1532 consensus               97.4 0.00049 1.3E-08   48.6   6.4   43  107-149    15-57  (366)
160 CHL00095 clpC Clp protease ATP  97.4  0.0035 8.8E-08   42.7  10.7  128  107-246   534-666 (823)
161 PRK04301 radA DNA repair and r  97.4   0.012   3E-07   38.9  13.4  144   55-203    45-209 (318)
162 PRK03846 adenylylsulfate kinas  97.4 0.00015 3.9E-09   52.2   3.7   46  108-153    21-66  (198)
163 PRK07940 DNA polymerase III su  97.4   0.004   1E-07   42.2  10.9  162   80-256     9-174 (395)
164 cd00880 Era_like Era (E. coli   97.4   0.004   1E-07   42.2  10.9  145  116-300     1-157 (163)
165 cd01894 EngA1 EngA1 subfamily.  97.4  0.0037 9.5E-08   42.4  10.7  145  115-299     1-150 (157)
166 PRK05342 clpX ATP-dependent pr  97.4  0.0012 3.1E-08   45.9   8.2   69  111-200   109-181 (411)
167 KOG0923 consensus               97.4 0.00076 1.9E-08   47.3   7.1  187  111-319   280-506 (902)
168 PRK07003 DNA polymerase III su  97.4  0.0098 2.5E-07   39.5  12.8   27  110-136    37-63  (816)
169 PRK12402 replication factor C   97.4 0.00044 1.1E-08   49.0   5.9   98  109-210    35-142 (337)
170 TIGR02928 TIGR02928 orc1/cdc6   97.4  0.0039   1E-07   42.3  10.7  112   82-205    23-148 (383)
171 TIGR00073 hypB hydrogenase acc  97.4 0.00045 1.2E-08   48.9   5.8  144  108-274    31-182 (225)
172 PRK10436 hypothetical protein;  97.4 0.00021 5.4E-09   51.2   4.1   79  110-202   214-293 (461)
173 PRK10751 molybdopterin-guanine  97.4 0.00011 2.9E-09   53.1   2.7   37  113-149     4-40  (170)
174 TIGR02533 type_II_gspE general  97.4 0.00015 3.7E-09   52.3   3.2   74  111-200   245-321 (495)
175 PRK00093 engA GTP-binding prot  97.4  0.0099 2.5E-07   39.5  12.5  146  113-299     3-155 (438)
176 COG0542 clpA ATP-binding subun  97.4  0.0071 1.8E-07   40.5  11.7  143   80-248   495-650 (786)
177 TIGR00763 lon ATP-dependent pr  97.4  0.0076 1.9E-07   40.3  11.8   78  108-200   446-524 (941)
178 pfam00437 GSPII_E Type II/IV s  97.4 6.9E-05 1.8E-09   54.6   1.4   34  112-145   140-173 (283)
179 PRK05480 uridine kinase; Provi  97.3 0.00024 6.1E-09   50.8   4.1   41  108-150     3-43  (209)
180 cd03116 MobB Molybdenum is an   97.3  0.0002 5.1E-09   51.4   3.6   71  111-206     1-71  (159)
181 pfam01695 IstB IstB-like ATP b  97.3  0.0029 7.4E-08   43.2   9.4   96  111-230    47-142 (178)
182 cd01891 TypA_BipA TypA (tyrosi  97.3   0.017 4.4E-07   37.8  13.1  152  113-301     4-176 (194)
183 PRK06645 DNA polymerase III su  97.3  0.0012   3E-08   46.0   7.1  119  109-242    41-167 (507)
184 PRK04195 replication factor C   97.3  0.0061 1.6E-07   40.9  10.7   84  112-219    41-127 (403)
185 PRK13869 plasmid-partitioning   97.3 0.00022 5.7E-09   51.0   3.3   43  109-151   119-162 (405)
186 PRK06872 DNA polymerase III su  97.3   0.012   3E-07   39.0  12.2   28  109-136    36-63  (696)
187 PRK00313 lpxK tetraacyldisacch  97.3  0.0021 5.3E-08   44.3   8.3   78  117-202    59-153 (332)
188 PRK11448 hsdR type I restricti  97.3 0.00027 6.9E-09   50.5   3.7  135  112-254   437-606 (1126)
189 PRK12337 2-phosphoglycerate ki  97.3  0.0021 5.5E-08   44.1   8.3  100   49-152   192-299 (492)
190 TIGR03594 GTPase_EngA ribosome  97.3  0.0097 2.5E-07   39.5  11.6  175   85-300   148-337 (429)
191 PRK11034 clpA ATP-dependent Cl  97.3  0.0021 5.4E-08   44.2   8.2   80  108-208   484-572 (758)
192 PRK09112 DNA polymerase III su  97.3  0.0017 4.5E-08   44.8   7.7  132  108-250    42-189 (352)
193 PRK00889 adenylylsulfate kinas  97.3 0.00031   8E-09   50.0   3.9   45  109-153     2-46  (175)
194 TIGR03453 partition_RepA plasm  97.3 0.00025 6.3E-09   50.7   3.3   43  108-150   101-144 (387)
195 PRK08691 DNA polymerase III su  97.3    0.02 5.1E-07   37.3  13.1   27  110-136    37-63  (704)
196 KOG2878 consensus               97.2  0.0014 3.6E-08   45.4   7.0   85  106-190    26-115 (282)
197 COG2074 2-phosphoglycerate kin  97.2  0.0021 5.3E-08   44.2   7.9   99   49-151    20-125 (299)
198 PRK10865 protein disaggregatio  97.2  0.0013 3.3E-08   45.7   6.8  130  107-248   593-727 (857)
199 PRK07952 DNA replication prote  97.2  0.0024   6E-08   43.8   8.1   93  110-224    95-187 (242)
200 PRK05648 DNA polymerase III su  97.2  0.0019 4.7E-08   44.6   7.5   27  110-136    37-63  (705)
201 PRK06835 DNA replication prote  97.2  0.0041   1E-07   42.2   9.3   85  112-215   184-268 (330)
202 PRK08233 hypothetical protein;  97.2   0.002   5E-08   44.4   7.6   84  109-202     1-86  (182)
203 PRK05563 DNA polymerase III su  97.2  0.0074 1.9E-07   40.4  10.5   28  109-136    36-63  (541)
204 PRK00454 engB GTPase EngB; Rev  97.2   0.025 6.3E-07   36.7  13.1  152  105-302    19-191 (196)
205 KOG0925 consensus               97.2  0.0017 4.3E-08   44.9   7.1  177  112-299    63-270 (699)
206 PRK09270 frcK putative fructos  97.2 0.00049 1.2E-08   48.7   4.3   43  108-150    31-75  (230)
207 PRK03003 engA GTP-binding prot  97.2  0.0095 2.4E-07   39.6  10.9  152  107-299    34-191 (474)
208 cd03109 DTBS Dethiobiotin synt  97.2   0.016   4E-07   38.1  12.0  116  119-287     7-130 (134)
209 cd01876 YihA_EngB The YihA (En  97.2   0.008 2.1E-07   40.1  10.5  148  114-301     2-165 (170)
210 cd01121 Sms Sms (bacterial rad  97.2  0.0037 9.3E-08   42.5   8.7   88  111-206    82-171 (372)
211 PRK08770 DNA polymerase III su  97.2   0.003 7.7E-08   43.1   8.3   28  109-136    36-63  (663)
212 cd02027 APSK Adenosine 5'-phos  97.2 0.00034 8.6E-09   49.8   3.4   40  113-152     1-40  (149)
213 COG0470 HolB ATPase involved i  97.2  0.0035   9E-08   42.6   8.6  114  109-251    22-158 (325)
214 PRK12323 DNA polymerase III su  97.2   0.023   6E-07   36.9  12.8   28  109-136    36-63  (721)
215 pfam02606 LpxK Tetraacyldisacc  97.2  0.0034 8.7E-08   42.7   8.5   78  117-202    43-136 (318)
216 PRK13695 putative NTPase; Prov  97.2 0.00067 1.7E-08   47.7   4.7  101  111-223     3-127 (174)
217 cd01898 Obg Obg subfamily.  Th  97.2   0.004   1E-07   42.3   8.7  143  114-300     3-164 (170)
218 PRK00440 rfc replication facto  97.2  0.0034 8.8E-08   42.7   8.3   29  109-138    36-64  (318)
219 cd02023 UMPK Uridine monophosp  97.2 0.00046 1.2E-08   48.8   3.8   36  113-150     1-36  (198)
220 pfam08423 Rad51 Rad51. Rad51 i  97.1  0.0074 1.9E-07   40.4   9.9  127   57-203     6-148 (261)
221 PRK00652 lpxK tetraacyldisacch  97.1  0.0036 9.2E-08   42.5   8.3   78  117-202    57-150 (334)
222 TIGR02639 ClpA ATP-dependent C  97.1 0.00045 1.1E-08   48.9   3.6  132    3-135   371-551 (774)
223 cd01129 PulE-GspE PulE/GspE Th  97.1 0.00056 1.4E-08   48.2   4.0  147  111-294    80-226 (264)
224 PRK09111 DNA polymerase III su  97.1  0.0035   9E-08   42.6   8.1  119  109-242    43-170 (600)
225 PRK08853 DNA polymerase III su  97.1    0.02   5E-07   37.4  11.9   27  110-136    37-63  (717)
226 COG0466 Lon ATP-dependent Lon   97.1   0.032 8.3E-07   35.9  14.9  197   15-215   216-487 (782)
227 cd04160 Arfrp1 Arfrp1 subfamil  97.1  0.0015 3.8E-08   45.3   6.1  139  114-298     2-160 (167)
228 COG1072 CoaA Panthothenate kin  97.1  0.0025 6.3E-08   43.7   7.2   47  106-152    77-125 (283)
229 PRK07471 DNA polymerase III su  97.1  0.0034 8.6E-08   42.8   7.8  134  108-251    36-188 (363)
230 cd00983 recA RecA is a  bacter  97.1  0.0029 7.4E-08   43.2   7.5   92  112-211    56-151 (325)
231 PRK07994 DNA polymerase III su  97.1   0.027 6.9E-07   36.4  12.4   27  110-136    37-63  (643)
232 cd04170 EF-G_bact Elongation f  97.1  0.0018 4.7E-08   44.6   6.3  142  114-288     2-150 (268)
233 pfam02421 FeoB_N Ferrous iron   97.1  0.0032 8.1E-08   43.0   7.5  147  113-300     1-153 (188)
234 PRK06305 DNA polymerase III su  97.1 0.00086 2.2E-08   46.9   4.6  118  109-241    37-159 (462)
235 TIGR02173 cyt_kin_arch cytidyl  97.1 0.00091 2.3E-08   46.7   4.7   72  113-198     2-77  (173)
236 cd03216 ABC_Carb_Monos_I This   97.1  0.0029 7.4E-08   43.2   7.3  102  110-222    25-128 (163)
237 COG0563 Adk Adenylate kinase a  97.1  0.0021 5.3E-08   44.2   6.5   93  113-213     2-97  (178)
238 cd04155 Arl3 Arl3 subfamily.    97.1  0.0013 3.2E-08   45.7   5.3  138  108-297    11-165 (173)
239 cd04153 Arl5_Arl8 Arl5/Arl8 su  97.1   0.005 1.3E-07   41.5   8.4  138  108-297    12-166 (174)
240 cd02021 GntK Gluconate kinase   97.1  0.0019 4.9E-08   44.5   6.2   81  113-204     1-83  (150)
241 pfam05970 DUF889 PIF1 helicase  97.0  0.0041   1E-07   42.2   7.8  117  118-239     1-121 (418)
242 PRK01906 tetraacyldisaccharide  97.0  0.0054 1.4E-07   41.3   8.3   84  117-201    64-175 (339)
243 COG0523 Putative GTPases (G3E   97.0  0.0048 1.2E-07   41.7   7.9  168  113-294     3-187 (323)
244 cd04171 SelB SelB subfamily.    97.0  0.0021 5.2E-08   44.3   6.0  143  113-300     2-159 (164)
245 pfam03205 MobB Molybdopterin g  97.0 0.00089 2.3E-08   46.8   4.1   37  113-149     2-39  (122)
246 cd01393 recA_like RecA is a  b  97.0   0.011 2.7E-07   39.2   9.6   92  112-203    20-124 (226)
247 CHL00181 cbbX CbbX; Provisiona  97.0  0.0062 1.6E-07   40.9   8.4   29  112-140    60-88  (287)
248 PRK11823 DNA repair protein Ra  97.0  0.0071 1.8E-07   40.5   8.6   86  111-205    90-177 (454)
249 PRK07667 uridine kinase; Provi  97.0  0.0011 2.8E-08   46.1   4.5   42  109-150    12-53  (190)
250 pfam10662 PduV-EutP Ethanolami  97.0  0.0098 2.5E-07   39.5   9.3  127  114-300     4-139 (143)
251 cd02025 PanK Pantothenate kina  97.0  0.0015 3.9E-08   45.2   5.2   38  113-150     1-40  (220)
252 PRK07764 DNA polymerase III su  97.0   0.017 4.5E-07   37.7  10.5  118  109-242    35-159 (775)
253 smart00178 SAR Sar1p-like memb  97.0  0.0066 1.7E-07   40.7   8.4  134  108-315    14-147 (184)
254 PRK09302 circadian clock prote  97.0   0.041   1E-06   35.1  12.4  109  110-223    23-157 (501)
255 TIGR03594 GTPase_EngA ribosome  96.9   0.016   4E-07   38.1  10.1  146  113-299     1-152 (429)
256 PTZ00301 uridine kinase; Provi  96.9  0.0012   3E-08   45.9   4.3   42  110-151     2-45  (210)
257 cd04169 RF3 RF3 subfamily.  Pe  96.9  0.0023 5.8E-08   44.0   5.7  141  111-286     2-155 (267)
258 PRK08116 hypothetical protein;  96.9  0.0068 1.7E-07   40.6   8.2   92  113-225   110-201 (262)
259 cd01879 FeoB Ferrous iron tran  96.9   0.002 5.2E-08   44.3   5.4  143  116-300     1-150 (158)
260 COG2403 Predicted GTPase [Gene  96.9    0.01 2.6E-07   39.4   8.9  137  108-272   124-284 (449)
261 cd01883 EF1_alpha Eukaryotic e  96.9  0.0028 7.3E-08   43.3   6.1  125  114-269     2-150 (219)
262 PRK10037 cell division protein  96.9  0.0012   3E-08   46.0   4.1  151  112-282     2-190 (250)
263 COG1797 CobB Cobyrinic acid a,  96.9   0.014 3.5E-07   38.5   9.5  164  114-300     3-184 (451)
264 COG1066 Sms Predicted ATP-depe  96.9   0.018 4.5E-07   37.7  10.0   90  111-209    93-184 (456)
265 PRK08769 DNA polymerase III su  96.9  0.0037 9.3E-08   42.5   6.4  127  108-250    23-161 (319)
266 pfam00485 PRK Phosphoribulokin  96.9 0.00066 1.7E-08   47.7   2.6   36  113-148     1-36  (196)
267 PRK05564 DNA polymerase III su  96.9  0.0041   1E-07   42.2   6.6  114  108-250    23-141 (313)
268 COG1763 MobB Molybdopterin-gua  96.9  0.0012 2.9E-08   46.0   3.8  153  111-310     2-159 (161)
269 PRK00411 cdc6 cell division co  96.9  0.0098 2.5E-07   39.5   8.6  105  109-217    53-164 (394)
270 PTZ00141 elongation factor 1 a  96.9    0.02 5.1E-07   37.3  10.1  135  108-270     3-159 (443)
271 PRK12377 putative replication   96.9   0.006 1.5E-07   41.0   7.4   94  107-223    97-190 (248)
272 COG0486 ThdF Predicted GTPase   96.9  0.0017 4.3E-08   44.9   4.6  174   87-308   196-377 (454)
273 cd00879 Sar1 Sar1 subfamily.    96.9  0.0028   7E-08   43.4   5.7   98  107-255    15-112 (190)
274 cd04105 SR_beta Signal recogni  96.9  0.0049 1.3E-07   41.6   6.9   98  113-256     2-100 (203)
275 cd04154 Arl2 Arl2 subfamily.    96.9  0.0053 1.3E-07   41.4   7.1  139  108-298    11-166 (173)
276 TIGR03598 GTPase_YsxC ribosome  96.9   0.053 1.4E-06   34.4  14.4  149  105-296    13-179 (179)
277 PRK09354 recA recombinase A; P  96.9  0.0062 1.6E-07   40.9   7.4   92  112-211    61-156 (350)
278 cd01881 Obg_like The Obg-like   96.9   0.022 5.6E-07   37.0  10.2   98  193-299    43-169 (176)
279 PRK09518 bifunctional cytidyla  96.8   0.055 1.4E-06   34.3  12.3  146  113-299   281-432 (714)
280 KOG1051 consensus               96.8   0.024   6E-07   36.8  10.3  121  109-246   589-715 (898)
281 COG2894 MinD Septum formation   96.8  0.0012 3.2E-08   45.8   3.6  180  113-314     5-249 (272)
282 PRK09518 bifunctional cytidyla  96.8   0.035 8.9E-07   35.6  10.9  154  109-301   450-617 (714)
283 KOG2004 consensus               96.8   0.058 1.5E-06   34.1  12.9  100  107-206   434-565 (906)
284 pfam00025 Arf ADP-ribosylation  96.8  0.0028 7.1E-08   43.4   5.2  139  108-298    11-166 (174)
285 cd03238 ABC_UvrA The excision   96.8  0.0063 1.6E-07   40.9   7.0   53  111-163    21-73  (176)
286 cd03111 CpaE_like This protein  96.8    0.01 2.6E-07   39.3   8.1   38  113-150     1-40  (106)
287 cd04168 TetM_like Tet(M)-like   96.8  0.0075 1.9E-07   40.3   7.3  142  114-293     2-155 (237)
288 pfam04851 ResIII Type III rest  96.8  0.0047 1.2E-07   41.8   6.2   59  114-208    21-79  (103)
289 TIGR00176 mobB molybdopterin-g  96.7  0.0013 3.4E-08   45.6   3.3  119  113-271     1-123 (165)
290 cd04150 Arf1_5_like Arf1-Arf5-  96.7  0.0035 8.8E-08   42.7   5.4  134  113-297     2-151 (159)
291 TIGR02903 spore_lon_C ATP-depe  96.7   0.013 3.4E-07   38.5   8.4   82  111-205   176-278 (616)
292 pfam09439 SRPRB Signal recogni  96.7  0.0063 1.6E-07   40.9   6.7   98  113-256     5-103 (181)
293 PRK00698 tmk thymidylate kinas  96.7  0.0054 1.4E-07   41.3   6.3   47  113-162     5-53  (204)
294 KOG0926 consensus               96.7   0.014 3.6E-07   38.4   8.3  129  113-242   273-425 (1172)
295 cd01890 LepA LepA subfamily.    96.7  0.0052 1.3E-07   41.5   6.0  154  114-299     3-169 (179)
296 TIGR00101 ureG urease accessor  96.7   0.027 6.8E-07   36.5   9.5  159  114-291     4-178 (199)
297 PRK13643 cbiO cobalt transport  96.7  0.0026 6.6E-08   43.6   4.3   56  112-167    33-88  (288)
298 TIGR03420 DnaA_homol_Hda DnaA   96.7   0.015 3.9E-07   38.1   8.2  135  112-285    39-178 (226)
299 cd01886 EF-G Elongation factor  96.6  0.0077   2E-07   40.2   6.6  139  114-289     2-151 (270)
300 cd04149 Arf6 Arf6 subfamily.    96.6   0.011 2.8E-07   39.2   7.3  137  108-296     6-159 (168)
301 TIGR00345 arsA arsenite-activa  96.6  0.0019 4.8E-08   44.5   3.4   35  115-149     1-37  (330)
302 TIGR01188 drrA daunorubicin re  96.6   0.001 2.6E-08   46.4   2.0   45  110-154    20-64  (343)
303 cd00046 DEXDc DEAD-like helica  96.6   0.017 4.4E-07   37.8   8.3   51  114-166     3-55  (144)
304 cd00878 Arf_Arl Arf (ADP-ribos  96.6   0.015 3.9E-07   38.1   7.9  133  114-298     2-151 (158)
305 PRK05917 DNA polymerase III su  96.6   0.016   4E-07   38.1   7.9  128  108-258    16-151 (290)
306 PRK12317 elongation factor 1-a  96.6    0.01 2.6E-07   39.4   6.9  134  108-269     3-153 (426)
307 PRK13646 cbiO cobalt transport  96.6  0.0036 9.2E-08   42.6   4.5   57  111-167    33-89  (286)
308 PTZ00133 ADP-ribosylation fact  96.6  0.0081 2.1E-07   40.1   6.3  139  108-298    14-169 (182)
309 cd04158 ARD1 ARD1 subfamily.    96.6  0.0086 2.2E-07   39.9   6.4  147  114-316     2-166 (169)
310 pfam05621 TniB Bacterial TniB   96.6   0.016   4E-07   38.0   7.8  110  106-222    56-179 (302)
311 PRK05595 replicative DNA helic  96.6   0.085 2.2E-06   32.9  19.1  118  111-228   201-349 (444)
312 PRK13766 Hef nuclease; Provisi  96.6   0.083 2.1E-06   33.0  11.4   21  271-291   646-666 (764)
313 PRK01184 hypothetical protein;  96.6   0.021 5.3E-07   37.2   8.3  104  112-241     2-113 (183)
314 cd01428 ADK Adenylate kinase (  96.5   0.007 1.8E-07   40.5   5.8   95  114-215     2-98  (194)
315 PRK08058 DNA polymerase III su  96.5   0.013 3.4E-07   38.5   7.3  130  108-250    25-158 (329)
316 cd01123 Rad51_DMC1_radA Rad51_  96.5   0.045 1.2E-06   34.8  10.0   53  111-166    19-78  (235)
317 PRK00089 era GTP-binding prote  96.5    0.03 7.7E-07   36.1   9.1  152  108-299     5-165 (296)
318 pfam00071 Ras Ras family. Incl  96.5   0.024 6.1E-07   36.8   8.5  138  114-298     2-152 (162)
319 cd01897 NOG NOG1 is a nucleola  96.5   0.079   2E-06   33.1  11.1  147  113-299     2-160 (168)
320 COG1111 MPH1 ERCC4-like helica  96.5   0.073 1.9E-06   33.4  10.9  160  114-290    32-214 (542)
321 COG0572 Udk Uridine kinase [Nu  96.5  0.0027 6.9E-08   43.4   3.6   63  109-173     6-94  (218)
322 PRK05439 pantothenate kinase;   96.5   0.018 4.5E-07   37.7   7.7   46  106-151    81-128 (312)
323 pfam01637 Arch_ATPase Archaeal  96.5   0.054 1.4E-06   34.3  10.2  109  109-219    18-138 (223)
324 PRK13641 cbiO cobalt transport  96.5  0.0033 8.3E-08   42.9   3.9   58  111-168    33-90  (286)
325 pfam00004 AAA ATPase family as  96.5  0.0072 1.8E-07   40.4   5.6   32  114-148     1-32  (131)
326 cd01884 EF_Tu EF-Tu subfamily.  96.5  0.0061 1.5E-07   41.0   5.2  152  114-300     5-176 (195)
327 PRK04040 adenylate kinase; Pro  96.5  0.0074 1.9E-07   40.4   5.6  171  111-312     2-185 (189)
328 cd02033 BchX Chlorophyllide re  96.5  0.0038 9.7E-08   42.4   4.1  161  107-288    27-236 (329)
329 PRK05537 bifunctional sulfate   96.5  0.0099 2.5E-07   39.5   6.2   47  108-154   389-436 (568)
330 cd04162 Arl9_Arfrp2_like Arl9/  96.5   0.022 5.6E-07   37.0   7.9  126  114-317     2-130 (164)
331 TIGR03600 phage_DnaB phage rep  96.5   0.098 2.5E-06   32.5  12.2   89  111-205   194-288 (421)
332 PRK06761 hypothetical protein;  96.4  0.0048 1.2E-07   41.7   4.5   41  113-153     4-51  (281)
333 PRK07413 hypothetical protein;  96.4   0.053 1.3E-06   34.4   9.8  175   57-238   139-344 (382)
334 TIGR01085 murE UDP-N-acetylmur  96.4  0.0046 1.2E-07   41.8   4.4   79  113-202    87-167 (494)
335 COG0468 RecA RecA/RadA recombi  96.4   0.022 5.6E-07   37.1   7.8  156  111-290    60-229 (279)
336 COG3598 RepA RecA-family ATPas  96.4   0.026 6.6E-07   36.5   8.2   90  113-202    90-203 (402)
337 PRK02362 ski2-like helicase; P  96.4   0.029 7.3E-07   36.2   8.4  123  114-250    42-189 (736)
338 cd01130 VirB11-like_ATPase Typ  96.4   0.003 7.7E-08   43.1   3.4   78  113-200    27-107 (186)
339 PRK05506 bifunctional sulfate   96.4  0.0036 9.2E-08   42.6   3.7   57  108-164   440-507 (613)
340 PRK11248 tauB taurine transpor  96.4   0.026 6.6E-07   36.5   8.0   38  111-148    27-64  (255)
341 COG0529 CysC Adenylylsulfate k  96.4  0.0042 1.1E-07   42.1   4.0   47  108-154    20-66  (197)
342 PRK05632 phosphate acetyltrans  96.4    0.11 2.7E-06   32.2  15.0   31  114-144     4-35  (702)
343 PRK13644 cbiO cobalt transport  96.4  0.0052 1.3E-07   41.5   4.3   54  111-167    28-81  (274)
344 PRK13342 recombination factor   96.4   0.011 2.9E-07   39.1   6.1   28  109-136    35-62  (417)
345 TIGR01448 recD_rel helicase, R  96.4   0.019 4.8E-07   37.5   7.1  173  111-305   365-560 (769)
346 cd01867 Rab8_Rab10_Rab13_like   96.3   0.053 1.4E-06   34.4   9.4  140  112-298     4-156 (167)
347 COG0132 BioD Dethiobiotin synt  96.3    0.11 2.9E-06   32.1  12.7  163  114-287     5-198 (223)
348 PRK13650 cbiO cobalt transport  96.3  0.0063 1.6E-07   40.8   4.6  164  111-296    30-217 (276)
349 COG1484 DnaC DNA replication p  96.3   0.038 9.8E-07   35.3   8.6   81  110-210   104-184 (254)
350 PRK13640 cbiO cobalt transport  96.3  0.0058 1.5E-07   41.1   4.4   61  111-173    34-94  (283)
351 COG2874 FlaH Predicted ATPases  96.3    0.02 5.1E-07   37.3   7.1  176  111-304    28-222 (235)
352 PRK07132 DNA polymerase III su  96.3   0.019 4.8E-07   37.5   6.9  121  108-254    17-144 (303)
353 PRK06762 hypothetical protein;  96.3    0.01 2.6E-07   39.4   5.6   90  111-217     2-91  (166)
354 PRK05201 hslU ATP-dependent pr  96.3   0.011 2.8E-07   39.2   5.7   27  109-135    48-74  (442)
355 TIGR01447 recD exodeoxyribonuc  96.3  0.0046 1.2E-07   41.8   3.7  123  111-240   242-394 (753)
356 PRK13633 cobalt transporter AT  96.3   0.013 3.2E-07   38.7   6.0   74  111-188    37-110 (281)
357 PTZ00035 Rad51; Provisional     96.3    0.12 3.1E-06   31.9  13.4   88  112-202   131-234 (350)
358 PRK13649 cbiO cobalt transport  96.3  0.0055 1.4E-07   41.3   4.1   58  111-168    33-90  (280)
359 cd03299 ABC_ModC_like Archeal   96.3   0.024 6.1E-07   36.8   7.3  182  111-315    25-234 (235)
360 COG1220 HslU ATP-dependent pro  96.3   0.012 3.1E-07   38.8   5.8   82   63-148     6-95  (444)
361 PRK08699 DNA polymerase III su  96.3   0.016   4E-07   38.1   6.3  130  108-249    18-160 (325)
362 smart00177 ARF ARF-like small   96.3  0.0051 1.3E-07   41.5   3.8  139  107-297     9-164 (175)
363 cd04123 Rab21 Rab21 subfamily.  96.3   0.033 8.5E-07   35.8   8.0  139  113-298     2-153 (162)
364 CHL00071 tufA elongation facto  96.3  0.0081 2.1E-07   40.1   4.8  130  108-270     8-142 (409)
365 pfam07724 AAA_2 AAA domain (Cd  96.3   0.018 4.6E-07   37.7   6.5   86  112-208     4-90  (168)
366 COG0125 Tmk Thymidylate kinase  96.2   0.014 3.5E-07   38.5   5.9   51  111-162     3-53  (208)
367 PRK13651 cobalt transporter AT  96.2  0.0095 2.4E-07   39.6   5.0   58  111-168    33-106 (304)
368 cd04151 Arl1 Arl1 subfamily.    96.2    0.01 2.6E-07   39.4   5.1  131  114-297     2-150 (158)
369 cd00267 ABC_ATPase ABC (ATP-bi  96.2   0.021 5.2E-07   37.3   6.7  102  111-222    25-126 (157)
370 PRK12735 elongation factor Tu;  96.2   0.023 5.8E-07   36.9   6.9  130  108-270     8-142 (396)
371 KOG2825 consensus               96.2  0.0041 1.1E-07   42.1   3.1   41  109-149    16-57  (323)
372 COG1160 Predicted GTPases [Gen  96.2    0.13 3.4E-06   31.5  10.8  170   85-299   153-343 (444)
373 COG4586 ABC-type uncharacteriz  96.2  0.0027 6.9E-08   43.4   2.1   41  111-151    50-90  (325)
374 PRK05707 DNA polymerase III su  96.2   0.038 9.7E-07   35.4   7.9  131  108-251    19-155 (328)
375 PRK13634 cbiO cobalt transport  96.2  0.0062 1.6E-07   40.9   3.9   58  111-168    20-77  (276)
376 cd03267 ABC_NatA_like Similar   96.2  0.0032 8.2E-08   42.9   2.4   66   84-149    19-85  (236)
377 cd03222 ABC_RNaseL_inhibitor T  96.2  0.0076 1.9E-07   40.3   4.3   92  110-220    24-115 (177)
378 COG4152 ABC-type uncharacteriz  96.2   0.018 4.7E-07   37.6   6.2  103  112-214    29-171 (300)
379 PRK00279 adk adenylate kinase;  96.2   0.016 4.2E-07   37.9   6.0   93  114-215     3-99  (215)
380 PTZ00088 adenylate kinase 1; P  96.2  0.0027 6.8E-08   43.5   1.9   40  114-157     3-42  (225)
381 PRK13647 cbiO cobalt transport  96.2  0.0057 1.4E-07   41.2   3.6   41  111-151    31-71  (273)
382 pfam03215 Rad17 Rad17 cell cyc  96.2    0.01 2.6E-07   39.4   4.8  107   85-201    28-169 (490)
383 PRK13409 putative ATPase RIL;   96.1   0.011 2.8E-07   39.1   5.0   28  112-139   366-394 (590)
384 pfam00270 DEAD DEAD/DEAH box h  96.1   0.057 1.5E-06   34.1   8.6   51  114-165    17-69  (167)
385 PRK13537 lipooligosaccharide t  96.1  0.0069 1.8E-07   40.6   3.9  100  110-209    30-172 (304)
386 PRK07429 phosphoribulokinase;   96.1  0.0078   2E-07   40.2   4.1  110  107-218     4-164 (331)
387 cd03214 ABC_Iron-Siderophores_  96.1   0.024   6E-07   36.8   6.6   41  111-151    25-65  (180)
388 cd00154 Rab Rab family.  Rab G  96.1    0.08   2E-06   33.1   9.3  139  113-298     2-153 (159)
389 TIGR00606 rad50 rad50; InterPr  96.1   0.002 5.1E-08   44.3   1.0   20  115-134    32-51  (1328)
390 PTZ00336 elongation factor 1-a  96.1   0.033 8.3E-07   35.8   7.2  132  108-268     3-157 (449)
391 PRK05636 replicative DNA helic  96.1   0.052 1.3E-06   34.4   8.2   39  110-148   266-305 (507)
392 TIGR00450 thdF tRNA modificati  96.1    0.07 1.8E-06   33.5   8.9  179   46-269   161-346 (473)
393 TIGR00958 3a01208 antigen pept  96.1  0.0043 1.1E-07   42.0   2.7   37  112-148   560-596 (770)
394 COG5008 PilU Tfp pilus assembl  96.1    0.13 3.2E-06   31.7  10.2  142  111-273   127-283 (375)
395 TIGR02538 type_IV_pilB type IV  96.1  0.0026 6.7E-08   43.5   1.5   75  109-200   323-402 (577)
396 PRK11545 gntK gluconate kinase  96.1  0.0062 1.6E-07   40.9   3.4   42  108-154     5-46  (177)
397 PRK13642 cbiO cobalt transport  96.1  0.0047 1.2E-07   41.7   2.8  165  111-296    33-220 (277)
398 PRK00741 prfC peptide chain re  96.1  0.0074 1.9E-07   40.4   3.8  137  110-285     9-162 (526)
399 KOG1533 consensus               96.1  0.0058 1.5E-07   41.1   3.2  113  111-224     2-126 (290)
400 COG3854 SpoIIIAA ncharacterize  96.1   0.016   4E-07   38.1   5.4   83  114-205   140-230 (308)
401 PRK02496 adk adenylate kinase;  96.1   0.019 4.9E-07   37.4   5.9   95  114-215     4-100 (185)
402 COG4555 NatA ABC-type Na+ tran  96.0  0.0059 1.5E-07   41.1   3.2   95  110-215    27-121 (245)
403 PRK00091 miaA tRNA delta(2)-is  96.0  0.0062 1.6E-07   40.9   3.3   35  110-149     3-37  (304)
404 pfam04548 AIG1 AIG1 family. Ar  96.0   0.017 4.3E-07   37.9   5.5  118  114-268     3-128 (200)
405 PRK11000 maltose/maltodextrin   96.0   0.041   1E-06   35.1   7.5   26  111-136    29-54  (369)
406 PRK03992 proteasome-activating  96.0   0.067 1.7E-06   33.7   8.5  136   82-250   138-288 (390)
407 cd03257 ABC_NikE_OppD_transpor  96.0   0.013 3.3E-07   38.7   4.8   57  110-167    30-86  (228)
408 cd01672 TMPK Thymidine monopho  96.0  0.0086 2.2E-07   39.9   3.9   35  113-147     2-36  (200)
409 COG2812 DnaX DNA polymerase II  96.0  0.0037 9.5E-08   42.5   2.0  117  109-242    36-158 (515)
410 PRK13632 cbiO cobalt transport  96.0  0.0078   2E-07   40.2   3.7   53  111-167    36-88  (273)
411 cd04166 CysN_ATPS CysN_ATPS su  96.0     0.1 2.6E-06   32.4   9.3  153  114-295     2-182 (208)
412 COG1100 GTPase SAR1 and relate  96.0    0.02   5E-07   37.4   5.6  114  112-271     6-126 (219)
413 cd04161 Arl2l1_Arl13_like Arl2  96.0   0.038 9.8E-07   35.4   7.1  110  114-294     2-111 (167)
414 TIGR00390 hslU heat shock prot  96.0   0.015 3.7E-07   38.3   4.9   67   64-135     4-71  (463)
415 cd03244 ABCC_MRP_domain2 Domai  96.0    0.11 2.7E-06   32.2   9.3   39  112-150    31-69  (221)
416 PRK10851 sulfate/thiosulfate t  96.0   0.059 1.5E-06   34.0   8.0   34  111-144    28-61  (352)
417 cd03265 ABC_DrrA DrrA is the A  95.9  0.0085 2.2E-07   39.9   3.7   39  111-149    26-64  (220)
418 PRK09825 idnK D-gluconate kina  95.9   0.055 1.4E-06   34.3   7.8   39  111-154     3-41  (176)
419 PRK13652 cbiO cobalt transport  95.9   0.006 1.5E-07   41.0   2.8   41  111-151    30-70  (277)
420 cd03255 ABC_MJ0796_Lo1CDE_FtsE  95.9    0.03 7.8E-07   36.1   6.4   57  111-167    30-86  (218)
421 PRK13808 adenylate kinase; Pro  95.9    0.13 3.2E-06   31.7   9.6  143  114-311     3-152 (297)
422 PRK01172 ski2-like helicase; P  95.9    0.11 2.9E-06   32.0   9.3  123  114-250    40-187 (674)
423 PRK11247 ssuB aliphatic sulfon  95.9   0.056 1.4E-06   34.2   7.7   34  111-144    38-71  (257)
424 pfam00406 ADK Adenylate kinase  95.9   0.018 4.6E-07   37.7   5.2   93  116-215     1-95  (186)
425 TIGR02237 recomb_radB DNA repa  95.9    0.04   1E-06   35.3   6.9   88  113-203    14-113 (223)
426 pfam00931 NB-ARC NB-ARC domain  95.9     0.1 2.6E-06   32.4   8.9   89  109-203    17-110 (285)
427 cd03218 ABC_YhbG The ABC trans  95.9  0.0051 1.3E-07   41.5   2.3   48  111-158    26-73  (232)
428 cd01863 Rab18 Rab18 subfamily.  95.9   0.041 1.1E-06   35.1   6.9  139  113-298     2-153 (161)
429 cd04167 Snu114p Snu114p subfam  95.9   0.083 2.1E-06   33.0   8.4  124  113-268     2-135 (213)
430 cd04159 Arl10_like Arl10-like   95.8   0.012   3E-07   38.9   4.0  134  114-298     2-152 (159)
431 cd01882 BMS1 Bms1.  Bms1 is an  95.8   0.015 3.7E-07   38.3   4.5   33  107-139    35-67  (225)
432 TIGR00382 clpX ATP-dependent C  95.8  0.0049 1.3E-07   41.6   2.1   66  112-220   153-231 (452)
433 cd00268 DEADc DEAD-box helicas  95.8     0.2   5E-06   30.4  10.4   86  114-206    39-131 (203)
434 pfam00625 Guanylate_kin Guanyl  95.8   0.019 4.8E-07   37.5   4.9   87  112-203     2-103 (182)
435 KOG0734 consensus               95.8    0.13 3.4E-06   31.5   9.2  161   86-285   310-488 (752)
436 PRK13889 conjugal transfer rel  95.8    0.14 3.6E-06   31.3   9.3  107  109-241   360-472 (992)
437 cd04128 Spg1 Spg1p.  Spg1p (se  95.8    0.13 3.4E-06   31.6   9.2  149  113-312     2-167 (182)
438 PRK06090 DNA polymerase III su  95.8   0.062 1.6E-06   33.9   7.5  121  108-242    22-148 (319)
439 PRK08694 consensus              95.7    0.13 3.2E-06   31.7   8.9  115  112-226   219-366 (468)
440 cd03266 ABC_NatA_sodium_export  95.7   0.013 3.3E-07   38.7   3.8   41  111-151    31-71  (218)
441 cd03240 ABC_Rad50 The catalyti  95.7  0.0074 1.9E-07   40.4   2.6   33  101-135    14-46  (204)
442 pfam05729 NACHT NACHT domain.   95.7  0.0086 2.2E-07   39.9   2.9   26  112-137     1-26  (165)
443 PRK05858 hypothetical protein;  95.7    0.22 5.6E-06   30.0  10.9  118   80-199   136-270 (543)
444 PRK00139 murE UDP-N-acetylmura  95.7   0.034 8.7E-07   35.7   5.8   97  114-217   100-214 (481)
445 cd03296 ABC_CysA_sulfate_impor  95.7   0.074 1.9E-06   33.4   7.5  178  111-312    28-238 (239)
446 PRK13645 cbiO cobalt transport  95.6   0.017 4.2E-07   37.9   4.1   57  111-167    37-94  (289)
447 TIGR03575 selen_PSTK_euk L-ser  95.6   0.014 3.7E-07   38.3   3.8   42  114-155     2-44  (340)
448 PRK12422 chromosomal replicati  95.6   0.068 1.7E-06   33.6   7.2   87  112-221   142-230 (455)
449 PRK13635 cbiO cobalt transport  95.6   0.012 2.9E-07   39.0   3.3   38  112-149    34-71  (279)
450 PRK07560 elongation factor EF-  95.6   0.083 2.1E-06   33.0   7.7   52  257-312   577-642 (730)
451 COG1102 Cmk Cytidylate kinase   95.6    0.01 2.6E-07   39.4   3.0   79  113-206     2-83  (179)
452 PRK08939 primosomal protein Dn  95.6   0.012   3E-07   38.9   3.3  143  112-291   158-301 (306)
453 COG1131 CcmA ABC-type multidru  95.6  0.0062 1.6E-07   40.9   1.9   40  112-151    32-71  (293)
454 cd03269 ABC_putative_ATPase Th  95.6  0.0098 2.5E-07   39.5   2.9   35  110-144    25-59  (210)
455 PRK06921 hypothetical protein;  95.6    0.13 3.2E-06   31.7   8.6   69  111-202   116-185 (265)
456 PRK10895 putative ABC transpor  95.6   0.009 2.3E-07   39.8   2.7   39  111-149    29-67  (241)
457 pfam09848 DUF2075 Uncharacteri  95.6   0.043 1.1E-06   35.0   6.1   90  112-208     2-94  (348)
458 PRK07399 DNA polymerase III su  95.6   0.039   1E-06   35.3   5.9   31  108-138    23-53  (314)
459 cd03245 ABCC_bacteriocin_expor  95.6    0.12   3E-06   31.9   8.4   34  111-144    30-63  (220)
460 COG1120 FepC ABC-type cobalami  95.6  0.0084 2.1E-07   40.0   2.5   42  111-152    28-69  (258)
461 TIGR03522 GldA_ABC_ATP gliding  95.6  0.0078   2E-07   40.2   2.3   34  111-144    28-61  (301)
462 COG1160 Predicted GTPases [Gen  95.6    0.24 6.1E-06   29.8  10.9  148  112-299     4-157 (444)
463 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  95.6    0.11 2.7E-06   32.2   8.0  140  112-298     3-155 (166)
464 PRK13636 cbiO cobalt transport  95.6   0.018 4.5E-07   37.7   4.1   35  111-145    32-66  (285)
465 pfam00265 TK Thymidine kinase.  95.6   0.046 1.2E-06   34.8   6.2   82  113-203     3-86  (175)
466 COG1084 Predicted GTPase [Gene  95.6    0.24 6.2E-06   29.7  14.5  240   19-297    49-325 (346)
467 cd04127 Rab27A Rab27a subfamil  95.6   0.057 1.5E-06   34.1   6.6  146  113-299     6-169 (180)
468 PRK07993 DNA polymerase III su  95.6   0.079   2E-06   33.1   7.4  130  108-250    21-156 (334)
469 cd03235 ABC_Metallic_Cations A  95.6  0.0071 1.8E-07   40.5   2.0   34  111-144    25-58  (213)
470 COG1663 LpxK Tetraacyldisaccha  95.5   0.027 6.9E-07   36.4   4.9   84  111-202    46-150 (336)
471 PRK13637 cbiO cobalt transport  95.5   0.018 4.5E-07   37.7   4.0   55  111-167    33-87  (287)
472 cd03301 ABC_MalK_N The N-termi  95.5   0.082 2.1E-06   33.0   7.3   35  111-145    26-60  (213)
473 cd02024 NRK1 Nicotinamide ribo  95.5   0.011 2.7E-07   39.3   2.8   36  113-152     1-36  (187)
474 PRK00049 elongation factor Tu;  95.5   0.076 1.9E-06   33.3   7.1  129  109-270     9-143 (397)
475 cd01128 rho_factor Transcripti  95.5    0.13 3.3E-06   31.7   8.2   89  112-204    17-114 (249)
476 CHL00195 ycf46 Ycf46; Provisio  95.5   0.071 1.8E-06   33.5   6.9   28  109-136   257-284 (491)
477 pfam00205 TPP_enzyme_M Thiamin  95.5   0.053 1.3E-06   34.4   6.2   49  129-177     2-50  (138)
478 cd04113 Rab4 Rab4 subfamily.    95.4    0.17 4.3E-06   30.8   8.7  138  113-298     2-153 (161)
479 PRK13639 cbiO cobalt transport  95.4   0.017 4.3E-07   37.8   3.6   55  111-167    28-82  (275)
480 cd03268 ABC_BcrA_bacitracin_re  95.4   0.011 2.7E-07   39.2   2.6   41  111-151    26-66  (208)
481 PRK13540 cytochrome c biogenes  95.4  0.0083 2.1E-07   40.0   2.0   38  111-148    27-64  (200)
482 COG1159 Era GTPase [General fu  95.4    0.27 6.9E-06   29.4  10.1  148  111-298     6-163 (298)
483 PRK11432 fbpC ferric transport  95.4   0.083 2.1E-06   33.0   7.1   27  111-137    32-58  (351)
484 cd03264 ABC_drug_resistance_li  95.4  0.0075 1.9E-07   40.3   1.7   41  111-151    25-65  (211)
485 PRK00300 gmk guanylate kinase;  95.4   0.034 8.7E-07   35.7   5.0   88  109-204     5-110 (208)
486 PRK06964 DNA polymerase III su  95.4   0.074 1.9E-06   33.3   6.7  130  108-251    18-181 (342)
487 cd03228 ABCC_MRP_Like The MRP   95.4   0.094 2.4E-06   32.6   7.2   39  111-149    28-66  (171)
488 COG1474 CDC6 Cdc6-related prot  95.4    0.13 3.3E-06   31.7   7.9   94  109-209    40-139 (366)
489 PRK13545 tagH teichoic acids e  95.4   0.069 1.8E-06   33.5   6.5   92  111-203    50-171 (549)
490 COG1061 SSL2 DNA or RNA helica  95.4   0.053 1.3E-06   34.4   5.9   93  111-209    55-162 (442)
491 PRK06871 DNA polymerase III su  95.4   0.051 1.3E-06   34.5   5.8  129  108-249    20-153 (324)
492 PRK06904 replicative DNA helic  95.4    0.28 7.2E-06   29.3  13.0  117  111-227   221-371 (472)
493 PRK05986 cob(I)yrinic acid a,c  95.4   0.016 4.1E-07   38.0   3.2  122  111-246    23-158 (190)
494 KOG0920 consensus               95.4    0.12 2.9E-06   32.0   7.6  133  111-257   188-339 (924)
495 PRK09165 replicative DNA helic  95.3    0.29 7.3E-06   29.2  10.1  117  111-227   205-368 (484)
496 cd03298 ABC_ThiQ_thiamine_tran  95.3    0.11 2.9E-06   32.1   7.5   39  111-149    24-62  (211)
497 PRK00149 dnaA chromosomal repl  95.3   0.094 2.4E-06   32.6   7.1   88  112-222   146-237 (447)
498 KOG2749 consensus               95.3   0.023 5.9E-07   36.9   4.0  169  108-290   101-298 (415)
499 PRK08840 replicative DNA helic  95.3    0.25 6.4E-06   29.6   9.3   39  110-148   216-255 (464)
500 COG0410 LivF ABC-type branched  95.3   0.009 2.3E-07   39.8   1.9   45  110-154    28-72  (237)

No 1  
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  This family includes the cell division ABC transporter and the periplasmic substrate-binding protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In Escherichia coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.; GO: 0005525 GTP binding.
Probab=100.00  E-value=0  Score=734.58  Aligned_cols=272  Identities=46%  Similarity=0.734  Sum_probs=256.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHH-HHHHHHHHHHHHCCCCCCCC---------CCCCCC
Q ss_conf             78999999999999973889899999999999875127899899-99999998785201001210---------001366
Q gi|254780709|r   40 RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQR-VLYDVSELIHKMLMPLSKPF---------NWDFSH  109 (321)
Q Consensus        40 ~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~-i~~~l~~~L~~~L~~~~~~~---------~~~~~~  109 (321)
                      +++|+++||||+.||+||||++++++|++.++++...++++..+ +...+++.|.+.+.+...+.         ..+..+
T Consensus         1 k~de~~~EELE~~Ll~~Dv~~~~v~~i~~~l~~~~~~~~~~~~~~~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (284)
T TIGR00064         1 KDDEDFFEELEEILLESDVGLEVVEKIIEELKKELVGKKVKDEEKLKEILKEALKEILKEILDKDTLLDLEQIEELPEEK   80 (284)
T ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCC
T ss_conf             93036899899999985051899999999988754035577078999999999999874112321133443344301478


Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCC-CCCHHHHHHHHHH
Q ss_conf             741231135444442478999999985226742677434512456889999975303532122358-6612454228999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIG-SDAAALAYEAFKQ  188 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~-~dp~~v~~~a~~~  188 (321)
                      +|+|||||||||+||||||||||++|+++||||+|+|||||||||+|||++||+|+||+++.+++| +|||||+|||+++
T Consensus        81 kp~Vil~VGVNG~GKTTTIaKLA~~l~~~Gk~V~laAgDTFRAAA~EQL~~Wa~R~gv~vi~~~~gn~DPAaV~fDAi~~  160 (284)
T TIGR00064        81 KPNVILFVGVNGVGKTTTIAKLANKLKKQGKSVLLAAGDTFRAAAIEQLEVWAKRLGVDVIKQKEGNADPAAVIFDAIQA  160 (284)
T ss_pred             CCEEEEEEEEECCCHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHHHCCEEEECCCCCCCCHHHHHHHHHH
T ss_conf             97799998440886010288999999874990899827524799999999989883875540788988717899998999


Q ss_pred             HHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC-CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             965148759986543332115778999989987630222-3430112310233522577899987643589769996545
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDP-HAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMD  267 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~-~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD  267 (321)
                      |+++|||+|||||||||||+.|||+||+||+||+++..+ .+|||++||+||+|||||+.||+.|++++++||+||||||
T Consensus       161 Ak~~niDvvliDTAGRLqnk~NLm~EL~KI~RV~~k~~~~~aP~e~lLVlDAt~Gqna~~QA~~F~eav~ltGiiLTKLD  240 (284)
T TIGR00064       161 AKARNIDVVLIDTAGRLQNKVNLMDELKKIKRVIKKVDPVDAPDEVLLVLDATTGQNALEQAKVFNEAVGLTGIILTKLD  240 (284)
T ss_pred             HHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             98749978997347545466203999999999873210257875575422022203089999998654068858996346


Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHC
Q ss_conf             78706999999999769889997589813255577899999872
Q gi|254780709|r  268 GTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT  311 (321)
Q Consensus       268 ~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~ll  311 (321)
                      ||||||++|||.+++++||+|||+||+||||.||||++|+.+||
T Consensus       241 g~AKGG~~l~i~~~l~~Pv~~~G~GE~~dDL~~Fd~~~fv~~L~  284 (284)
T TIGR00064       241 GTAKGGIILAIAYELKLPVKFIGVGEKIDDLAPFDADWFVEALF  284 (284)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCCHHHHHHHCC
T ss_conf             88037899988998579769985488733201479789987509


No 2  
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents various SRP subunits.; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=100.00  E-value=0  Score=733.13  Aligned_cols=289  Identities=33%  Similarity=0.531  Sum_probs=274.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCH----HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC-----CHHHHHHHHHHH
Q ss_conf             99999999999998605677899----999999999997388989999999999987512789-----989999999998
Q gi|254780709|r   21 FASTSLKLKEGITDIISSRRLDD----GVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDV-----SVQRVLYDVSEL   91 (321)
Q Consensus        21 L~kt~~~L~~~l~~l~~~~~lde----~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i-----~~~~i~~~l~~~   91 (321)
                      |+.++++|++.|+++.++.+|+|    +.++|++.+||+|||++.||++|+++++++..++++     |.+.++++++++
T Consensus         1 fe~Ls~~l~~~~~~L~~~~~itE~~i~~al~EiR~ALLeADVnl~VvK~Fi~~V~ekA~G~eV~~~~~P~Qq~iKIV~eE   80 (439)
T TIGR00959         1 FESLSERLQRIFKKLSGKGTITEKNIKEALREIRLALLEADVNLQVVKDFIKKVKEKALGQEVLKSLSPGQQFIKIVHEE   80 (439)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHEEHHHHHH
T ss_conf             90157899999985117777588999999999999887731576899999998888752254412678020120224689


Q ss_pred             HHHHCCCC---CCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHH--HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             78520100---12100013667412311354444424789999999--85226742677434512456889999975303
Q gi|254780709|r   92 IHKMLMPL---SKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK--MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTS  166 (321)
Q Consensus        92 L~~~L~~~---~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~--~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~  166 (321)
                      |.++|+..   ..++.+. .++|.||||||+|||||||||||||+|  ++++|+||+|||||+|||||+|||+++|+++|
T Consensus        81 L~~~LG~~~~E~~~L~~~-~~~P~vilmvGLQGsGKTTt~gKLA~~ll~kk~~~kvLLva~D~yRPAA~~QL~~Lg~Q~g  159 (439)
T TIGR00959        81 LVAILGGKGRESAELKLA-EKRPTVILMVGLQGSGKTTTAGKLALYLLKKKEGKKVLLVACDLYRPAAIEQLKVLGEQVG  159 (439)
T ss_pred             HHHHCCCCCCCCCCCCCC-CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHCCCHHHHHHHHHHHHHCC
T ss_conf             998516667325675556-7868389973137885788999999999998638970340321034789999999767528


Q ss_pred             CCCCC-CCCCCC---CHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             53212-235866---12454228999965148759986543332115778999989987630222343011231023352
Q gi|254780709|r  167 ADFVC-SEIGSD---AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       167 v~~~~-~~~~~d---p~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      ||||. .+.+.+   |+.+|.+|+++|+.+++|+||||||||||.|+.||+||..|+++++      |+|++||+|||+|
T Consensus       160 Vpvf~h~~~~~~p~~Pv~ia~~Al~~Ak~~~~D~vI~DTAGRL~ID~~LM~EL~~iK~~~n------P~EiLlVvDaM~G  233 (439)
T TIGR00959       160 VPVFAHLGKGQSPDDPVEIARQALEEAKENGFDVVIVDTAGRLQIDEELMEELAEIKEILN------PDEILLVVDAMTG  233 (439)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHC------CCEEEECCHHCCH
T ss_conf             8711004788898877899999999999748978997267512555999999999988868------8705412201021


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             25778999876435897699965457870699999999976988999758981325557789999987286564
Q gi|254780709|r  243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDY  316 (321)
Q Consensus       243 q~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~  316 (321)
                      |+|+++|++||+.+++||+||||||||||||+|||+.+.+|+||+|||+||+++||+||||+|+|+|||||||-
T Consensus       234 QdAvn~A~~F~e~lgltG~vltK~DGDaRGGAALS~~~~tg~PIKFiG~GEK~~dLe~FhP~R~A~RILGMGDv  307 (439)
T TIGR00959       234 QDAVNTAKTFNERLGLTGVVLTKLDGDARGGAALSVRSVTGKPIKFIGVGEKIEDLEPFHPDRMASRILGMGDV  307 (439)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCH
T ss_conf             69999998636600135478854756605789999999968961888417772331246747898632365522


No 3  
>PRK10416 cell division protein FtsY; Provisional
Probab=100.00  E-value=0  Score=717.25  Aligned_cols=309  Identities=40%  Similarity=0.698  Sum_probs=297.9

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-HHHH
Q ss_conf             593541489999999999999999999986056778999999999999973889899999999999875127899-8999
Q gi|254780709|r    6 VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS-VQRV   84 (321)
Q Consensus         6 ~~~e~m~~f~kLk~gL~kt~~~L~~~l~~l~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~-~~~i   84 (321)
                      ....+.|||.||++||.||+++|.+.+.++|++++||+++|++||++||.||||++++.+|+++++++...+++. .+.+
T Consensus       190 e~~~k~g~f~rlk~gL~kt~~~l~~~~~~lf~~kkiD~~~~eeLEe~Li~aDvGv~tt~~ii~~l~~~~~~~~~~~~~~l  269 (499)
T PRK10416        190 EKPTKEGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEAL  269 (499)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             36422658999998999999999999999866898888999999999997205999999999999999986479999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             99999987852010012100013667412311354444424789999999852267426774345124568899999753
Q gi|254780709|r   85 LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR  164 (321)
Q Consensus        85 ~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~  164 (321)
                      ...|++.|.++|.+...++.+. .++|+||||||+|||||||||||||+||+++|+||+|+|||||||||+|||++||++
T Consensus       270 ~~~l~~~~~~il~~~~~~l~~~-~~~P~VIl~vGvNG~GKTTTigKLA~~~~~~gkkVllaA~DTfRaAAieQL~~w~~r  348 (499)
T PRK10416        270 YGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQR  348 (499)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCC-CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             9999999999873104466568-999879999747878789899999999997799537884066756899999998424


Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH
Q ss_conf             03532122358661245422899996514875998654333211577899998998763022234301123102335225
Q gi|254780709|r  165 TSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN  244 (321)
Q Consensus       165 ~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~  244 (321)
                      +|||+|....|+||++|+|+|+++|+.++||+||||||||+||+.+||+||+||.|++++..+.+||+++||+|||+|||
T Consensus       349 ~~v~vi~~~~g~Dpa~V~~dai~~a~~~~~DvviiDTAGRl~~~~~LM~EL~ki~rvi~k~~~~aP~e~lLVlDa~tGQn  428 (499)
T PRK10416        349 NNIPVIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQN  428 (499)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCHH
T ss_conf             57369836899997999999999999729998998577643260999999999999997237899974899977876778


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCC
Q ss_conf             77899987643589769996545787069999999997698899975898132555778999998728656
Q gi|254780709|r  245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD  315 (321)
Q Consensus       245 ~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd  315 (321)
                      +++||+.|++.+++||+|+||||||||||++||+++.+++||+|||+||+++||++|+|++|+++||+-.|
T Consensus       429 a~~qak~F~e~~~ltGiIlTKlDGtAKGG~~lsi~~~~~~PI~fiG~GE~idDL~~F~~~~Fv~aLf~~e~  499 (499)
T PRK10416        429 AVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED  499 (499)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCHHHCCCCCHHHHHHHHHCCCC
T ss_conf             99999998442799759996567788525999999998839599867988220667798999999844799


No 4  
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=100.00  E-value=0  Score=690.21  Aligned_cols=310  Identities=44%  Similarity=0.757  Sum_probs=286.8

Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCC---CCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH-HHCCC
Q ss_conf             100593541489999999999999999999986056---77899999999999997388989999999999987-51278
Q gi|254780709|r    3 NQKVASESLSWIRKLTKGFASTSLKLKEGITDIISS---RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTK-RYAKD   78 (321)
Q Consensus         3 ~~~~~~e~m~~f~kLk~gL~kt~~~L~~~l~~l~~~---~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~-~~~~~   78 (321)
                      .+...+++.+||++++.||+++++.|...+..++..   .+++++++++||+.||+||||++++..|++.++++ ...++
T Consensus        23 ~~~~~~~~~~~~~~~~~gl~k~~~~~~~~~~~~~~~~~~~~~de~~~eeLE~~Li~aDvg~e~~~~i~~~l~~~~~~~~~  102 (340)
T COG0552          23 EEDEEEEKEGWFERLKQGLSKTKKNFGKGIKGLFLKKIKEKLDEDLLEELEELLIEADVGVETAEEIIEELRKREGKKKK  102 (340)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             11143210007999988999999999998766301234430048899999999997024699999999999987510236


Q ss_pred             C-CHHHHHHHHHHHHHHHCCCCCC---CCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             9-9899999999987852010012---10001366741231135444442478999999985226742677434512456
Q gi|254780709|r   79 V-SVQRVLYDVSELIHKMLMPLSK---PFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus        79 i-~~~~i~~~l~~~L~~~L~~~~~---~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
                      + +...+...+++.+.++|.+...   +......++|+|||||||||+||||||||||+||+.+|+||+|+|||||||||
T Consensus       103 ~~~~~~v~~~l~~~l~~il~~~~~~~~~~~~~~~~~p~Vil~vGVNG~GKTTTIaKLA~~l~~~g~~VllaA~DTFRAaA  182 (340)
T COG0552         103 IKDEETVKEALREALIEILRPVDKVDLPLEIPKEKKPFVILFVGVNGVGKTTTIAKLAKYLKQQGKSVLLAAGDTFRAAA  182 (340)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             89889999999999999846554444365523589867999993488863717999999999789869998233478999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             88999997530353212235866124542289999651487599865433321157789999899876302223430112
Q gi|254780709|r  155 IDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL  234 (321)
Q Consensus       155 ~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~  234 (321)
                      +|||++||+|+|++++.+++|+|||+|+|||+++|++++||+|||||||||||+.|||+||+||.||+++..+.+|||++
T Consensus       183 iEQL~~w~er~gv~vI~~~~G~DpAaVafDAi~~Akar~~DvvliDTAGRLhnk~nLM~EL~KI~rV~~k~~~~ap~e~l  262 (340)
T COG0552         183 IEQLEVWGERLGVPVISGKEGADPAAVAFDAIQAAKARGIDVVLIDTAGRLHNKKNLMDELKKIVRVIKKDDPDAPHEIL  262 (340)
T ss_pred             HHHHHHHHHHHCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             99999999995992782599998089999999999976999999967554457366899999999984645689984289


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             310233522577899987643589769996545787069999999997698899975898132555778999998728
Q gi|254780709|r  235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG  312 (321)
Q Consensus       235 lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG  312 (321)
                      ||+||++|||+++||+.|++++++||+|+||||+|||||++|||++++++||+|||+||+++||+||++++|++.||+
T Consensus       263 lvlDAttGqnal~QAk~F~eav~l~GiIlTKlDgtAKGG~il~I~~~l~~PI~fiGvGE~~~DL~~Fd~~~fv~~L~~  340 (340)
T COG0552         263 LVLDATTGQNALSQAKIFNEAVGLDGIILTKLDGTAKGGIILSIAYELGIPIKFIGVGEGYDDLRPFDAEWFVDALLG  340 (340)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEHHHHHCCCEEEEECCCCHHHCCCCCHHHHHHHHHC
T ss_conf             997756475689999999875288669997024677762435088886999799857888443200699999998609


No 5  
>PRK10867 signal recognition particle protein; Provisional
Probab=100.00  E-value=0  Score=664.75  Aligned_cols=290  Identities=32%  Similarity=0.509  Sum_probs=273.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC----C-HHHHHHHHHHH
Q ss_conf             999999999999986056778999----99999999997388989999999999987512789----9-89999999998
Q gi|254780709|r   21 FASTSLKLKEGITDIISSRRLDDG----VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDV----S-VQRVLYDVSEL   91 (321)
Q Consensus        21 L~kt~~~L~~~l~~l~~~~~lde~----~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i----~-~~~i~~~l~~~   91 (321)
                      |+.++++|++.++++.++..|+|+    .++|++.+||+|||+++++++++++++++..++++    + .+.++++++++
T Consensus         2 f~~Ls~~l~~~~~~l~g~~~lte~~i~~~lrEIr~ALLeADV~~~vvk~~i~~vke~~~g~~v~~~l~p~q~i~kiv~~e   81 (453)
T PRK10867          2 FDNLTDRLSRTLRNISGRGRLTEDNVKETLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNE   81 (453)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             37888999999997149987789999999999999999756887999999999999963351357898899999999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             7852010012100013667412311354444424789999999852-267426774345124568899999753035321
Q gi|254780709|r   92 IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV  170 (321)
Q Consensus        92 L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~  170 (321)
                      |.++|++...++.+. +.+|+||||||+||||||||+||||+||++ ++++|+++|||||||||+|||++||++++||||
T Consensus        82 L~~lLg~~~~~l~~~-~~~p~VIm~vGLqGsGKTTT~aKLA~~lk~k~~k~vllvaaDt~RpaA~eQL~~la~~~~v~~~  160 (453)
T PRK10867         82 LVAAMGEENQTLNLA-AQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFF  160 (453)
T ss_pred             HHHHHCCCCCCCCCC-CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             999858887666337-8999699997468885185899999999973898379855887705899999999985198043


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             22358661245422899996514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  171 CSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       171 ~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                      .++.++||++|+++|+++|+.++||+||||||||+|+|.+||+||++|+++++      |+|++||+||++||+|++||+
T Consensus       161 ~~~~~~dp~~ia~~a~~~ak~~~~DvvivDTAGRl~~d~~Lm~El~~i~~~~~------P~e~llV~Da~~GQ~a~~~a~  234 (453)
T PRK10867        161 PSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIN------PVETLFVVDAMTGQDAANTAK  234 (453)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHCCHHHHHHHHHHHHHHC------CCCEEEEEECCCCHHHHHHHH
T ss_conf             67889988999999999999779999999787601210888999999987637------871379743223566899999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             8764358976999654578706999999999769889997589813255577899999872865646
Q gi|254780709|r  251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYG  317 (321)
Q Consensus       251 ~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~~  317 (321)
                      .|+++++++|+|+||||+|||||+|||+++.+++||+|||+||++|||++|+|+||++|||||||.-
T Consensus       235 ~F~~~~~~~gvIlTKlDgdarGG~alS~~~~t~~PI~FiG~GEk~ddle~F~p~r~asRILGmGDi~  301 (453)
T PRK10867        235 AFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTDALEPFHPDRIASRILGMGDVL  301 (453)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCCCHH
T ss_conf             9998559870787504678761389899999786967886699824588768489999861898789


No 6  
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=100.00  E-value=0  Score=647.54  Aligned_cols=285  Identities=32%  Similarity=0.527  Sum_probs=266.5

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC----C-HHHHHHHHHH
Q ss_conf             9999999999999986056778999----99999999997388989999999999987512789----9-8999999999
Q gi|254780709|r   20 GFASTSLKLKEGITDIISSRRLDDG----VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDV----S-VQRVLYDVSE   90 (321)
Q Consensus        20 gL~kt~~~L~~~l~~l~~~~~lde~----~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i----~-~~~i~~~l~~   90 (321)
                      .|+.++++|++.++++.++..++|+    .++|++.+||+|||+++++++++++++++..++++    + .+.+++++++
T Consensus         2 mf~~Ls~~l~~~~~~l~g~~~l~E~~i~~~l~eIr~ALLeADV~~~vvk~f~~~vk~k~~g~~v~~~~~p~q~iikiv~~   81 (433)
T PRK00771          2 MLDKLGSSLKDALKKLAGATVIDKKTVKEVVKDIQRALLQADVNVKLVMNLSKEIERRALEEEPPKGMSKKEHIIKIVYE   81 (433)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             76889899999999861899889999999999999999965678799999999999997146245789989999999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             87852010012100013667412311354444424789999999852267426774345124568899999753035321
Q gi|254780709|r   91 LIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV  170 (321)
Q Consensus        91 ~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~  170 (321)
                      +|.++|++...     ...+|+||||||+||||||||+||||+||+++|++|+|+|||||||||+|||++||++++||||
T Consensus        82 eL~~llg~~~~-----~~~kP~Vim~vGlqGsGKTTT~aKLA~~~kk~g~kv~lvaaDt~RpaA~eQL~~la~~~~v~~~  156 (433)
T PRK00771         82 ELVKLLGEEAE-----ILLKPQTILLVGLQGSGKTTTAAKLARYFQKKGLKVGVICADTWRPGAYEQLKQLCEKINVPFY  156 (433)
T ss_pred             HHHHHHCCCCC-----CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             99998496765-----6689858999737889789999999999997799467850678836899999999986388731


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             22358661245422899996514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  171 CSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       171 ~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                      ..+.++||++|+++|+++++  +||+||||||||+|+|++||+||++|+++++      |+|++||+||++||+|++||+
T Consensus       157 ~~~~~~dp~~i~~~a~~~~k--~~DvviiDTAGRl~~d~~Lm~El~~i~~~~~------P~e~llV~Da~~GQ~a~~~a~  228 (433)
T PRK00771        157 GDPKEKDAVKIVKEGLEKLK--KVDVIIVDTAGRHKLEKDLIEEMKQIKEITK------PDEVILVIDATIGQQASEQAK  228 (433)
T ss_pred             CCCCCCCHHHHHHHHHHHHC--CCCEEEEECCCCCCCCHHHHHHHHHHHHHHC------CCEEEEEEECCCCHHHHHHHH
T ss_conf             78899999999999999845--6988999776521040999999999987757------976899865442267899999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             8764358976999654578706999999999769889997589813255577899999872865646
Q gi|254780709|r  251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYG  317 (321)
Q Consensus       251 ~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~~  317 (321)
                      .|+++++++|+|+||||||||||+|||+++.+++||+|+|+||+++||++|+|+||++|||||||.-
T Consensus       229 ~F~~~~~i~gvIlTKlDgdarGGaaLSi~~~t~~PI~FiG~GEk~~dle~F~p~r~asRILGmGDi~  295 (433)
T PRK00771        229 AFKEAVGIGGIIITKLDGTAKGGGALSAVAETGAPIKFIGTGETIDDLEPFDPKRFISRLLGMGDLK  295 (433)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCCCHH
T ss_conf             9987538873799725678873054218988789956886178721488668088999870898589


No 7  
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=100.00  E-value=0  Score=645.30  Aligned_cols=290  Identities=35%  Similarity=0.553  Sum_probs=274.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-----HHHHHHHHHHH
Q ss_conf             999999999999986056778999----999999999973889899999999999875127899-----89999999998
Q gi|254780709|r   21 FASTSLKLKEGITDIISSRRLDDG----VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS-----VQRVLYDVSEL   91 (321)
Q Consensus        21 L~kt~~~L~~~l~~l~~~~~lde~----~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~-----~~~i~~~l~~~   91 (321)
                      |+.+.++|++.++.+.+...++|.    .++|++.+||+|||++.++++++++++++..+.+++     .+.++++++++
T Consensus         2 ~e~L~~~l~~~~~kl~g~~~i~E~~i~e~~reir~ALLeADVnl~vVk~fi~~ikera~g~ev~~~l~p~q~~iKiV~eE   81 (451)
T COG0541           2 FESLSDRLSNALKKLRGKGRITEKDVKEALREIRRALLEADVNLKVVKDFIKRIKERALGEEVPKGLTPGQQFIKIVYEE   81 (451)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             47899999999998637786779999999999999999644468999999999999861466788899899999999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             78520100121000136674123113544444247899999998522674267743451245688999997530353212
Q gi|254780709|r   92 IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC  171 (321)
Q Consensus        92 L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~  171 (321)
                      |.++|++...++.+. ..+|+||||||++|+|||||+||||+||+++|+||++||||||||||+|||+++|++++||||.
T Consensus        82 Lv~llG~~~~~l~l~-~~~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVaaD~~RpAA~eQL~~La~q~~v~~f~  160 (451)
T COG0541          82 LVKLLGGENSELNLA-KKPPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQVGVPFFG  160 (451)
T ss_pred             HHHHHCCCCCCCCCC-CCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEC
T ss_conf             999848887665037-8998589998156797486899999999974994589850567868999999999860985316


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             23586612454228999965148759986543332115778999989987630222343011231023352257789998
Q gi|254780709|r  172 SEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM  251 (321)
Q Consensus       172 ~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~  251 (321)
                      ...+.||+.||.+|+++|+.++||+||||||||+|.|+.||+||..|+++++      |+|++||+||++||+|.++|+.
T Consensus       161 ~~~~~~Pv~Iak~al~~ak~~~~DvvIvDTAGRl~ide~Lm~El~~Ik~~~~------P~E~llVvDam~GQdA~~~A~a  234 (451)
T COG0541         161 SGTEKDPVEIAKAALEKAKEEGYDVVIVDTAGRLHIDEELMDELKEIKEVIN------PDETLLVVDAMIGQDAVNTAKA  234 (451)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCC------CCEEEEEEECCCCHHHHHHHHH
T ss_conf             7788997999999999999749988999688733030999999999985539------8748998764445678999999


Q ss_pred             HHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             764358976999654578706999999999769889997589813255577899999872865646
Q gi|254780709|r  252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYG  317 (321)
Q Consensus       252 F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~~  317 (321)
                      ||+.++++|+|+||+|||||||+|||+.+.+++||+|||+||+++||++|+|+||++|||||||.-
T Consensus       235 F~e~l~itGvIlTKlDGdaRGGaALS~~~~tg~PIkFiGtGEki~dLE~F~P~R~asRILGMGDv~  300 (451)
T COG0541         235 FNEALGITGVILTKLDGDARGGAALSARAITGKPIKFIGTGEKIDDLEPFHPDRFASRILGMGDVL  300 (451)
T ss_pred             HHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCHH
T ss_conf             866269864999714678762288856998789859974588735477749588999853732099


No 8  
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.; GO: 0005525 GTP binding, 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=100.00  E-value=0  Score=594.14  Aligned_cols=292  Identities=29%  Similarity=0.461  Sum_probs=267.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC-HHH----HHHHHHHHHHCCCCHHHHHHHHHHHHH---HHHCCCCCH-----HHHHHH
Q ss_conf             9999999999999860567789-999----999999999738898999999999998---751278998-----999999
Q gi|254780709|r   21 FASTSLKLKEGITDIISSRRLD-DGV----REELEDLLIRSDIGVAVAQKIVEELLT---KRYAKDVSV-----QRVLYD   87 (321)
Q Consensus        21 L~kt~~~L~~~l~~l~~~~~ld-e~~----leeLee~LL~ADVg~~va~~Iie~ik~---~~~~~~i~~-----~~i~~~   87 (321)
                      |+.+-++|+.+|+++-+..-+| |++    +.|++.+||++||.+..++++.++||+   +...++++.     .-+..+
T Consensus         2 LA~LG~~l~~AL~~~~saTv~dse~vl~~~Lkei~~ALL~~dvn~klv~~l~~Nik~kid~~n~e~~~~g~nKRk~iq~~   81 (453)
T TIGR01425         2 LADLGSSLVSALRSMSSATVIDSEEVLNEMLKEICTALLESDVNVKLVRQLRENIKKKIDKINLEELASGLNKRKLIQKA   81 (453)
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             10101489999860123611044899999999998875113352677898888788740503513321032478999998


Q ss_pred             HHHHHHHHCCCCCCC-----C-----------CCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             999878520100121-----0-----------001366741231135444442478999999985226742677434512
Q gi|254780709|r   88 VSELIHKMLMPLSKP-----F-----------NWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus        88 l~~~L~~~L~~~~~~-----~-----------~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      +-++|.+++.|...+     +           ..+.+++++||||||+||+||||||.|||+||+++|+||.||+|||||
T Consensus        82 vF~EL~~LvDp~~~APkPkklststktinGkk~~p~Kgk~~ViMfVGLQGaGKTTtctKLA~YYk~rGfK~~lvCADTFR  161 (453)
T TIGR01425        82 VFEELCNLVDPGVEAPKPKKLSTSTKTINGKKFTPKKGKSSVIMFVGLQGAGKTTTCTKLAYYYKRRGFKPALVCADTFR  161 (453)
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCEEECCCEEECCCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             99998976086323468753332110103503411568821588862148871566878777763266432565177542


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             45688999997530353212235866124542289999651487599865433321157789999899876302223430
Q gi|254780709|r  152 SAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPH  231 (321)
Q Consensus       152 ~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~  231 (321)
                      |||+||||..|.+-+||||+++.+.||+.||+++++.|+++++|+|||||.||+..+..|..|+..+.++++      |+
T Consensus       162 AGAFdQLkqNA~kA~iPFYGsy~E~DPVkiA~EGv~~Fk~E~~diIivDTSGRHkQe~~LF~Em~qv~~Ai~------Pd  235 (453)
T TIGR01425       162 AGAFDQLKQNATKAKIPFYGSYLESDPVKIASEGVEKFKKEKFDIIIVDTSGRHKQEEELFEEMVQVAEAIK------PD  235 (453)
T ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC------CC
T ss_conf             324899987476448971201048987078002011322127847998379873225888899876863349------98


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHC
Q ss_conf             11231023352257789998764358976999654578706999999999769889997589813255577899999872
Q gi|254780709|r  232 SVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT  311 (321)
Q Consensus       232 ~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~ll  311 (321)
                      .+++|+|+.+||.|..||++|++.+++.+||+|||||+||||+|||++..|+-||.||||||+|||||+|+|+.|+++||
T Consensus       236 ~iifVMDGsIGQAA~~QAkAFK~~~~vGSvIiTKLDGHAkGGGALSAVAATKsPiiFIGTGEhv~d~E~F~~~~FvskLL  315 (453)
T TIGR01425       236 SIIFVMDGSIGQAAFSQAKAFKDSVEVGSVIITKLDGHAKGGGALSAVAATKSPIIFIGTGEHVDDFEIFDAEPFVSKLL  315 (453)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHC
T ss_conf             36998066166788999998630035003887515677676237889875359779813775027605789971477540


Q ss_pred             CCCCCCC
Q ss_conf             8656463
Q gi|254780709|r  312 GCLDYGE  318 (321)
Q Consensus       312 G~gd~~~  318 (321)
                      ||||+-+
T Consensus       316 GmGDl~G  322 (453)
T TIGR01425       316 GMGDLKG  322 (453)
T ss_pred             CCCCHHH
T ss_conf             2021889


No 9  
>KOG0780 consensus
Probab=100.00  E-value=0  Score=555.77  Aligned_cols=290  Identities=29%  Similarity=0.472  Sum_probs=261.8

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCH----HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC----HH-HHHHHHHHHH
Q ss_conf             9999999999998605677899----9999999999973889899999999999875127899----89-9999999987
Q gi|254780709|r   22 ASTSLKLKEGITDIISSRRLDD----GVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS----VQ-RVLYDVSELI   92 (321)
Q Consensus        22 ~kt~~~L~~~l~~l~~~~~lde----~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~----~~-~i~~~l~~~L   92 (321)
                      +.+..++.++++.+.....+++    ..++|++.+||+|||++.+++++.+++++.....++.    .. .+...+.++|
T Consensus         4 a~lGrrI~~a~~~~s~~t~~~~~~l~~~L~eI~~ALLesDV~~~lV~~l~~nir~~i~~~~~~~G~nk~r~i~~~vf~eL   83 (483)
T KOG0780           4 AELGRRITSAFSRMSNATSIDETALNTMLKEICRALLESDVNPRLVKELRENIRKIINLEKLASGVNKRRIIQKAVFDEL   83 (483)
T ss_pred             HHHCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             77650689999985268862077899999999999985258888999999999987462420244578899999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             85201001210001366741231135444442478999999985226742677434512456889999975303532122
Q gi|254780709|r   93 HKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCS  172 (321)
Q Consensus        93 ~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~  172 (321)
                      ..++.|...++ .+.+.+|+||||||+||+||||||+|||+||+++|+||+|||+|||||||++||++||.+.+||||++
T Consensus        84 ~kl~dp~~~~~-~~~K~kpsVimfVGLqG~GKTTtc~KlA~y~kkkG~K~~LvcaDTFRagAfDQLkqnA~k~~iP~ygs  162 (483)
T KOG0780          84 VKLLDPGKSAL-QPKKGKPSVIMFVGLQGSGKTTTCTKLAYYYKKKGYKVALVCADTFRAGAFDQLKQNATKARVPFYGS  162 (483)
T ss_pred             HHHHCCCCCCC-CCCCCCCCEEEEEECCCCCCCEEHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEEC
T ss_conf             99718997646-61568970899983057886300899999998468724577602245306899998767407706840


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             35866124542289999651487599865433321157789999899876302223430112310233522577899987
Q gi|254780709|r  173 EIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF  252 (321)
Q Consensus       173 ~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F  252 (321)
                      ..+.||+.|+.++++.||+++||+||+||+||+|.+..||+||..+.++++      |++++||+||++||.|..||+.|
T Consensus       163 yte~dpv~ia~egv~~fKke~fdvIIvDTSGRh~qe~sLfeEM~~v~~ai~------Pd~vi~VmDasiGQaae~Qa~aF  236 (483)
T KOG0780         163 YTEADPVKIASEGVDRFKKENFDVIIVDTSGRHKQEASLFEEMKQVSKAIK------PDEIIFVMDASIGQAAEAQARAF  236 (483)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCC------CCEEEEEEECCCCHHHHHHHHHH
T ss_conf             366555899999999888639728998278730124899999999985159------87389998562007679999988


Q ss_pred             HHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             643589769996545787069999999997698899975898132555778999998728656463
Q gi|254780709|r  253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGE  318 (321)
Q Consensus       253 ~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~~~  318 (321)
                      ++.++++++|+|||||+||||++||++..++.||.|||+||++||||||+|++|++|||||||.-.
T Consensus       237 k~~vdvg~vIlTKlDGhakGGgAlSaVaaTksPIiFIGtGEhmdDlE~F~pk~FvsrlLGmGDi~g  302 (483)
T KOG0780         237 KETVDVGAVILTKLDGHAKGGGALSAVAATKSPIIFIGTGEHMDDLEPFDPKPFVSRLLGMGDIEG  302 (483)
T ss_pred             HHHHCCCEEEEEECCCCCCCCCEEEEHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHHCCCCHHH
T ss_conf             776154037997225677777345303540798799816755111577780779998715652899


No 10 
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=100.00  E-value=0  Score=512.45  Aligned_cols=254  Identities=19%  Similarity=0.288  Sum_probs=227.2

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             99999999999738898999999999998751278998999999999878520100121000136674123113544444
Q gi|254780709|r   44 GVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVG  123 (321)
Q Consensus        44 ~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~G  123 (321)
                      +.++|++.+|++|||+++++++|+++++++..+.....+++++.+.+.+...+....     ....+|++||||||||||
T Consensus        13 ~~l~ei~~aLleaDV~~~vv~~~~~~ik~k~~~~~~~~~~vi~~l~~~l~~~~~~~~-----~~~~~~~vI~lvG~~G~G   87 (270)
T PRK06731         13 FIIQKVIRMLEQNDVEQYFIHAYAEKLKVKFENATMITEEVIEYILEDMSSHFNTEN-----VFEKEVQTIALIGPTGVG   87 (270)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC-----CCCCCCEEEEEECCCCCC
T ss_conf             999999999997699889999999999988504553299999999999987507665-----467998189998889898


Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             24789999999852267426774345124568899999753035321223586612454228999965148759986543
Q gi|254780709|r  124 KTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAG  203 (321)
Q Consensus       124 KTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAG  203 (321)
                      ||||+||||+||+++|++|++++||||||||+|||++||+++|+|++...   ||.++......+++..++|+|||||||
T Consensus        88 KTTT~AKLA~~~~~~~~kV~lia~DtyR~aA~eQLk~~a~~l~v~~~~~~---~~~~~~~~~~~~~~~~~~DvilIDTAG  164 (270)
T PRK06731         88 KTTTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQLQDYVKTIGFEVIAVR---DEAAMTRALTYFKEEARVDYILIDTAG  164 (270)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCEECCC---CHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             89999999999986799089998388888899999999998199535458---878999999999997699999997999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC-CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             3321157789999899876302223430112310233-522577899987643589769996545787069999999997
Q gi|254780709|r  204 RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT-TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTH  282 (321)
Q Consensus       204 R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~-~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~  282 (321)
                      |+|+|.++|+||.++.+.++      |++++||+||+ .||++.++++.|+. ++++|+|+||||||+|||++||+++.+
T Consensus       165 R~~~d~~lm~el~~~~~~~~------p~~~~Lvldas~~~~~~~~~~~~f~~-~~i~gvIlTKlD~ta~gG~als~~~~~  237 (270)
T PRK06731        165 KNYRASETVEEMIETMGQVE------PDYICLTLSASMKSKDMIEIITNFKD-IHIDGIVFTKFDETASSGELLKIPAVS  237 (270)
T ss_pred             CCCCCHHHHHHHHHHHCCCC------CCEEEEEEECCCCHHHHHHHHHHHCC-CCCCEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             87146999999999860638------98799998687776999999998077-999889996535899772999999998


Q ss_pred             CCCEEEEECCCCC-CCCCCCCHHHHHHHHCC
Q ss_conf             6988999758981-32555778999998728
Q gi|254780709|r  283 KIPVYFLGVGEGI-NDLEPFVAKDFSAVITG  312 (321)
Q Consensus       283 ~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG  312 (321)
                      ++||+|+|+||+| +||++|+|+++++|||+
T Consensus       238 ~~PI~fig~Ge~VpeDi~~~~~~~la~riL~  268 (270)
T PRK06731        238 SAPIVLMTDGQDVKKNIHIATAEHLAKQMLQ  268 (270)
T ss_pred             CCCEEEEECCCCCHHHHHCCCHHHHHHHHHH
T ss_conf             8597999459997021413799999999830


No 11 
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=100.00  E-value=0  Score=482.35  Aligned_cols=241  Identities=22%  Similarity=0.308  Sum_probs=200.4

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHH
Q ss_conf             99738898999999999998751278998999999999878520100121000136674123113544444247899999
Q gi|254780709|r   53 LIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS  132 (321)
Q Consensus        53 LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA  132 (321)
                      ++-+|+...+.+++ .++      +.+..+.+..++...+...|.. .++..+.   .-.|||||||||||||||+||||
T Consensus       159 ~~~~~f~~~~~~~~-~~~------e~~~~~~~~~~~~~~~~~~~~~-~~~~~l~---~g~VIaLVGvnGvGKTTTiAKLA  227 (407)
T PRK12726        159 TYVADFMQAGRKQF-KQV------ETAHLDDITDWFVPYLSGKLAV-EDSFDLS---NHRIISLIGQTGVGKTTTLVKLG  227 (407)
T ss_pred             HHHHHHHHHHHHHH-HHH------HHHHHHHHHHHHHHHHCCCCCC-CCEEEEC---CCCEEEEECCCCCCHHHHHHHHH
T ss_conf             66542448899999-887------3101534068999975389770-3202303---69089998999897899999999


Q ss_pred             HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEEECCCCCCCHHHH
Q ss_conf             99852267426774345124568899999753035321223586612454228999-96514875998654333211577
Q gi|254780709|r  133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ-AQAKKVDVLIIDTAGRLHNNSIL  211 (321)
Q Consensus       133 ~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~-a~~~~~DvvliDTAGR~~~~~~l  211 (321)
                      ++|+++|+||+|+|||||||||+|||++||+++||||+.   +.||+++. +++.+ ++.+++|+||||||||+|++.+|
T Consensus       228 ~~l~~~gkkV~LVAaDTFRaAAiEQLk~~g~rlgVpV~~---~~dpa~l~-~av~~~a~~~~~DvVIIDTAGRl~~d~~L  303 (407)
T PRK12726        228 WQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDVELIV---ATSPAELE-EAVQYMTYVNCVDHILIDTVGRNYLAEES  303 (407)
T ss_pred             HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCEEEE---ECCHHHHH-HHHHHHHHCCCCCEEEEECCCCCCCCHHH
T ss_conf             999977991799970667788999999999997964998---18889999-99999986289998999699988134999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEC
Q ss_conf             89999899876302223430112310233522577899987643589769996545787069999999997698899975
Q gi|254780709|r  212 MAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGV  291 (321)
Q Consensus       212 m~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~  291 (321)
                      |+||.+|.++++      |++++||+|++++++...++..|+..++++|+|+||||||+|||++||+++.+++||+|+|+
T Consensus       304 m~EL~ki~~vi~------P~~~lLV~dag~~~~~v~qa~~~~~~v~ItGiILTKLDgtAKGG~aLSi~~~~~lPI~fIG~  377 (407)
T PRK12726        304 VSEISAYTDVVH------PDLTCFTFSSGMKSADVMTILPKLAEIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTD  377 (407)
T ss_pred             HHHHHHHHHCCC------CCEEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHHHCCCEEEEEC
T ss_conf             999999873328------96699993675669999999987047999879997014789853999999998889799947


Q ss_pred             CCCC-CCCCCCCHHHHHHHHCCCC
Q ss_conf             8981-3255577899999872865
Q gi|254780709|r  292 GEGI-NDLEPFVAKDFSAVITGCL  314 (321)
Q Consensus       292 Ge~i-~Dl~~f~~~~~~~~llG~g  314 (321)
                      ||+| |||.+||+.++++|+||--
T Consensus       378 GEkIPEDi~~~~~~~l~~R~l~~~  401 (407)
T PRK12726        378 GQNITENIFRPKSRWLAERFVGTD  401 (407)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCH
T ss_conf             999970120289899999984631


No 12 
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=100.00  E-value=0  Score=445.47  Aligned_cols=265  Identities=22%  Similarity=0.284  Sum_probs=215.7

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             7789999999999999738898999999999998751278998-999999999878520100121000136674123113
Q gi|254780709|r   39 RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSV-QRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVV  117 (321)
Q Consensus        39 ~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~-~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~v  117 (321)
                      ..++...+..+++.|.+.|+.....+++.+.++++....++.. +.+...+...+.+.+.. ..+.  ....++.|++||
T Consensus       104 ~~~~~~~~~~~~~~l~~~~~~~~~~~~i~~~l~~~~~~~~~~~~~~v~~~l~~~i~~~i~~-~~~~--~~~~k~~vi~lV  180 (388)
T PRK12723        104 EEINHPTILKIEDILRSNDFSESYIKDINEFIKREFSLSDLDDYDKVRDSVIIYIAKTIKC-SGSI--IDNLKKRIFILV  180 (388)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCC-CCCC--CCCCCCEEEEEE
T ss_conf             4445535899999998675579999999999998722122440879999999999976223-6665--335576289998


Q ss_pred             CCCCCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             54444424789999999852----26742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  118 GVNGVGKTTVIGKLSKKMSD----AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       118 G~nG~GKTTT~aKLA~~~~~----~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      ||+|||||||+||||++|..    ++++|+||++||||+||+|||++||+++|||++......|+.    +++.  +.++
T Consensus       181 GPTGvGKTTTiAKLAa~~~l~~~~k~~~V~lit~DtyRigAveQLktya~il~vp~~v~~~~~dl~----~~l~--~~~~  254 (388)
T PRK12723        181 GPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNYRIGAKKQIQTYGDIMGIPVKAIESFKDLK----EEIT--QSKD  254 (388)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEECCHHHHH----HHHH--HHCC
T ss_conf             998875787999999999986267677379998078758899999999999788069857889999----9999--7249


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH-HHHHHHHCCCCEEEEECCCCCCCH
Q ss_conf             8759986543332115778999989987630222343011231023352257789-998764358976999654578706
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ-VEMFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~-a~~F~~~~~~~g~I~TKlD~ta~~  272 (321)
                      +|+||||||||+|.|..+|.||+++.+.++     .+.+++||++|+++++...+ ++.| +.++++++||||||||+++
T Consensus       255 ~D~IlIDTAGrs~~d~~~~~el~~~~~~~~-----~~~~~~Lvlsat~~~~d~~~i~~~f-~~~~~~~~I~TKlDEt~~~  328 (388)
T PRK12723        255 FDLVLIDTIGKSPKDFMKLAEMKELLNACG-----RDAEFHLAVSSTTKTSDIKEIFHQF-SPFSYKTVIFTKLDETTCV  328 (388)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHCC-----CCCEEEEEECCCCCHHHHHHHHHHH-CCCCCCEEEEEECCCCCCC
T ss_conf             999999589988568999999999997418-----9845999987989999999999984-2799984999832278986


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCC-CCCCCCCHHHHHHHHCC--CCCCCC
Q ss_conf             99999999976988999758981-32555778999998728--656463
Q gi|254780709|r  273 GGLIPIVVTHKIPVYFLGVGEGI-NDLEPFVAKDFSAVITG--CLDYGE  318 (321)
Q Consensus       273 G~~ls~~~~~~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG--~gd~~~  318 (321)
                      |.+||+.+.+++||+|+|+||+| |||++|+|++|+++|+|  +||-.|
T Consensus       329 G~~l~~~~~~~~Pi~yit~GQ~VPdDie~a~p~~~~~~ilG~~~~~~~~  377 (388)
T PRK12723        329 GNLISLIHEMRKEVSYVTDGQIVPHNISIAEPLTFIKKINGYRISDDAE  377 (388)
T ss_pred             CHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCHHH
T ss_conf             6999999998888699938996830203389999999984871454699


No 13 
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=100.00  E-value=0  Score=455.49  Aligned_cols=196  Identities=49%  Similarity=0.780  Sum_probs=192.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      |+||+||||+|||||||+||||++++++|++|++|++||||+||+|||++||+++|+|++....++||+++++++++.++
T Consensus         1 P~vi~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~gA~eQL~~ya~~l~v~~~~~~~~~d~~~~~~~~l~~~~   80 (196)
T pfam00448         1 PNVILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAIEQLKQLAERLGVPVFGSGTGSDPAAVAFDAVEKAK   80 (196)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             96999989999988999999999999779928999758776889999999998639817814877787899999999988


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             51487599865433321157789999899876302223430112310233522577899987643589769996545787
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTA  270 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta  270 (321)
                      .+++|+||||||||+|.|.++|+||+++...++      |++++||+||++||++.+++..|++.++++|+|+||||||+
T Consensus        81 ~~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~~------~~~~~LVl~a~~~~~~~~~~~~f~~~~~~~~~I~TKlDet~  154 (196)
T pfam00448        81 AENYDVVLVDTAGRLQNDKNLMDELKKIKRVIA------PDEVLLVLDATTGQNALNQAKAFNEAVGITGVILTKLDGDA  154 (196)
T ss_pred             HCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCC------CCCEEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             468999999899987476778999999985228------73028998567782137899987600477626888405788


Q ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             069999999997698899975898132555778999998728
Q gi|254780709|r  271 RGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG  312 (321)
Q Consensus       271 ~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG  312 (321)
                      ++|.++|++..+++||+|+|+||+|+||++|+|++|+++|||
T Consensus       155 ~~G~~l~~~~~~~~Pi~~~t~Gq~v~Dl~~~~~~~~~~~lLG  196 (196)
T pfam00448       155 KGGAALSIAAETGKPIKFIGVGEKIDDLEPFDPERFVSRLLG  196 (196)
T ss_pred             CCCHHHHHHHHHCCCEEEEECCCCHHHCCCCCHHHHHHHHCC
T ss_conf             752999899998969799967998120634799999998559


No 14 
>KOG0781 consensus
Probab=100.00  E-value=0  Score=450.55  Aligned_cols=284  Identities=31%  Similarity=0.479  Sum_probs=258.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-----HHHHHHHHHHHH
Q ss_conf             99999999999986056778999----999999999973889899999999999875127899-----899999999987
Q gi|254780709|r   22 ASTSLKLKEGITDIISSRRLDDG----VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS-----VQRVLYDVSELI   92 (321)
Q Consensus        22 ~kt~~~L~~~l~~l~~~~~lde~----~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~-----~~~i~~~l~~~L   92 (321)
                      .++...+.+-|+++.+++.|.++    .++.+++-||.-.|..+.++++++.+...+.++.+.     ...+...+++.|
T Consensus       274 ~k~~g~aFg~fkglvG~K~L~eeDL~pvL~km~ehLitKNVA~eiA~~LcesV~a~Legkkv~sfs~V~~Tvk~Al~daL  353 (587)
T KOG0781         274 KKTVGGAFGLFKGLVGSKSLSEEDLNPVLDKMTEHLITKNVAAEIAEKLCESVAASLEGKKVGSFSTVESTVKEALRDAL  353 (587)
T ss_pred             HCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             42024589988863155644475669999999999876201289999999999998510210450277899999999999


Q ss_pred             HHHCCCCCCC-----C-CCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH-
Q ss_conf             8520100121-----0-00136674123113544444247899999998522674267743451245688999997530-
Q gi|254780709|r   93 HKMLMPLSKP-----F-NWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRT-  165 (321)
Q Consensus        93 ~~~L~~~~~~-----~-~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~-  165 (321)
                      ..+|.|....     + ....+.+|+||.|||||||||.|++||+|+|+..++.+|+++||||||+||+|||++|.+++ 
T Consensus       354 vQILTP~~sVDlLrdI~~ar~~krPYvi~fvGVNGVGKSTNLAKIayWLlqNkfrVlIAACDTFRsGAvEQLrtHv~rl~  433 (587)
T KOG0781         354 VQILTPQRSVDLLRDIMSARRRKRPYVISFVGVNGVGKSTNLAKIAYWLLQNKFRVLIAACDTFRSGAVEQLRTHVERLS  433 (587)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHH
T ss_conf             98738873066999999987468975999982147665132999999998578369998624312447899999999998


Q ss_pred             -----CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             -----353212235866124542289999651487599865433321157789999899876302223430112310233
Q gi|254780709|r  166 -----SADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT  240 (321)
Q Consensus       166 -----~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~  240 (321)
                           -|++|...+|.||+.||++||++|+.++|||||||||||+|+|.+||.-|.|+.++-+      ||.+++|-.|+
T Consensus       434 ~l~~~~v~lfekGYgkd~a~vak~AI~~a~~~gfDvvLiDTAGRmhn~~~LM~~L~kl~~~n~------pD~i~~VgEAL  507 (587)
T KOG0781         434 ALHGTMVELFEKGYGKDAAGVAKEAIQEARNQGFDVVLIDTAGRMHNNAPLMTSLAKLIKVNK------PDLILFVGEAL  507 (587)
T ss_pred             HHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCC------CCEEEEEHHHH
T ss_conf             745520488861047782899999999998669878998354433478067899999974479------86599850555


Q ss_pred             CCHHHHHHHHHHHHHC-------CCCEEEEECCCC-CCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHC
Q ss_conf             5225778999876435-------897699965457-8706999999999769889997589813255577899999872
Q gi|254780709|r  241 TGQNALRQVEMFHAVA-------GTTGLIMTKMDG-TARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT  311 (321)
Q Consensus       241 ~gq~~~~~a~~F~~~~-------~~~g~I~TKlD~-ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~ll  311 (321)
                      .|.|+++|++.|+.++       .+||+|+||+|. +.+.|+++|++|.++.||.|+|+||.|.||+..+.+++++.||
T Consensus       508 VG~dsvdq~~~Fn~al~d~~~~r~iDgilltK~DTvdd~vG~~v~Mvy~t~~PIlFvG~GQtysDLr~l~vk~vV~tLm  586 (587)
T KOG0781         508 VGNDSVDQLKKFNRALADHSTPRLIDGILLTKFDTVDDKVGAAVSMVYITGKPILFVGVGQTYSDLRKLNVKAVVATLM  586 (587)
T ss_pred             HCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHEECCCCEEEEECCCCCHHHHHCCHHHHHHHHH
T ss_conf             2755899999999987448974423437887125065688878764200389769984586610376525899999863


No 15 
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=100.00  E-value=0  Score=441.53  Aligned_cols=265  Identities=22%  Similarity=0.287  Sum_probs=213.1

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             99999999999973889899999999999875127899-89999999998785201001210001366741231135444
Q gi|254780709|r   43 DGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS-VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG  121 (321)
Q Consensus        43 e~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~-~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG  121 (321)
                      +..+..+.+.|+..+|+...++++.+.+.++....+.. ...+...+.+.+...+......+.......+.||+||||||
T Consensus       154 ~~~~~~l~~~L~~~~~~~~~~~~i~~~l~~~~~~~d~~~~~~~~~~~~~~l~~~i~~~~~~~~~~~~~~~kvi~lVGPTG  233 (432)
T PRK12724        154 DSPLQRLGERLVREGMSQSYVEEMASKLEERLSPVDQGRNHNVTERAVTYLEERVSVDSDLFSGTGKNQRKVVFFVGPTG  233 (432)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHCCCCCCCEEEEEECCCC
T ss_conf             76899999999875668899999999998753810011067899999999998714774011035777762999989999


Q ss_pred             CCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             442478999999985-2267426774345124568899999753035321223586612454228999965148759986
Q gi|254780709|r  122 VGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIID  200 (321)
Q Consensus       122 ~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliD  200 (321)
                      ||||||+||||++|. ++|+||+||++||||+||+|||++||+++|||++...   ||... .+++..   +++|+||||
T Consensus       234 VGKTTTiAKLAA~~~l~~~kkVaLIT~DTYRIgAvEQLktYa~Il~iPv~vv~---~~~el-~~al~~---~~~DlILID  306 (432)
T PRK12724        234 SGKTTSIAKLAAKYFLHMGKSVSLYTTDNYRIAAIEQLKRYADTMGMPFYPVK---DIKKF-KETLAR---DGSELILID  306 (432)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEE---CHHHH-HHHHHH---CCCCEEEEE
T ss_conf             88899999999999997499279995266537799999999998599459951---89999-999985---699999992


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-HHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             54333211577899998998763022234301123102335225-77899987643589769996545787069999999
Q gi|254780709|r  201 TAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIV  279 (321)
Q Consensus       201 TAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~  279 (321)
                      ||||+|.|...|+||+.+.+++.   +..+.+++||++||+..+ ..++++.|. .++++++||||||||+.+|.+||++
T Consensus       307 TAGrS~rd~~~~~eL~~ll~~~~---~~~~ie~~LVLSaTtk~~dl~~ii~~f~-~l~~~~lIfTKLDET~s~G~ilni~  382 (432)
T PRK12724        307 TAGYSHRNLEQLERMQSFYSCFG---EKDSVENLLVLSSTSSYHHTLTVLKAYE-SLNYRRILLTKLDEADFLGSFLELA  382 (432)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHC---CCCCCEEEEEEECCCCHHHHHHHHHHHC-CCCCCEEEEEECCCCCCCCHHHHHH
T ss_conf             99989789999999999998636---6788517999978899899999999842-6999849997122779866999999


Q ss_pred             HHHCCCEEEEECCCCC-CCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             9976988999758981-32555778999998728656463
Q gi|254780709|r  280 VTHKIPVYFLGVGEGI-NDLEPFVAKDFSAVITGCLDYGE  318 (321)
Q Consensus       280 ~~~~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG~gd~~~  318 (321)
                      +.+++||+|+|+||+| |||++++|+++++.|||-.-+.|
T Consensus       383 ~~~~~PisYiT~GQ~VPdDI~~A~~~~la~lilg~~~~~~  422 (432)
T PRK12724        383 DTYSKSFTYLSVGQEVPFDILNATKNLMAECVVFPEKIAE  422 (432)
T ss_pred             HHHCCCEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHH
T ss_conf             9988986998089979717333599999999766798998


No 16 
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=100.00  E-value=0  Score=420.97  Aligned_cols=286  Identities=26%  Similarity=0.363  Sum_probs=236.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             14899999999999999999999860567-78999999999999973889899999999999875127899899999999
Q gi|254780709|r   11 LSWIRKLTKGFASTSLKLKEGITDIISSR-RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS   89 (321)
Q Consensus        11 m~~f~kLk~gL~kt~~~L~~~l~~l~~~~-~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~   89 (321)
                      -.-++.+++.++..++.|......+.... ...+.....+.+.|++++|+..++++|++.+.+     ..+..+....+.
T Consensus       118 ~~~~~~l~~El~~lr~~l~~~~~~~~~~~~~~~~p~~~~l~~~L~~~Gvs~~la~~l~~~~~~-----~~~~~~~~~~l~  192 (412)
T PRK05703        118 EKELKDMRKELAELKELLEHQLSMLAWEKLERIPPEFAKLYKRLKESGLSPEIADKLLKLLLE-----DMNPREAWRYLL  192 (412)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHH-----CCCHHHHHHHHH
T ss_conf             378999999999999999999864101222348878999999999869999999999998664-----289799999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHH-HCCC-CEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             98785201001210001366741231135444442478999999985-2267-426774345124568899999753035
Q gi|254780709|r   90 ELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMS-DAGL-KVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus        90 ~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~-kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      ..|.+.+.....    .......+|+||||+|||||||+||||++|. ++|+ +|+||++||||+||+|||++||+++||
T Consensus       193 ~~L~~~l~~~~~----~~~~~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~DtyRigA~eQLk~Ya~ilgv  268 (412)
T PRK05703        193 ELLANMLPTRVE----DILEQGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTYRIGAVEQLKTYAKIMGI  268 (412)
T ss_pred             HHHHHHCCCCCC----CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             999975788876----6545673699988888756769999999999972998179998376777799999999997197


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC-HHHH
Q ss_conf             321223586612454228999965148759986543332115778999989987630222343011231023352-2577
Q gi|254780709|r  168 DFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG-QNAL  246 (321)
Q Consensus       168 ~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g-q~~~  246 (321)
                      |++....   |.. ..++++.  ..++|+||||||||+|.|...++||+.+.+...      |.+++|||+|++. ++..
T Consensus       269 p~~v~~~---~~~-l~~al~~--~~~~dlILIDTaG~s~~d~~~~~eL~~~~~~~~------~~~~~LVlsat~~~~dl~  336 (412)
T PRK05703        269 PVKVAYD---PKE-LAKALEQ--LANCDLILIDTAGRSQRDPRLISELKALIENSK------PIDVYLVLSATTKYRDLK  336 (412)
T ss_pred             EEEEECC---HHH-HHHHHHH--HCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCC------CCCEEEEECCCCCHHHHH
T ss_conf             3798479---999-9999987--158997999689889789999999999986248------871899975989989999


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             8999876435897699965457870699999999976988999758981-32555778999998728656463
Q gi|254780709|r  247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGI-NDLEPFVAKDFSAVITGCLDYGE  318 (321)
Q Consensus       247 ~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG~gd~~~  318 (321)
                      ++++.|.. ++++++||||||||++.|.+||++..+++||+|+++||+| |||++++++++++++||-.|.+|
T Consensus       337 ~i~~~f~~-~~~~~lI~TKlDEt~~~G~il~~~~~~~lplsy~t~GQ~VPeDi~~a~~~~l~~~~l~g~~~~~  408 (412)
T PRK05703        337 DIVKHFSR-LPLDGLILTKLDETSSLGSILSLLIESGLPISYLTDGQRVPDDIKVATPEELVRLALGGFLKCE  408 (412)
T ss_pred             HHHHHHCC-CCCCEEEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCCCHHHHHCCCHHHHHHHHHCCCCCCC
T ss_conf             99998467-9998799971128998629999999988796999469997243422899999999858755567


No 17 
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=100.00  E-value=0  Score=408.50  Aligned_cols=286  Identities=23%  Similarity=0.281  Sum_probs=229.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             14899999999999999999999860567-78999999999999973889899999999999875127899899999999
Q gi|254780709|r   11 LSWIRKLTKGFASTSLKLKEGITDIISSR-RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS   89 (321)
Q Consensus        11 m~~f~kLk~gL~kt~~~L~~~l~~l~~~~-~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~   89 (321)
                      ......+.+.+..+++.+...+.++.... .-.+.....+.+.|+.++|+..+++++++++..     +.+.+.....+.
T Consensus        82 ~~~~~~l~~El~~lr~~l~~ql~~~~~~~~~~~~p~~~~l~~~L~~~g~~~~la~~l~~~l~~-----~~~~~~~~~~~~  156 (404)
T PRK06995         82 DIVNATVMQELGSMRGMLEEQLAGLAWGDRQRRDPVRGALFRHLLAAGFSAQLVRMLLENLPA-----GDDAQAAMDWAR  156 (404)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCC-----CCCHHHHHHHHH
T ss_conf             055899999999999999999998641264425807999999999879999999999984703-----389789999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHH-HCCC-CEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             98785201001210001366741231135444442478999999985-2267-426774345124568899999753035
Q gi|254780709|r   90 ELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMS-DAGL-KVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus        90 ~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~-kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      ..|...+.......  ..-.+..|++||||+|||||||+||||+++. ++|+ ||+||++||||+||+|||++||+++||
T Consensus       157 ~~l~~~l~~~~~~~--~~~~~ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~Ilgv  234 (404)
T PRK06995        157 SVLASNLPVLGSED--ALMERGGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKILGV  234 (404)
T ss_pred             HHHHHHCCCCCCCC--CHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCC
T ss_conf             99997466666653--1011475589866888763758999999999983898379997687547899999999987595


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-HHH
Q ss_conf             3212235866124542289999651487599865433321157789999899876302223430112310233522-577
Q gi|254780709|r  168 DFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-NAL  246 (321)
Q Consensus       168 ~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-~~~  246 (321)
                      |++......   . ..+++..  .+++|+||||||||+|.|..+++|+..+...      ..|.+++||++|++.. +..
T Consensus       235 Pv~vv~~~~---e-L~~aL~~--l~~~dlILIDTaGrs~rD~~~~e~l~~l~~~------~~~~~~~LVLsat~~~~dl~  302 (404)
T PRK06995        235 PVHAVKDAA---D-LRLALAE--LRNKHIVLIDTVGMSQRDRMVSEQIAMLHGA------GAPVQRLLLLNATSHGDTLN  302 (404)
T ss_pred             EEEEECCHH---H-HHHHHHH--HCCCCEEEEECCCCCCCCHHHHHHHHHHHHC------CCCCEEEEEECCCCCHHHHH
T ss_conf             599959999---9-9999997--0899999980999897688899999999735------78852899977989999999


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCHHHHHHHHCCCCCC
Q ss_conf             8999876435897699965457870699999999976988999758981-325557789999987286564
Q gi|254780709|r  247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGI-NDLEPFVAKDFSAVITGCLDY  316 (321)
Q Consensus       247 ~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG~gd~  316 (321)
                      ++++.|. .++++++||||||||++.|.+||+++.+++||+|+++||+| |||++.+++..++|-|...-.
T Consensus       303 ~i~~~f~-~~~~~~~I~TKLDEt~~~G~iln~~~~~~lPlsy~T~GQ~VPeDi~~A~~~~Lv~ra~~~~~~  372 (404)
T PRK06995        303 EVVQAYR-GPGLAGCILTKLDEAASLGGALDTVIRHKLPLHYVSNGQRVPEDLHVANAKFLLHRAFCAPRE  372 (404)
T ss_pred             HHHHHHC-CCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCHHCCCHHHHHHHHHHCCCC
T ss_conf             9999844-699983998304067972399999999789859981899584212108989999998626455


No 18 
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=100.00  E-value=0  Score=401.86  Aligned_cols=173  Identities=43%  Similarity=0.685  Sum_probs=169.1

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      +||+||||||||||||+||||++++++|++|++|++||||+||+|||++||+++|+|++..+.+.||.+++++++++++.
T Consensus         1 ~Vi~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit~Dt~R~gA~eQL~~~a~~l~v~~~~~~~~~~~~~~~~~~~~~~~~   80 (173)
T cd03115           1 TVILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQVGVPVFEEGEGKDPVSIAKRAIEHARE   80 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             99999899999889999999999997699289997488757799999999997498599227755879999999999875


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             14875998654333211577899998998763022234301123102335225778999876435897699965457870
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTAR  271 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~  271 (321)
                      +++|+||||||||+|+|.++|+||+++.+.++      |++++||+||++||++.+|++.|++.++++++|+|||||+++
T Consensus        81 ~~~D~IlIDTaGr~~~d~~~~~el~~l~~~~~------p~~~~LVl~a~~~~~~~~~~~~f~~~~~~~~~I~TKlDet~~  154 (173)
T cd03115          81 ENFDVVIVDTAGRLQIDENLMEELKKIKRVVK------PDEVLLVVDAMTGQDAVNQAKAFNEALGITGVILTKLDGDAR  154 (173)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHC------CCCCEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCC
T ss_conf             68998999788878799999999999986448------972157424655065899999987427997899971438997


Q ss_pred             HHHHHHHHHHHCCCEEEEE
Q ss_conf             6999999999769889997
Q gi|254780709|r  272 GGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       272 ~G~~ls~~~~~~~Pi~fig  290 (321)
                      +|.+||+++.+++||+|+|
T Consensus       155 ~G~~ls~~~~~~~Pi~fig  173 (173)
T cd03115         155 GGAALSIRAVTGKPIKFIG  173 (173)
T ss_pred             CCHHHHHHHHHCCCEEEEC
T ss_conf             5799999999890908509


No 19 
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=100.00  E-value=0  Score=389.99  Aligned_cols=250  Identities=20%  Similarity=0.298  Sum_probs=197.6

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHH
Q ss_conf             99999999738898999999999998751278-99899999999987852010012100013667412311354444424
Q gi|254780709|r   47 EELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT  125 (321)
Q Consensus        47 eeLee~LL~ADVg~~va~~Iie~ik~~~~~~~-i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKT  125 (321)
                      .++-..|-.+||..-......++++-+..... +..++++..+-+-+.+-..    .-+. +.+....|.||||+|||||
T Consensus       181 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~-~~~~~q~IALVGPTGVGKT  255 (436)
T PRK11889        181 QKVIRMLEQNDVEQYFIHAYAEKLKVKFENATMITEEEVIKYILEDMRSHFN----TENV-FEKEVQTIALIGPTGVGKT  255 (436)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCC----HHHH-HHHHCEEEEEECCCCCCHH
T ss_conf             9999998855525899999999863112134110299999999999887403----1013-3641717999899998889


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH-HCCCEEEEECCCC
Q ss_conf             789999999852267426774345124568899999753035321223586612454228999965-1487599865433
Q gi|254780709|r  126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA-KKVDVLIIDTAGR  204 (321)
Q Consensus       126 TT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~-~~~DvvliDTAGR  204 (321)
                      ||+||||++|..++++|+||++||||+||+|||++||+++|+|+.....   |..+ .+|+...+. .++|+||||||||
T Consensus       256 TTIAKLAArf~~~~KkVALITtDTYRIGAVEQLKTYAeIMgVPV~VV~d---p~eL-~~AL~~lkdka~~DLILIDTAGR  331 (436)
T PRK11889        256 TTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQLQDYVKTIGFEVIAVRD---EAAM-TRALTYFKEEARVDYILIDTAGK  331 (436)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEECC---HHHH-HHHHHHHHHCCCCCEEEEECCCC
T ss_conf             9999999998616980899980663476999999999984994399688---8999-99999876336888899929898


Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-HHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             321157789999899876302223430112310233522-5778999876435897699965457870699999999976
Q gi|254780709|r  205 LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-NALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHK  283 (321)
Q Consensus       205 ~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~  283 (321)
                      +|.|...|+||..+.+...      |++++||++|++.. +..++++.|. .++++|+||||||||+++|.+||+...++
T Consensus       332 S~RD~~~I~EL~~~l~~~~------p~ev~LVLSATTK~~DL~eIi~rF~-~l~idglIfTKLDET~SlG~ILNv~~~s~  404 (436)
T PRK11889        332 NYRASETVEEMIETMGQVE------PDYICLTLSASMKSKDMIEIITNFK-DIHIDGIVFTKFDETASSGELLKIPAVSS  404 (436)
T ss_pred             CCCCHHHHHHHHHHHHHCC------CCEEEEEEECCCCHHHHHHHHHHHC-CCCCCEEEEEECCCCCCCHHHHHHHHHHC
T ss_conf             8468999999999985127------7716999978899899999999725-79988289971325687037888998839


Q ss_pred             CCEEEEECCCCC-CCCCCCCHHHHHHHHCC
Q ss_conf             988999758981-32555778999998728
Q gi|254780709|r  284 IPVYFLGVGEGI-NDLEPFVAKDFSAVITG  312 (321)
Q Consensus       284 ~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG  312 (321)
                      +||+|+++||+| +||++++++++++.+|-
T Consensus       405 LPIsYvTdGQ~VPEDIevA~ae~LAk~mLe  434 (436)
T PRK11889        405 APIVLMTDGQDVKKNIHIATAEHLAKQMLQ  434 (436)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHH
T ss_conf             987997899858753000699999999843


No 20 
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=100.00  E-value=0  Score=384.34  Aligned_cols=218  Identities=29%  Similarity=0.414  Sum_probs=183.0

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             9999998785201001210001366741231135444442478999999985--22674267743451245688999997
Q gi|254780709|r   85 LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMS--DAGLKVMLAAGDTFRSAAIDQLKIWA  162 (321)
Q Consensus        85 ~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~--~~g~kV~lva~DtfR~aA~eQL~~~a  162 (321)
                      .....+.+..++....... ..  .++.+|++|||+|||||||+||||++|.  .+.++|++|++||||+||+|||++||
T Consensus       180 ~~~~~~~l~~~~~~~~~~~-~~--~~~~vi~LVGPTGVGKTTTlAKLAar~~~~~~~~kVaiITtDtYRIGA~EQLk~Ya  256 (407)
T COG1419         180 LRYFSEKLRKLLLSLIENL-IV--EQKRVIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAIITTDTYRIGAVEQLKTYA  256 (407)
T ss_pred             HHHHHHHHHHHHHHHCCCC-CC--CCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             3217999999887644111-12--46857999899887588799999999975325760689971441152899999999


Q ss_pred             HHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             53035321223586612454228999965148759986543332115778999989987630222343011231023352
Q gi|254780709|r  163 DRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       163 ~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      +++|+|+......   ... -+|+..  .+++|+||||||||+|.|...++||+.+.++.      .+.+++||++|++-
T Consensus       257 ~im~vp~~vv~~~---~el-~~ai~~--l~~~d~ILVDTaGrs~~D~~~i~el~~~~~~~------~~i~~~Lvlsat~K  324 (407)
T COG1419         257 DIMGVPLEVVYSP---KEL-AEAIEA--LRDCDVILVDTAGRSQYDKEKIEELKELIDVS------HSIEVYLVLSATTK  324 (407)
T ss_pred             HHHCCCEEEECCH---HHH-HHHHHH--HHCCCEEEEECCCCCCCCHHHHHHHHHHHHCC------CCCEEEEEEECCCC
T ss_conf             9869955996399---999-999998--53188899968998833789999999997035------66217999845764


Q ss_pred             -HHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             -25778999876435897699965457870699999999976988999758981-32555778999998728656463
Q gi|254780709|r  243 -QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGI-NDLEPFVAKDFSAVITGCLDYGE  318 (321)
Q Consensus       243 -q~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~llG~gd~~~  318 (321)
                       ++..++.+.|. .+|++|+||||||||.+.|.++|+++++++||+|+++||+| +||...+|++++++++|.-...+
T Consensus       325 ~~dlkei~~~f~-~~~i~~~I~TKlDET~s~G~~~s~~~e~~~PV~YvT~GQ~VPeDI~va~~~~Lv~~~~g~~~~~~  401 (407)
T COG1419         325 YEDLKEIIKQFS-LFPIDGLIFTKLDETTSLGNLFSLMYETRLPVSYVTNGQRVPEDIVVANPDYLVRRILGTFANQE  401 (407)
T ss_pred             HHHHHHHHHHHC-CCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCHHHHCCHHHHHHHHHCCCCCCC
T ss_conf             688999999724-58866168971335676338999999968974997179878703553586889999861214477


No 21 
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=100.00  E-value=0  Score=369.26  Aligned_cols=274  Identities=22%  Similarity=0.306  Sum_probs=217.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             99999999999999999999860567789999999999999738898999999999998751278998999999999878
Q gi|254780709|r   14 IRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIH   93 (321)
Q Consensus        14 f~kLk~gL~kt~~~L~~~l~~l~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~   93 (321)
                      ++.++..+...++-|...+..+..+..=-+...-.+-+-|+...++..+++++.+.+-     .+.+..+....+...|.
T Consensus       260 l~~mr~El~smR~llE~Ql~~L~~e~~r~~P~ra~L~krL~~~GfS~~Lar~L~~~lP-----~~~~~~~a~~~ll~~La  334 (557)
T PRK12727        260 LKQLRGELALMRQMIEREMNRLTDERLRGSPVRAQALELMDDYGFDAGLTRDVAMQIP-----ADTELHRGRGLMLGLLS  334 (557)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHCC-----CCCCHHHHHHHHHHHHH
T ss_conf             9999999999999999999998887772393889999999976699999999997483-----32788899999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHH-HCC-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             5201001210001366741231135444442478999999985-226-74267743451245688999997530353212
Q gi|254780709|r   94 KMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMS-DAG-LKVMLAAGDTFRSAAIDQLKIWADRTSADFVC  171 (321)
Q Consensus        94 ~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~-~~g-~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~  171 (321)
                      ..|.-..... +   .+-.|+.||||+|||||||+||||++|. +.| ++|+||++||||+||+|||++||+++|||++.
T Consensus       335 ~~Lpv~~~d~-~---~~gGv~AlvGpTGvGKTTT~aKlAa~~~~~~g~~~valit~DtyRiga~eQL~~y~~ilgvpv~~  410 (557)
T PRK12727        335 KRLPVAPVDP-L---ERGGVIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTTDTQRVGGREQLHSYGRQLGIAVHE  410 (557)
T ss_pred             HHCCCCCCCH-H---HCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEEEE
T ss_conf             6287777751-5---40764787437776731179999999999739981899972664087999999999983975798


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-HHHHHHH
Q ss_conf             235866124542289999651487599865433321157789999899876302223430112310233522-5778999
Q gi|254780709|r  172 SEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-NALRQVE  250 (321)
Q Consensus       172 ~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-~~~~~a~  250 (321)
                      .....|   + .+++.  ..+++|+||||||||+|.|..+++||..+..       ....+++||++|++.. +..+++.
T Consensus       411 ~~~~~~---l-~~~l~--~l~~~~lvliDTaG~~~rd~~~~~~~~~l~~-------~~~~~~~Lvl~a~~~~~~l~~~~~  477 (557)
T PRK12727        411 ADSAES---L-LDLLE--RLRDYKLVLIDTAGMGQRDRALAAQLNWLRA-------ARQVTSLLVLPANAHFSDLDEVVR  477 (557)
T ss_pred             ECCHHH---H-HHHHH--HHCCCCEEEEECCCCCCCCHHHHHHHHHHHC-------CCCCCEEEEEECCCCHHHHHHHHH
T ss_conf             289999---9-99999--8369998999499988469999999998751-------477635999968899899999999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCHHHHHHHH
Q ss_conf             876435897699965457870699999999976988999758981-325557789999987
Q gi|254780709|r  251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGI-NDLEPFVAKDFSAVI  310 (321)
Q Consensus       251 ~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i-~Dl~~f~~~~~~~~l  310 (321)
                      .|. .++++|+||||+||+.+.|.+||++..+++|+.|+++||+| +||++.++..+++|.
T Consensus       478 ~~~-~~~~~~~i~TKlDE~~~~G~~l~~~~~~~lp~~y~t~GQ~VPeDi~~a~~~~Lv~Ra  537 (557)
T PRK12727        478 RFA-HAKPQGVVLTKLDETGRFGSALSVVVDHQMPITWVTDGQRVPDDLHRANAASLVLRL  537 (557)
T ss_pred             HHC-CCCCCEEEEEECCCCCCCCHHHHHHHHHCCCEEEECCCCCCCCCHHHCCHHHHHHHH
T ss_conf             853-799874899614367870399999999689828975898285236438999999999


No 22 
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=100.00  E-value=3.5e-31  Score=239.16  Aligned_cols=175  Identities=25%  Similarity=0.316  Sum_probs=131.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             99999999999999999999860567789999999999999738898999999999998751278998999999999878
Q gi|254780709|r   14 IRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIH   93 (321)
Q Consensus        14 f~kLk~gL~kt~~~L~~~l~~l~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~   93 (321)
                      .+.+++.+...++.+...+..+... ..+ .....+.+.|++++|...++.+|++.+..     ..+.+.....+...|.
T Consensus       106 ~~~l~~El~~lk~~l~~~~~~~~~~-~~~-~~~~~l~~~L~~~gv~~~~~~~l~~~~~~-----~~~~~~~~~~l~~~L~  178 (282)
T TIGR03499       106 PEELRKELSALRELLERLLAGLAWL-QRD-PEGAKLYERLEEAGVSEELARELLEKLPE-----RADAESAWRWLREALE  178 (282)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHC-CCC-HHHHHHHHHHHHCCCCHHHHHHHHHHHHH-----CCCHHHHHHHHHHHHH
T ss_conf             8999999999999999997554214-588-68999999999869999999999997460-----2997899999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHH-C-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             52010012100013667412311354444424789999999852-2-674267743451245688999997530353212
Q gi|254780709|r   94 KMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD-A-GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC  171 (321)
Q Consensus        94 ~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~-g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~  171 (321)
                      +.+...  +........+.|++||||+|||||||+||||++|.. . +++|+||++||||+||+|||++||+++|||++.
T Consensus       179 ~~i~~~--~~~~~~~~~~~vi~lvGPTGVGKTTTiAKLAa~~~l~~~~~~V~lIT~DtyRigA~eQLk~ya~il~vp~~v  256 (282)
T TIGR03499       179 NMLPVK--PEEDEILEQGGVIALVGPTGVGKTTTLAKLAARFVLEHGKKKVALITTDTYRIGAVEQLKTYAKILGVPVKV  256 (282)
T ss_pred             HHCCCC--CCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEE
T ss_conf             647778--876554456727999778887578899999999999738996799980777678999999999995974899


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             23586612454228999965148759986543
Q gi|254780709|r  172 SEIGSDAAALAYEAFKQAQAKKVDVLIIDTAG  203 (321)
Q Consensus       172 ~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAG  203 (321)
                      ...   |..+ .++++.  .+++|+|||||||
T Consensus       257 v~~---~~~l-~~~l~~--~~~~d~IlIDTaG  282 (282)
T TIGR03499       257 ARD---PKEL-AKALER--LRDKDLILIDTAG  282 (282)
T ss_pred             ECC---HHHH-HHHHHH--CCCCCEEEEECCC
T ss_conf             399---9999-999986--5798999981979


No 23 
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional
Probab=98.94  E-value=4.7e-08  Score=76.86  Aligned_cols=149  Identities=14%  Similarity=0.218  Sum_probs=97.6

Q ss_pred             CCCCCEEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH---------------HHHH------HH
Q ss_conf             6674123113-544444247899999998522674267743451245688999---------------9975------30
Q gi|254780709|r  108 SHRPHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLK---------------IWAD------RT  165 (321)
Q Consensus       108 ~~~p~vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~---------------~~a~------~~  165 (321)
                      ..++.||++. -..|-||||+++-||.-+...|+||+||-||.-|+.-...+.               .|.+      ..
T Consensus       528 ~~~~kvi~vTS~~pgEGKSt~a~nLA~~~A~~G~rvLLID~DlRrp~l~~~~~~~~~~GLs~~L~g~~~~~~~i~~~~~~  607 (726)
T PRK09841        528 ETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKG  607 (726)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHCCCCCCCCHHHHHCCCCCHHHHCCCCCCC
T ss_conf             88886899977999997799999999999847995999828877710776159999987799838999889933027989


Q ss_pred             CCCCCC-CCCCCCCHHHHH----HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-
Q ss_conf             353212-235866124542----28999965148759986543332115778999989987630222343011231023-
Q gi|254780709|r  166 SADFVC-SEIGSDAAALAY----EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-  239 (321)
Q Consensus       166 ~v~~~~-~~~~~dp~~v~~----~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-  239 (321)
                      +++|.. ++...+|+.+.-    ..+-..-.+.||+|||||+==+..-..++  |..           ..|-++||+.+ 
T Consensus       608 ~ldvl~aG~~p~nP~elL~s~~~~~ll~~l~~~yD~IIiDtPPvl~v~Da~~--l~~-----------~~D~~l~Vvr~g  674 (726)
T PRK09841        608 GFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAV--VGR-----------SVGTSLLVARFG  674 (726)
T ss_pred             CEEEEECCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHH--HHH-----------HCCEEEEEEECC
T ss_conf             9899828999979899958769999999998139999991999653415999--999-----------789599999799


Q ss_pred             CCCHHHHHHH-HHHHH-HCCCCEEEEECCCCC
Q ss_conf             3522577899-98764-358976999654578
Q gi|254780709|r  240 TTGQNALRQV-EMFHA-VAGTTGLIMTKMDGT  269 (321)
Q Consensus       240 ~~gq~~~~~a-~~F~~-~~~~~g~I~TKlD~t  269 (321)
                      .|..+.+..+ +.+.+ .+++.|+|++.+|-.
T Consensus       675 ~T~~~~~~~a~~~l~~~~~~v~G~vlN~v~~~  706 (726)
T PRK09841        675 LNTAKEVSLSMQRLEQAGVNIKGAILNGVIKR  706 (726)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             68899999999999978997589998288656


No 24 
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA).  This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life.  ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities.   To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates.  A divalent cation, typically Mg2+, is required for its enzymatic activity.
Probab=98.88  E-value=5.8e-08  Score=76.18  Aligned_cols=38  Identities=34%  Similarity=0.560  Sum_probs=35.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             12311354444424789999999852267426774345
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      .+|+|.|=-||||||+.+=+|..+.++|+||+++++|-
T Consensus         1 r~i~~~GKGGVGKTT~AaalA~~lA~~G~kVLlvstDP   38 (254)
T cd00550           1 RYIFFGGKGGVGKTTISAATAVRLAEQGKKVLLVSTDP   38 (254)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             98999689855489999999999996899499995898


No 25 
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=98.81  E-value=6.3e-08  Score=75.97  Aligned_cols=137  Identities=23%  Similarity=0.276  Sum_probs=90.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---CCCHHHHHHHHH----HHHHHCCCCCCCCC---CCCCHHHH
Q ss_conf             231135444442478999999985226742677434---512456889999----97530353212235---86612454
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKI----WADRTSADFVCSEI---GSDAAALA  182 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D---tfR~aA~eQL~~----~a~~~~v~~~~~~~---~~dp~~v~  182 (321)
                      ||-+.||.|+||||-+.+|+.+|.++|++|+++|.|   .|.-||+-.=|+    |+..-++-+-....   -...+..+
T Consensus         1 viGitG~pGaGKStLi~~l~~~~~~~g~~VaVlavDPsS~~sgGalLGDRiRm~~~~~~~~vfiRs~atrg~~ggla~~~   80 (148)
T cd03114           1 VIGITGVPGAGKSTLIDALITALRARGKRVAVLAIDPSSPFSGGAILGDRIRMERHASDPGVFIRSLATRGFLGGLSRAT   80 (148)
T ss_pred             CEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHH
T ss_conf             97625899787899999999999978983799996888786686203235453441579983686346666542046889


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC-CCEE
Q ss_conf             228999965148759986543332115778999989987630222343011231023352257789998764358-9769
Q gi|254780709|r  183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAG-TTGL  261 (321)
Q Consensus       183 ~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~-~~g~  261 (321)
                      ++++...+..+||+|||.|.|=.|....-.       .        ..|.+++|++...|-+.  |++- .-.+. -|=+
T Consensus        81 ~~~i~~l~~~g~D~IiIETvGvGQse~~i~-------~--------~aD~~i~v~~p~~GD~i--Q~~K-~gi~e~aDl~  142 (148)
T cd03114          81 PEVIRVLDAAGFDVIIVETVGVGQSEVDIA-------S--------MADTTVVVMAPGAGDDI--QAIK-AGIMEIADIV  142 (148)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHH-------H--------HCCEEEEEECCCCCCHH--HHCC-CCHHHCCCEE
T ss_conf             999999997599989997487775602655-------4--------35669999636887377--6112-2852124699


Q ss_pred             EEECCC
Q ss_conf             996545
Q gi|254780709|r  262 IMTKMD  267 (321)
Q Consensus       262 I~TKlD  267 (321)
                      ++.|.|
T Consensus       143 vvNK~D  148 (148)
T cd03114         143 VVNKAD  148 (148)
T ss_pred             EEECCC
T ss_conf             993789


No 26 
>PHA02518 ParA-like protein; Provisional
Probab=98.80  E-value=2.6e-07  Score=71.58  Aligned_cols=145  Identities=18%  Similarity=0.218  Sum_probs=86.5

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH--CCCCCCCC-CCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             4444247899999998522674267743451245688999997530--35321223-58661245422899996514875
Q gi|254780709|r  120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRT--SADFVCSE-IGSDAAALAYEAFKQAQAKKVDV  196 (321)
Q Consensus       120 nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~--~v~~~~~~-~~~dp~~v~~~a~~~a~~~~~Dv  196 (321)
                      =|||||||+.-||++|.++|++|+++-+|..+.+.     .|.+.-  +-|.+... .+.   . ....+.. ...+||+
T Consensus        10 GGvGKTT~a~nLA~~la~~G~~VlliD~DpQ~s~~-----~w~~~r~~~~~~~~~~~~~~---~-~~~~l~~-~~~~yD~   79 (211)
T PHA02518         10 GGAGKTTVATNLASWLHADGHKVLLVDLDPQGSST-----DWAEAREEGEPLIPVVRMGK---S-IRADLPK-VASGYDY   79 (211)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHH-----HHHHHCCCCCCCCCHHHCCH---H-HHHHHHH-HCCCCCE
T ss_conf             99749999999999999789948999779996788-----99985226899740121367---7-9999997-4067888


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-------CCC-HHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             9986543332115778999989987630222343011231023-------352-25778999876435897699965457
Q gi|254780709|r  197 LIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-------TTG-QNALRQVEMFHAVAGTTGLIMTKMDG  268 (321)
Q Consensus       197 vliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-------~~g-q~~~~~a~~F~~~~~~~g~I~TKlD~  268 (321)
                      |||||+|++.   .++...      +.     .-|.++.-+..       +.+ .+.+++++..++..+.-+++++..+.
T Consensus        80 viID~pp~~~---~~~~~a------l~-----aaD~vliP~~ps~~d~~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~~~  145 (211)
T PHA02518         80 VVVDGAPQDS---ELARAA------LR-----IADMVLIPVQPSPFDIWAAPDLVELIKARQEVTDGLPKFAFIISRAIK  145 (211)
T ss_pred             EEECCCCCCH---HHHHHH------HH-----HCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCC
T ss_conf             9988999742---999999------99-----589699963786878999999999999999866567516888623586


Q ss_pred             CCCH-HHHHHHHHHHCCCEEE
Q ss_conf             8706-9999999997698899
Q gi|254780709|r  269 TARG-GGLIPIVVTHKIPVYF  288 (321)
Q Consensus       269 ta~~-G~~ls~~~~~~~Pi~f  288 (321)
                      .++- -.+.......+.|+.-
T Consensus       146 ~~~~~~~~~~~l~~~~~~v~~  166 (211)
T PHA02518        146 NTQLYREARKALAGYGLPILR  166 (211)
T ss_pred             CCHHHHHHHHHHHHCCCCCCC
T ss_conf             656999999999986998106


No 27 
>PRK11519 tyrosine kinase; Provisional
Probab=98.78  E-value=3.7e-07  Score=70.58  Aligned_cols=149  Identities=17%  Similarity=0.207  Sum_probs=95.2

Q ss_pred             CCCCCEEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH---------------------HHHH
Q ss_conf             6674123113-54444424789999999852267426774345124568899999---------------------7530
Q gi|254780709|r  108 SHRPHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIW---------------------ADRT  165 (321)
Q Consensus       108 ~~~p~vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~---------------------a~~~  165 (321)
                      ..++.+|++. -..|-||||+++-||.-+...|+||+||-||--|+.-.+.+..-                     ...-
T Consensus       523 ~~~~~vi~vTS~~pgEGKSt~a~nLA~~~A~~G~rvLLID~DlRrp~l~~~~~~~~~~GLs~~L~g~~~~~~~i~~~~~~  602 (720)
T PRK11519        523 QAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIA  602 (720)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHCCCCCCCCHHHHCCCCCCHHHHCCCCCCC
T ss_conf             88876799970899997899999999999837991999938777701677539999998599807999789970357989


Q ss_pred             CCCCCC-CCCCCCCHHHHH----HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-
Q ss_conf             353212-235866124542----28999965148759986543332115778999989987630222343011231023-
Q gi|254780709|r  166 SADFVC-SEIGSDAAALAY----EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-  239 (321)
Q Consensus       166 ~v~~~~-~~~~~dp~~v~~----~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-  239 (321)
                      +.+|.+ +....+|+.+.-    ..+-..-.+.||+|||||+==+..-..++     +.+        .-|-++||+-+ 
T Consensus       603 ~l~vl~~G~~~pnp~elL~s~~~~~ll~~l~~~yD~IIiDtpPv~~v~Da~~-----la~--------~aD~~l~Vvr~g  669 (720)
T PRK11519        603 NFDLIPRGQVPPNPSELLMSERFAELVAWASKNYDLVLIDTPPILAVTDAAI-----VGR--------HVGTTLMVARYA  669 (720)
T ss_pred             CEEEECCCCCCCCHHHHHCCHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH-----HHH--------HCCEEEEEEECC
T ss_conf             9899769999949899838759999999998529999993999652358999-----999--------789799999899


Q ss_pred             CCCHHHHHHH-HHHHH-HCCCCEEEEECCCCC
Q ss_conf             3522577899-98764-358976999654578
Q gi|254780709|r  240 TTGQNALRQV-EMFHA-VAGTTGLIMTKMDGT  269 (321)
Q Consensus       240 ~~gq~~~~~a-~~F~~-~~~~~g~I~TKlD~t  269 (321)
                      .|-...+..+ +.+.+ .+.+.|+||.++|--
T Consensus       670 ~t~~~~v~~a~~~l~~~~~~v~G~VlN~v~~~  701 (720)
T PRK11519        670 VNTLKEVETSLSRFEQNGIPVKGVILNSIFRR  701 (720)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             57899999999999968997489998897666


No 28 
>pfam02374 ArsA_ATPase Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.
Probab=98.78  E-value=2.7e-07  Score=71.52  Aligned_cols=38  Identities=39%  Similarity=0.538  Sum_probs=36.0

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             12311354444424789999999852267426774345
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      .+|++.|--||||||+.|=+|.++.+.|+||+++++|.
T Consensus         2 r~i~~~GKGGVGKTT~AaA~A~~~A~~G~rvLlvStDP   39 (304)
T pfam02374         2 RWIFFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTDP   39 (304)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             19999579857489999999999995899299994697


No 29 
>pfam02881 SRP54_N SRP54-type protein, helical bundle domain.
Probab=98.78  E-value=5.4e-08  Score=76.43  Aligned_cols=76  Identities=30%  Similarity=0.413  Sum_probs=63.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHH
Q ss_conf             99999999999999999860567789999999999999738898999999999998751278998-99999999987
Q gi|254780709|r   17 LTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSV-QRVLYDVSELI   92 (321)
Q Consensus        17 Lk~gL~kt~~~L~~~l~~l~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~-~~i~~~l~~~L   92 (321)
                      |++||.+++++|++.+.+++.+.+..+++|++||++||+||||++++++|++++++....+.++. +.+...+++.|
T Consensus         1 l~~~l~kt~~~l~~~~~~~~~~~~~i~~~l~ele~~Li~aDvg~~~~~~ii~~l~~~~~~~~~~~~~~i~~~l~e~L   77 (77)
T pfam02881         1 LKEGLSKTRSKLGGKIKDLFLGEKKIDELLEELEEALLEADVGVETTEKIIERLKELVGRKGLSDPEEIKKALKEEL   77 (77)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHC
T ss_conf             91268898999999999998489860899999999999812468999999999999998717999999999999769


No 30 
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.
Probab=98.73  E-value=3.1e-07  Score=71.11  Aligned_cols=144  Identities=19%  Similarity=0.255  Sum_probs=75.6

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC---------HHHH------HH-HHHHHHHHCCCCC------
Q ss_conf             231135444442478999999985226742677434512---------4568------89-9999753035321------
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR---------SAAI------DQ-LKIWADRTSADFV------  170 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR---------~aA~------eQ-L~~~a~~~~v~~~------  170 (321)
                      ++++.|-=||||||+.+-||..+.++|+||+++++|--+         ..+.      |. ...|.........      
T Consensus         1 i~~~sGKGGVGKTTvAaalA~~lA~~G~rvLlvs~DPah~l~d~~~~~L~~~~~~~~~e~~~~~~~~~v~~~~~~~~~~~   80 (217)
T cd02035           1 VIFFTGKGGVGKTTIAAATAVRLAEEGKKVLLVSTDPAHNLSDKGLPNLSDAFIVEDPEIAPNLYREEVDATRRVERAWG   80 (217)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98997899661999999999999968994999958987665323479865135888766679999875016665333110


Q ss_pred             ------CCCCCCCCH----HHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCE--EEEECC
Q ss_conf             ------223586612----45422899996514875998654333211577899998998763022234301--123102
Q gi|254780709|r  171 ------CSEIGSDAA----ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHS--VLQVLD  238 (321)
Q Consensus       171 ------~~~~~~dp~----~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~--~~lVld  238 (321)
                            ......-|.    .......+.....+||+|+||||==-|.=.-|+.++      +.     .|..  .++|.-
T Consensus        81 ~~~~~~~~~~~~~pg~~E~~~l~~~~~~~~~~~yD~IVvDtpPTGhtlrlL~~~~------L~-----d~~~t~~~lVt~  149 (217)
T cd02035          81 GEGGLMLELAAALPGIEELASLLAVFREFSEGLYDVIVFDTAPTGHTLRLLVREL------LT-----DPERTSFRLVTL  149 (217)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHH------HC-----CCCCCEEEEEEC
T ss_conf             0114567776159978999999999999854899889982898556999867887------24-----888767999957


Q ss_pred             C--CCCHHHHHHHHHHHH-HCCCCEEEEECCC
Q ss_conf             3--352257789998764-3589769996545
Q gi|254780709|r  239 A--TTGQNALRQVEMFHA-VAGTTGLIMTKMD  267 (321)
Q Consensus       239 a--~~gq~~~~~a~~F~~-~~~~~g~I~TKlD  267 (321)
                      +  +.=.++.+-...+++ -+++.++|+.++=
T Consensus       150 Pe~~~~~et~r~~~~L~~~gi~v~~vVvN~v~  181 (217)
T cd02035         150 PEKLPLYETERAITELALYGIPVDAVVVNRVL  181 (217)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             76217999999999999779988989895882


No 31 
>pfam07015 VirC1 VirC1 protein. This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumour formation by increasing the level of T-DNA processing. It is thought that the virC operon which enhances T-DNA processing probably does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA.
Probab=98.73  E-value=6.6e-08  Score=75.79  Aligned_cols=159  Identities=19%  Similarity=0.257  Sum_probs=89.7

Q ss_pred             EEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH---HHCC--CCCCCCCCCCCHHHHHHHH
Q ss_conf             23113-5444442478999999985226742677434512456889999975---3035--3212235866124542289
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD---RTSA--DFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~---~~~v--~~~~~~~~~dp~~v~~~a~  186 (321)
                      ||.|+ .=-|+||||++.-||..+..+|++|+++-+|-.|.     +..|.+   +-+.  |.. .....+..+...+.+
T Consensus         3 vi~~~~~KGG~GKtT~a~~la~~~~~~g~~V~liD~Dpq~s-----~~~W~~~a~~~~~~~~~~-~v~~~~~~~~l~~~~   76 (231)
T pfam07015         3 LITFCSFKGGAGKTTALMGLCSALASDGKRVALFEADENRP-----LTKWRENALRKGTWDPAC-EIFNADELPLLEQAY   76 (231)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC-----HHHHHHHHHHCCCCCCCC-CEECCCCHHHHHHHH
T ss_conf             79996179986599999999999996899599996899868-----899999876468888765-222056601589999


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-CCCHHH------HH----HHHHHHHH
Q ss_conf             99965148759986543332115778999989987630222343011231023-352257------78----99987643
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-TTGQNA------LR----QVEMFHAV  255 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-~~gq~~------~~----~a~~F~~~  255 (321)
                      +.+..++||+|+|||+|+...   ++.-      ++..     -|.++  +.. -+..|+      +.    +.+.+...
T Consensus        77 ~~~~~~~yD~VIIDtpg~~s~---~~~~------AI~~-----ADlVL--IP~qpSplD~~~a~~t~~~i~~~~~~~~~~  140 (231)
T pfam07015        77 EHAEGSGFDYALADTHGGSSE---LNNT------IIAS-----SDLLL--IPTMLTPLDIDEALATYRYVIELLLTENLA  140 (231)
T ss_pred             HHHHHCCCCEEEECCCCCCCH---HHHH------HHHH-----CCEEE--ECCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             988657999899839985758---9999------9997-----89899--778998233999999999999999973789


Q ss_pred             CCCCEEEEECCCCCCCHH--HHHHHHHHHCCCEEEEECCCCC
Q ss_conf             589769996545787069--9999999976988999758981
Q gi|254780709|r  256 AGTTGLIMTKMDGTARGG--GLIPIVVTHKIPVYFLGVGEGI  295 (321)
Q Consensus       256 ~~~~g~I~TKlD~ta~~G--~~ls~~~~~~~Pi~fig~Ge~i  295 (321)
                      +| ..+++|++-....-.  ..+.-..+ ++|+.=...+|+-
T Consensus       141 ip-~avl~tRv~~~~~~~~~~~i~e~le-~lpvl~t~i~eR~  180 (231)
T pfam07015       141 IP-TAILRQRVPVGRLTSSQRFCSDMLE-QLPVFDCPMHERD  180 (231)
T ss_pred             CC-EEEEEEECCCCCCCHHHHHHHHHHH-CCCCCCCCCCCHH
T ss_conf             98-0334551140002178999999996-4985435420289


No 32 
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the  protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.
Probab=98.69  E-value=1.2e-06  Score=66.94  Aligned_cols=162  Identities=17%  Similarity=0.205  Sum_probs=95.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH-----------H-HHHHHHH--HHH-----------CC
Q ss_conf             231135444442478999999985226742677434512456-----------8-8999997--530-----------35
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA-----------I-DQLKIWA--DRT-----------SA  167 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA-----------~-eQL~~~a--~~~-----------~v  167 (321)
                      .|.+.|==|||||||.+-||+-+.+.|+||+++-||..-...           + +-+..+.  +..           |+
T Consensus         2 ~iaiyGKGGVGKTTts~NLaaaLA~~G~rVl~iD~Dp~~~st~~L~g~~~~~~i~~~~~~~~~~~~~~~~~ii~~g~~gv   81 (212)
T cd02117           2 QIAIYGKGGIGKSTTSQNLSAALAEMGKKVLQVGCDPKADSTRLLLGGKAPTTILELAAEDGHVEDLELEDVIFEGFGGV   81 (212)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHCCCCCCCCHHHHHHHHCCCCCEEEEEEEEECCCCE
T ss_conf             59998898356877899999999986996999903899873303119977871999987527866445667899668870


Q ss_pred             CCCCCCCCCCCHHH------HHHHHHHH-----HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             32122358661245------42289999-----65148759986543332115778999989987630222343011231
Q gi|254780709|r  168 DFVCSEIGSDAAAL------AYEAFKQA-----QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       168 ~~~~~~~~~dp~~v------~~~a~~~a-----~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
                      .++.  .+..++.+      .-.+++..     ...+||+||||+-|-..-+.=.| -+   .       ...-+++++|
T Consensus        82 ~~ve--aggp~~g~~~ag~~i~~~~~ll~~~~~~~~~~D~IliD~lGdvv~~gf~~-pi---~-------~~~Ad~vlIv  148 (212)
T cd02117          82 KCVE--SGGPEPGVGCAGRGVITAVNLLEKEGFAEDDLDVVLYDVLGDVVCGGFAM-PI---R-------EGKADEIYIV  148 (212)
T ss_pred             EEEE--CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEECCCCC-CC---C-------CCCCCEEEEE
T ss_conf             8998--89977676545411788999999741002579999996588540356334-32---1-------1668889998


Q ss_pred             CCCC----CC-HHHHHHHHHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEE
Q ss_conf             0233----52-2577899987643--58976999654578706999999999769889
Q gi|254780709|r  237 LDAT----TG-QNALRQVEMFHAV--AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVY  287 (321)
Q Consensus       237 lda~----~g-q~~~~~a~~F~~~--~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~  287 (321)
                      ...-    ++ .+.++-++.|.+.  +.+.|+|.++.|....-..+=-++..++.|+.
T Consensus       149 tt~E~~Al~~a~~l~k~I~~~~~~~n~~l~GiI~N~~~~~~~~~~i~~f~~~~g~~vl  206 (212)
T cd02117         149 TSGEFMALYAANNICKGIRKYAKSGGVRLGGLICNSRNTDRETELIDAFAERLGTQVI  206 (212)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCEEE
T ss_conf             0693578898899999999997367981489998467888649999999998399189


No 33 
>PRK13849 putative crown gall tumor protein VirC1; Provisional
Probab=98.68  E-value=1.1e-07  Score=74.37  Aligned_cols=160  Identities=19%  Similarity=0.185  Sum_probs=89.0

Q ss_pred             EEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH---HHCC--CCCCCCCCCCCHHHHHHHH
Q ss_conf             23113-5444442478999999985226742677434512456889999975---3035--3212235866124542289
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD---RTSA--DFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~---~~~v--~~~~~~~~~dp~~v~~~a~  186 (321)
                      ||.|+ .=-|+||||.+.-||..+...|++|+++-+|-.+.     +..|.+   +-+.  +.... ...+..+...+++
T Consensus         3 vi~~~~~KGG~GKtT~a~~la~~~~~~g~~v~~iD~Dpq~s-----~~~W~e~a~~~~~~~~~~~v-~~~~~~~~l~~~~   76 (231)
T PRK13849          3 LLTFCSFKGGAGKTTALMGLCAALASDGKRVALFEADENRP-----LTRWKENALRSNTWDPACEV-YAADELPLLEAAY   76 (231)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC-----HHHHHHHHHHCCCCCCCCCE-EECCCHHHHHHHH
T ss_conf             79996189987699999999999997899599996899868-----89999876525898877523-4056525789999


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH----------HHHHHHHHHC
Q ss_conf             999651487599865433321157789999899876302223430112310233522577----------8999876435
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL----------RQVEMFHAVA  256 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~----------~~a~~F~~~~  256 (321)
                      +.+..++||+|||||+|+...   ++...-..           -|.++.=+ .-+..|+-          ++.+.++..+
T Consensus        77 e~~~~~~~D~VIIDtpg~~s~---~~~~Ai~~-----------ADLVLIP~-qPSp~D~~~a~~tv~~i~~~~~~~~~~i  141 (231)
T PRK13849         77 EDAELQGFDYALADTHGGSSE---LNNTIIAS-----------SNLLLIPT-MLTPLDIDEALSTYRYVIELLLSENLAI  141 (231)
T ss_pred             HHHHHCCCCEEEECCCCCCCH---HHHHHHHH-----------CCEEEECC-CCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             887536998899818997758---99999997-----------89899779-9986679999999999999999728788


Q ss_pred             CCCEEEEECCCCC--CCHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             8976999654578--70699999999976988999758981
Q gi|254780709|r  257 GTTGLIMTKMDGT--ARGGGLIPIVVTHKIPVYFLGVGEGI  295 (321)
Q Consensus       257 ~~~g~I~TKlD~t--a~~G~~ls~~~~~~~Pi~fig~Ge~i  295 (321)
                      +. .+++|+.-..  .+--..+.-.. .++|+.=....|+-
T Consensus       142 p~-~vlltRv~a~~~t~~~~~i~~~l-e~lPvl~T~i~eR~  180 (231)
T PRK13849        142 PT-AILRQRVPVGRLTTSQRAMSDML-ESLPVVDSPMHERD  180 (231)
T ss_pred             CE-EEEEEECCHHHHCHHHHHHHHHH-HCCCCCCCCCHHHH
T ss_conf             65-66654050454068899999999-62995555302279


No 34 
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=98.68  E-value=2.1e-06  Score=65.20  Aligned_cols=173  Identities=22%  Similarity=0.263  Sum_probs=109.6

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH---HHH----HHHHHHHHHHCCCCCCCCCCCC---
Q ss_conf             667412311354444424789999999852267426774345124---568----8999997530353212235866---
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS---AAI----DQLKIWADRTSADFVCSEIGSD---  177 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~---aA~----eQL~~~a~~~~v~~~~~~~~~d---  177 (321)
                      .++.++|-+.||.|+||.|.+..|+.+|..+|++|+++|.|.-.+   ||+    --+..++..-++-+-+......   
T Consensus        46 ~g~a~~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDPsS~~sgGaiLGDr~Rm~~~~~~~~~fiRs~~srg~lgg  125 (325)
T PRK09435         46 TGNALRIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDPSSTRTGGSILGDKTRMERLSRHPNAFIRPSPSSGTLGG  125 (325)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCC
T ss_conf             79825997427999868899999999999679858999978999988861010388887614799848840677888677


Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH-C
Q ss_conf             124542289999651487599865433321157789999899876302223430112310233522577899987643-5
Q gi|254780709|r  178 AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV-A  256 (321)
Q Consensus       178 p~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~-~  256 (321)
                      .+.-..+++.-+..-+||+|||-|.|=-|.....+       .+        .|-+++|+-.-.| |.+.   ..+.- .
T Consensus       126 ~~~~~~~~~~~~~a~g~d~i~iETvGvGQ~e~~v~-------~~--------~d~~~~~~~p~~G-D~~Q---~~K~GIm  186 (325)
T PRK09435        126 VARKTRETMLLCEAAGFDVILVETVGVGQSETAVA-------GM--------VDFFLLLQLPGAG-DELQ---GIKKGIM  186 (325)
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHH-------HH--------CCEEEEEECCCCC-CHHH---HHHHHHH
T ss_conf             33549999999997799989997067771488998-------74--------2668888358876-0889---9886577


Q ss_pred             C-CCEEEEECCCCCCCHHHHHHHHHH-------------HCCCEEEEEC--CCCCCCCC
Q ss_conf             8-976999654578706999999999-------------7698899975--89813255
Q gi|254780709|r  257 G-TTGLIMTKMDGTARGGGLIPIVVT-------------HKIPVYFLGV--GEGINDLE  299 (321)
Q Consensus       257 ~-~~g~I~TKlD~ta~~G~~ls~~~~-------------~~~Pi~fig~--Ge~i~Dl~  299 (321)
                      . -|-++++|.|++-+.++--.....             ..-||.-+..  |+.+++|-
T Consensus       187 EiaDi~vVNKaDgd~~~~A~~t~~e~~~aL~l~~~~~~~W~ppVl~~SA~~g~GI~eL~  245 (325)
T PRK09435        187 ELADLIVINKADGDNHTAARRAAAEYRSALRLLRPKDPGWQPPVLTCSALEGEGIDELW  245 (325)
T ss_pred             HHCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             50426899776755658999999999999860788789999998999815899879999


No 35 
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family.
Probab=98.67  E-value=9.8e-07  Score=67.57  Aligned_cols=157  Identities=19%  Similarity=0.223  Sum_probs=84.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH----------------------HHHH-------HC
Q ss_conf             135444442478999999985226742677434512456889999----------------------9753-------03
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKI----------------------WADR-------TS  166 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~----------------------~a~~-------~~  166 (321)
                      .-|==||||||+++=||+.+.++|+||+++-+|..-+.+. .+-.                      ....       -+
T Consensus         4 ~s~KGGVGKTT~a~nLA~~la~~G~rVlliD~D~q~~~~~-~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (212)
T pfam01656         4 AGTKGGVGKTTLAANLARALAKRGYRVLLIDLDPQANLTS-SLGKGPDLIDVLKEGLEIVDAQPLQHIAAAIVPSRNLDP   82 (212)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH-HHCCCCCCCCCCCCCCHHCCCCCHHHHHHEEECCCCCCC
T ss_conf             7689980699999999999997899789983899996258-865876434444441010112100245642224555587


Q ss_pred             CCCCCCCC---CCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC-
Q ss_conf             53212235---86612454228999965148759986543332115778999989987630222343011231023352-
Q gi|254780709|r  167 ADFVCSEI---GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG-  242 (321)
Q Consensus       167 v~~~~~~~---~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g-  242 (321)
                      +.+.....   ..+...............+||+|+|||++-...  ..+.-|       .     .++.++.|.....- 
T Consensus        83 l~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~D~viiD~pp~~~~--~~~~al-------~-----~ad~vivv~~p~~~s  148 (212)
T pfam01656        83 LLLIPSNLSLANFESELILEGGEEGLIKLAYDYVIIDGAPGLGE--LTANAL-------V-----AADILVVPIEPEGVA  148 (212)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH--HHHHHH-------H-----CCCEEEEEECCCHHH
T ss_conf             46533501566777777999999876660499899947997559--999999-------8-----399899994897699


Q ss_pred             -HHHHHHHHHHHHH-CCCCEEEEECCCCCCCHH---HHHHHHHHHCCCEE
Q ss_conf             -2577899987643-589769996545787069---99999999769889
Q gi|254780709|r  243 -QNALRQVEMFHAV-AGTTGLIMTKMDGTARGG---GLIPIVVTHKIPVY  287 (321)
Q Consensus       243 -q~~~~~a~~F~~~-~~~~g~I~TKlD~ta~~G---~~ls~~~~~~~Pi~  287 (321)
                       +++....+.+.+. +++-|+|++|.|....--   .+..+...++.|..
T Consensus       149 l~~~~~l~~~~~~l~~~~~gvV~N~~~~~~~~~~~~~~~~~~~~~~~~~~  198 (212)
T pfam01656       149 VLGAQRLLELVERLGLKILGVVLNKVDRGDERHLDKEIEALERKTGIPVL  198 (212)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             99999999999985996229999148899836630789999999789975


No 36 
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=98.63  E-value=1.1e-07  Score=74.15  Aligned_cols=172  Identities=26%  Similarity=0.430  Sum_probs=125.7

Q ss_pred             CCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCC-C--CCHHHH
Q ss_conf             36674-1231135444442478999999985226742677434512456889999975303532122358-6--612454
Q gi|254780709|r  107 FSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIG-S--DAAALA  182 (321)
Q Consensus       107 ~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~-~--dp~~v~  182 (321)
                      ..++| ..|-+.||.||||||-+-|+-..++.+ +++++|+.|.|.-.-.+.|+..   .++|++....| .  .+++..
T Consensus         8 ~~~~~~~~i~v~Gp~GSGKTaLie~~~~~L~~~-~~~aVI~~Di~t~~Da~~l~~~---~g~~i~~v~TG~~CH~da~m~   83 (202)
T COG0378           8 EKNRPMLRIGVGGPPGSGKTALIEKTLRALKDE-YKIAVITGDIYTKEDADRLRKL---PGEPIIGVETGKGCHLDASMN   83 (202)
T ss_pred             HHCCCEEEEEECCCCCCCHHHHHHHHHHHHHHH-CCEEEEECEEECHHHHHHHHHC---CCCEEEEECCCCCCCCCHHHH
T ss_conf             725864899961799867899999999999752-7768996404006559999737---798068740387658867889


Q ss_pred             HHHHHHHHHH--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH--HHHHHHHCCC
Q ss_conf             2289999651--48759986543332115778999989987630222343011231023352257789--9987643589
Q gi|254780709|r  183 YEAFKQAQAK--KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ--VEMFHAVAGT  258 (321)
Q Consensus       183 ~~a~~~a~~~--~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~--a~~F~~~~~~  258 (321)
                      ..|++.....  ..|+++|-++|-|-.-..  -+|.             -+..+.|+|.+.|.+.-.-  -..|.    -
T Consensus        84 ~~ai~~l~~~~~~~Dll~iEs~GNL~~~~s--p~L~-------------d~~~v~VidvteGe~~P~K~gP~i~~----a  144 (202)
T COG0378          84 LEAIEELVLDFPDLDLLFIESVGNLVCPFS--PDLG-------------DHLRVVVIDVTEGEDIPRKGGPGIFK----A  144 (202)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCEECCCC--CCHH-------------HCEEEEEEECCCCCCCCCCCCCCEEE----E
T ss_conf             999999863177677899923764324468--0413-------------04699999878888876557996467----4


Q ss_pred             CEEEEECCCCCCCHHHHHHHHH------HHCCCEEEEE--CCCCCCCCCCC
Q ss_conf             7699965457870699999999------9769889997--58981325557
Q gi|254780709|r  259 TGLIMTKMDGTARGGGLIPIVV------THKIPVYFLG--VGEGINDLEPF  301 (321)
Q Consensus       259 ~g~I~TKlD~ta~~G~~ls~~~------~~~~Pi~fig--~Ge~i~Dl~~f  301 (321)
                      +=+|+||.|=.+-.|+=+.++.      .-+.||.|..  +||..+++-.|
T Consensus       145 DllVInK~DLa~~v~~dlevm~~da~~~np~~~ii~~n~ktg~G~~~~~~~  195 (202)
T COG0378         145 DLLVINKTDLAPYVGADLEVMARDAKEVNPEAPIIFTNLKTGEGLDEWLRF  195 (202)
T ss_pred             EEEEEEHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             189985677387728669999999998499998899847878689999999


No 37 
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family.
Probab=98.61  E-value=9.7e-07  Score=67.61  Aligned_cols=164  Identities=18%  Similarity=0.188  Sum_probs=88.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH------------HHHHHHHH-------------HHHCC
Q ss_conf             231135444442478999999985226742677434512456------------88999997-------------53035
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA------------IDQLKIWA-------------DRTSA  167 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA------------~eQL~~~a-------------~~~~v  167 (321)
                      +|.+.|==|||||||.+-||.=+.+.|+||+++-+|.+=+..            .+-+..-+             ...++
T Consensus         2 ~iai~GKGGVGKTTtsvNLA~aLA~~GkrVlliDaD~~~~~~~~llg~~~~~~l~d~l~~~~~~~~~~~~~vi~~~~~gv   81 (269)
T pfam00142         2 KIAIYGKGGIGKSTTSQNTSAALAEMGKKVLIVGCDPKADSTRLILGGKAQPTIIDTLREKGLVEDVELEDVVKKGYGGI   81 (269)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCHHHHEECCCCCC
T ss_conf             58998999768899999999999987990999845899874144438988884787760467702240745013377872


Q ss_pred             CCCCCCCCCCC----H-HHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             32122358661----2-454228999965----14875998654333211577899998998763022234301123102
Q gi|254780709|r  168 DFVCSEIGSDA----A-ALAYEAFKQAQA----KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD  238 (321)
Q Consensus       168 ~~~~~~~~~dp----~-~v~~~a~~~a~~----~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVld  238 (321)
                      .++... +.++    . .-...+++..+.    ..||++|||+.|=.+.+.-.|.    +.       ....+++++|..
T Consensus        82 ~~i~~~-~~e~~~~~~~~~~~~~~~~l~~~~~~~~~DyiliD~~g~~~~~~~~~~----i~-------~~~A~~viiv~t  149 (269)
T pfam00142        82 RCVESG-GPEPGVGCAGRGVITAIDLLEELGAYDDLDFVLYDVLGDVVCGGFAMP----IR-------EGKAQEVYIVTS  149 (269)
T ss_pred             EEEECC-CCCCCCCCCHHHHHHHHHHHHHHCCHHCCCEEEEECCCCEEECCCCCC----HH-------HCCCCEEEEEEC
T ss_conf             688689-986563211078999999999821021288898533674024340053----34-------435887999828


Q ss_pred             CCC--CHHHHH---HHHHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEE
Q ss_conf             335--225778---99987643--58976999654578706999999999769889997
Q gi|254780709|r  239 ATT--GQNALR---QVEMFHAV--AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       239 a~~--gq~~~~---~a~~F~~~--~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig  290 (321)
                      .--  =+++..   ....+.+.  +.+.|++.+.-..+..-+.+=.+...++.|  |+|
T Consensus       150 ~E~~al~~a~~l~~~i~~~~~~~~~~i~giv~n~~~~~~~~~~~~~~~~~~~~~--~lg  206 (269)
T pfam00142       150 GEMMALYAANNICKGILKYAKSGGVRLGGLICNSRKVDDERELIDAFAEALGTQ--MIH  206 (269)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC--EEE
T ss_conf             947899999999999999850579627899826865411579999999981994--799


No 38 
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=98.58  E-value=7.4e-06  Score=61.41  Aligned_cols=172  Identities=24%  Similarity=0.262  Sum_probs=106.3

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC---HHHH----HHHHHHHHHHCCCCCCCCCCCC---
Q ss_conf             66741231135444442478999999985226742677434512---4568----8999997530353212235866---
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR---SAAI----DQLKIWADRTSADFVCSEIGSD---  177 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR---~aA~----eQL~~~a~~~~v~~~~~~~~~d---  177 (321)
                      .++-.+|-+.||.|+||.|-+.+|+.++..+|++|+++|.|.-.   =||+    --+..++..-++-+-+.+....   
T Consensus        26 ~g~a~~iGiTG~PGaGKStli~~l~~~~~~~g~~vaVlAvDPSS~~sgGaiLGDr~RM~~~~~~~~vfiRs~~srg~lGG  105 (267)
T pfam03308        26 TGRAHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRTRMQRLAVDPGAFIRSSPSRGALGG  105 (267)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCC
T ss_conf             59955998768998879999999999999689868999978999888863001077776505899858864577888887


Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH-C
Q ss_conf             124542289999651487599865433321157789999899876302223430112310233522577899987643-5
Q gi|254780709|r  178 AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV-A  256 (321)
Q Consensus       178 p~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~-~  256 (321)
                      .+.-.++++.-+..-+||+|||-|.|=-|....-       .++        .|-++||+-.-.| |.+   +..+.- .
T Consensus       106 ls~~t~~~i~lleaaGfD~IivETVGVGQsE~~v-------~~~--------aD~~llv~~Pg~G-Dei---Q~iKaGIm  166 (267)
T pfam03308       106 LSRATREAILLLDAAGFDVIIIETVGVGQSEVDI-------ANM--------ADTFVLVTIPGGG-DDL---QGIKAGLM  166 (267)
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHH-------HHH--------CCEEEEEECCCCC-HHH---HHHHHHHH
T ss_conf             1476999999999779999999247777530355-------541--------5768999558876-088---89875376


Q ss_pred             C-CCEEEEECCCCCCCHHHHHHH---HHH----------HCCCEEEEEC--CCCCCCCCCC
Q ss_conf             8-976999654578706999999---999----------7698899975--8981325557
Q gi|254780709|r  257 G-TTGLIMTKMDGTARGGGLIPI---VVT----------HKIPVYFLGV--GEGINDLEPF  301 (321)
Q Consensus       257 ~-~~g~I~TKlD~ta~~G~~ls~---~~~----------~~~Pi~fig~--Ge~i~Dl~~f  301 (321)
                      . -|-++++|.|.   .|+-...   ...          ..-||.-+..  |+.+++|-..
T Consensus       167 EiaDi~vVNKaD~---~~A~~~~~~l~~~l~l~~~~~~~W~p~Vl~tSA~~g~Gi~el~~~  224 (267)
T pfam03308       167 EIADIYVVNKADL---PGAERTARELRSALHLLTPKEAGWRPPVLTTSAVTGEGIDELWDA  224 (267)
T ss_pred             HHCCEEEEECCCH---HHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             5354899966764---769999999999985179877899999899874788999999999


No 39 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=98.58  E-value=5.5e-07  Score=69.36  Aligned_cols=97  Identities=27%  Similarity=0.291  Sum_probs=70.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      +..++++|++|+||||.+.+||+.+...+..|..+++++++.....+..      .....................+.++
T Consensus         2 ~~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~   75 (148)
T smart00382        2 GEVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLL------LIIVGGKKASGSGELRLRLALALAR   75 (148)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             9789999999702999999999872668996899875998988898765------3000112210519999999999998


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHH
Q ss_conf             51487599865433321157789
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMA  213 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~  213 (321)
                      ...+++|+||-++++........
T Consensus        76 ~~~~~viiiDei~~~~~~~~~~~   98 (148)
T smart00382       76 KLKPDVLILDEITSLLDAEQEAL   98 (148)
T ss_pred             HCCCCEEEEECCHHHCCCCCHHH
T ss_conf             44998999827502147620799


No 40 
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ. Members of this family are the YhjQ protein, found immediately upsteam of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae. In several species it is seen clearly as part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm (PMID:16930487), based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=98.53  E-value=3.6e-06  Score=63.65  Aligned_cols=159  Identities=19%  Similarity=0.177  Sum_probs=81.7

Q ss_pred             EEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH---------H----------HHHH--HHHHHCCCCC
Q ss_conf             23113-54444424789999999852267426774345124568---------8----------9999--9753035321
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI---------D----------QLKI--WADRTSADFV  170 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~---------e----------QL~~--~a~~~~v~~~  170 (321)
                      +|.++ +==|||||||+.-||+.+.+.|+||++|-+|.......         +          .++.  +-...|+.++
T Consensus         3 iIav~n~KGGVGKTT~avNLA~~La~~G~rVLlIDlDpQ~~l~~~~g~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~i   82 (246)
T TIGR03371         3 VIAIVGIKGGVGRTTLTAALASALKLLGEPVLAIDLDPQNLLRLHFGMDWSVRDGWARALLAGEDWRAAAYRSSDGVLFL   82 (246)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHCCCCCCCCCCHHHHHHCCCCHHHHHEECCCCEEEE
T ss_conf             99997599985499999999999996899789997599985032248887534569999827998889525578982897


Q ss_pred             CCCC----------CCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             2235----------866124542289999651487599865433321157789999899876302223430112310233
Q gi|254780709|r  171 CSEI----------GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT  240 (321)
Q Consensus       171 ~~~~----------~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~  240 (321)
                      ....          ..++. ...+.+.......||+|||||+.-+..  -.+.       ++.     +.+.++.++.+.
T Consensus        83 p~~~~~~~~~~~~~~~~~~-~l~~~l~~l~~~~~D~viiD~pp~l~~--~~~~-------al~-----aad~vlipv~~~  147 (246)
T TIGR03371        83 PYGTLSADEREAYQAHDAG-WLARLLQQLDLAARDWVLIDLPRGPSP--ITDQ-------ALA-----AADLVLVVVNAD  147 (246)
T ss_pred             ECCCCCHHHHHHHCCCCHH-HHHHHHHHHCCCCCCEEEEECCCCCCH--HHHH-------HHH-----HCCEEEEEECCC
T ss_conf             0898477789876044789-999999863036798899948998749--9999-------999-----889479981899


Q ss_pred             C-CHHHHHH-H---HHHHHHCCCCEEEEECCCCCCCHHH-HHHHH-HHHCCCE
Q ss_conf             5-2257789-9---9876435897699965457870699-99999-9976988
Q gi|254780709|r  241 T-GQNALRQ-V---EMFHAVAGTTGLIMTKMDGTARGGG-LIPIV-VTHKIPV  286 (321)
Q Consensus       241 ~-gq~~~~~-a---~~F~~~~~~~g~I~TKlD~ta~~G~-~ls~~-~~~~~Pi  286 (321)
                      . ......+ .   ..+......-+++++++|...+... ++... ..++.|+
T Consensus       148 ~~s~~~~~~~~~~~~~~~~~~~~~~iv~n~~~~~~~~~~~~~~~l~~~~~~~~  200 (246)
T TIGR03371       148 AACYATLHQLALALLARSVPPDGIHYLINQFQPARQLSRDVRAVLRATLGSRL  200 (246)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             89999999999999984277675178863026401589999999999749881


No 41 
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase. Members of this protein family are related to a known protein-tyrosine autokinase and to numerous homologs from exopolysaccharide biosynthesis region proteins, many of which are designated as chain length determinants. Most members of this family contain a short region, immediately C-terminal to the region modeled here, with an abundance of Tyr residues. These C-terminal tyrosine residues are likely to be autophosphorylation sites. Some members of this family are fusion proteins.
Probab=98.52  E-value=7.4e-06  Score=61.42  Aligned_cols=141  Identities=18%  Similarity=0.254  Sum_probs=81.7

Q ss_pred             CCCCCEEECCCC-CCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHH------------HH----HHHHH-----
Q ss_conf             667412311354-444424789999999852-26742677434512456889------------99----99753-----
Q gi|254780709|r  108 SHRPHVILVVGV-NGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQ------------LK----IWADR-----  164 (321)
Q Consensus       108 ~~~p~vil~vG~-nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQ------------L~----~~a~~-----  164 (321)
                      ..++++|++..+ .|.||||+++-||.-+.. -|++|+||-||..|+.-...            |.    .|.+.     
T Consensus        32 ~~~~kvi~VTS~~pgeGKTtva~nLA~~lA~~~~~~VLLVDaDlr~p~l~~~l~~~~~~Gl~d~L~~~~~~l~~~i~~~~  111 (207)
T TIGR03018        32 KKNNNLIMVTSSLPGEGKSFTAINLAISLAQEYDKTVLLIDADLRRPSLHRTLGLEAEPGLSDCLLDPVLDLADVLVPTN  111 (207)
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHCCCCCCCCHHHHHCCCCCCHHHHEECCC
T ss_conf             67880999978999998899999999999972498599995357899710013889999856774389987567234268


Q ss_pred             -HCCCCCCC-CCCCCCHHHH----HHHHHHHHHHCCC--EEEEECCCCCCCHH-HHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             -03532122-3586612454----2289999651487--59986543332115-77899998998763022234301123
Q gi|254780709|r  165 -TSADFVCS-EIGSDAAALA----YEAFKQAQAKKVD--VLIIDTAGRLHNNS-ILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       165 -~~v~~~~~-~~~~dp~~v~----~~a~~~a~~~~~D--vvliDTAGR~~~~~-~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
                       -++.++.. ....+|..+.    ++.+-..-.+.||  +|||||+==+.... ..+...              -|-++|
T Consensus       112 ~~~l~vlpag~~~~~~~~ll~s~~~~~li~~lr~~yd~~~VIiDtPPvl~~~Da~~la~~--------------~D~vll  177 (207)
T TIGR03018       112 IGRLSLLPAGRRHPNPTELLASQRMRSLLHELARRYPDRIIIIDTPPLLVFSEARALARL--------------VGQIVL  177 (207)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHH--------------CCEEEE
T ss_conf             875557516898996676542699999999999737965799838962232369999996--------------896999


Q ss_pred             ECCC-CCCHHHHHH-HHHHHHHCCCCEEEE
Q ss_conf             1023-352257789-998764358976999
Q gi|254780709|r  236 VLDA-TTGQNALRQ-VEMFHAVAGTTGLIM  263 (321)
Q Consensus       236 Vlda-~~gq~~~~~-a~~F~~~~~~~g~I~  263 (321)
                      |+.. .|..+.+.+ .+.+. ..++.|+|+
T Consensus       178 Vvr~~~t~~~~v~~a~~~L~-~~~vlG~Vl  206 (207)
T TIGR03018       178 VVEEGRTTQEAVKEALSALE-SCKVLGVVL  206 (207)
T ss_pred             EEECCCCCHHHHHHHHHHHC-CCCEEEEEE
T ss_conf             99799878999999999866-898069996


No 42 
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG. The proteins in this family are homologs of the EpsG protein found in Methylobacillus strain 12S and are generally found in operons with other Eps homologs. The protein is believed to function as the protein tyrosine kinase component of the chain length regulator (along with the transmembrane component EpsF).
Probab=98.52  E-value=3.4e-06  Score=63.77  Aligned_cols=143  Identities=17%  Similarity=0.216  Sum_probs=85.0

Q ss_pred             CCCEEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH---------------HHH------HHCC
Q ss_conf             74123113-5444442478999999985226742677434512456889999---------------975------3035
Q gi|254780709|r  110 RPHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKI---------------WAD------RTSA  167 (321)
Q Consensus       110 ~p~vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~---------------~a~------~~~v  167 (321)
                      ..+.++++ .-.|-||||++|-||.-|...|+||+||-||.-||.-..=+..               +.+      .-+.
T Consensus       102 ~~~~LaItS~~pGEGKS~vAaNLA~~~Aq~G~RvLLVDaDLRrP~lh~~f~l~~~~GLs~vL~g~~~l~~i~~~~~~~nL  181 (274)
T TIGR03029       102 GRKALAVVSAKSGEGCSYIAANLAIVFSQLGEKTLLIDANLRDPVQHRNFKLSEQRGLSDILAGRSDLEVITHIPALENL  181 (274)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHCCCCCCCHHHHHCCCCCHHHEEECCCCCCE
T ss_conf             88389996899999899999999999996799199995888884477975999976878884599988990515898997


Q ss_pred             CCCC-CCCCCCCHHHHH----HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-CC
Q ss_conf             3212-235866124542----28999965148759986543332115778999989987630222343011231023-35
Q gi|254780709|r  168 DFVC-SEIGSDAAALAY----EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-TT  241 (321)
Q Consensus       168 ~~~~-~~~~~dp~~v~~----~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-~~  241 (321)
                      .+.. +....+|+.+.-    ..+-..-.+.||+|||||+==+.....++     +.+        .-+-++||.-. .|
T Consensus       182 ~VLpaG~~ppnP~eLL~s~~~~~ll~~l~~~yD~IIiDTPPvl~~sDA~i-----la~--------~aDg~LlVvR~~~T  248 (274)
T TIGR03029       182 SVLPAGAIPPNPQELLARPAFTDLLNKVMGDYDVVIVDTPSAEHSSDAQI-----VAT--------RARGTLIVSRVNET  248 (274)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCHHHH-----HHH--------HCCEEEEEEECCCC
T ss_conf             89969999989799873589999999998409999993898655434999-----998--------68979999968988


Q ss_pred             CHHHH-HHHHHHHHH-CCCCEEEEEC
Q ss_conf             22577-899987643-5897699965
Q gi|254780709|r  242 GQNAL-RQVEMFHAV-AGTTGLIMTK  265 (321)
Q Consensus       242 gq~~~-~~a~~F~~~-~~~~g~I~TK  265 (321)
                      -...+ +-.+.+.+. +++-|+|+.|
T Consensus       249 ~~~~l~~a~~~L~~~g~~VlGvVLNq  274 (274)
T TIGR03029       249 RLHELTSLKEHLSGVGVRVVGAVLNQ  274 (274)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             89999999999997799668998487


No 43 
>pfam09140 MipZ ATPase MipZ. MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Probab=98.51  E-value=6.3e-07  Score=68.94  Aligned_cols=85  Identities=24%  Similarity=0.258  Sum_probs=55.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCHHH--HHHHHHHHHHHCCCCCCCCC----CCCC-----HH----HHHH
Q ss_conf             44424789999999852267426774345-12456--88999997530353212235----8661-----24----5422
Q gi|254780709|r  121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDT-FRSAA--IDQLKIWADRTSADFVCSEI----GSDA-----AA----LAYE  184 (321)
Q Consensus       121 G~GKTTT~aKLA~~~~~~g~kV~lva~Dt-fR~aA--~eQL~~~a~~~~v~~~~~~~----~~dp-----~~----v~~~  184 (321)
                      |||||||+.-||..+...|++|++|-+|. .+...  .+.=..|+++.++++-....    ..++     ..    -..+
T Consensus        11 GvGKTTtavnLA~aLA~~G~rVllIDlDpqq~slt~~l~nr~~~~~~~~~~l~~P~~~~l~~~~~~~~~~~~~~~~~L~~   90 (261)
T pfam09140        11 GSGKSTTAVHVAVALLYLGARVATIDLDLRQRTLTRYIENRAATAERTGLDLPVPKHLCLPDDVSEVFDGESADDARLEE   90 (261)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             87299999999999998899789997999998512344303556551386534665344550677761345578999999


Q ss_pred             HHHHHHHHCCCEEEEECCCCCC
Q ss_conf             8999965148759986543332
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGRLH  206 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR~~  206 (321)
                      ++.. -..+||+|+|||.|.+.
T Consensus        91 al~~-l~~~yDfIlIDcPPsl~  111 (261)
T pfam09140        91 AVAD-LEQDADFIVIDTPGSDS  111 (261)
T ss_pred             HHHH-HHCCCCEEEEECCCCCC
T ss_conf             9999-87579999996998573


No 44 
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=98.51  E-value=5.3e-06  Score=62.44  Aligned_cols=165  Identities=18%  Similarity=0.232  Sum_probs=84.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH------------HHHHHHHHH------------HHCC
Q ss_conf             1231135444442478999999985226742677434512456------------889999975------------3035
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA------------IDQLKIWAD------------RTSA  167 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA------------~eQL~~~a~------------~~~v  167 (321)
                      ++|.+.|==|||||||++-||+-|.+.|+||+++-+|..=+..            .+-|..-+.            -.|+
T Consensus         2 r~Iai~GKGGVGKTTtavNLA~aLa~~GkkVlliDaDpq~~~t~~l~g~~~~~~~~~~l~~~~~~~~~~~~~i~~~~~gv   81 (270)
T cd02040           2 RQIAIYGKGGIGKSTTTQNLSAALAEMGKKVMIVGCDPKADSTRLLLGGKAIPTVLDTLREKGEVELELEDVIFEGFGGI   81 (270)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHCCCCCCCCHHHHHHHCCCCCCCHHHHEECCCCCC
T ss_conf             58999799857789999999999998799499986579985134652998888289988752777653889613376770


Q ss_pred             CCCCCCCCCCCH-H-----H--HHHHHHH--HHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             321223586612-4-----5--4228999--9651487599865433321157789999899876302223430112310
Q gi|254780709|r  168 DFVCSEIGSDAA-A-----L--AYEAFKQ--AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVL  237 (321)
Q Consensus       168 ~~~~~~~~~dp~-~-----v--~~~a~~~--a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVl  237 (321)
                      .++.... ..|. .     +  ..+-++.  +-..+||+|||||.|-.....-.| .+   .       ....++++.|.
T Consensus        82 ~~ip~~~-~~~~~~~~gr~~~~~~~ll~~l~~~~~~~D~iliD~lg~~~~~~~~~-~i---~-------~~~ad~viiv~  149 (270)
T cd02040          82 KCVESGG-PEPGVGCAGRGVITAINLLEELGAYEDDLDFVIYDVLGDVVCGGFAM-PI---R-------EGKAQEIYIVT  149 (270)
T ss_pred             EEEECCC-CCCCCHHCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHC-HH---H-------HCCCCEEEEEC
T ss_conf             6410599-64351212400788999999854344069889982356333212323-03---5-------53388799962


Q ss_pred             CC----CCCH-HHHHHHHHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEE
Q ss_conf             23----3522-577899987643--58976999654578706999999999769889997
Q gi|254780709|r  238 DA----TTGQ-NALRQVEMFHAV--AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       238 da----~~gq-~~~~~a~~F~~~--~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig  290 (321)
                      ..    ++|. +.++..+.|.+.  ..+.|++.+..+.......+-.+...++.|  |+|
T Consensus       150 t~e~~al~~~~~l~k~i~~~~~~~~~~l~gvv~~~~~~~~~~~~~~~~~~~~~~~--~l~  207 (270)
T cd02040         150 SGEMMALYAANNICKGILKYAKSGGVRLGGLICNSRNTDREDELIDAFAKRLGTQ--MIH  207 (270)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC--EEE
T ss_conf             8818999999999999999983469747999837866513789999999985995--287


No 45 
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=98.49  E-value=8.8e-06  Score=60.88  Aligned_cols=147  Identities=24%  Similarity=0.322  Sum_probs=93.0

Q ss_pred             CCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH---HHH--HH--HHHHHHHHCCCCCCCCCCCC-
Q ss_conf             13667412311354444424789999999852267426774345124---568--89--99997530353212235866-
Q gi|254780709|r  106 DFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS---AAI--DQ--LKIWADRTSADFVCSEIGSD-  177 (321)
Q Consensus       106 ~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~---aA~--eQ--L~~~a~~~~v~~~~~~~~~d-  177 (321)
                      +..+++.+|=+.|+.|+||.|.+.+|...|...|++|+++|.|.-.+   ||+  +-  .+.++..-|+-+-+.+...- 
T Consensus        46 p~tG~a~viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp~TGGsiLGDRiRM~~~~~~~~vFiRs~~srG~l  125 (323)
T COG1703          46 PRTGNAHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIRMQRLAVDPGVFIRSSPSRGTL  125 (323)
T ss_pred             HCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCC
T ss_conf             11799837873179988668899999999997796789999889999878530120766776446998178426877651


Q ss_pred             --CHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             --124542289999651487599865433321157789999899876302223430112310233522577899987643
Q gi|254780709|r  178 --AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV  255 (321)
Q Consensus       178 --p~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~  255 (321)
                        .+.-..+++..+..-+||+|||-|.|=-|.+..       |.+.        .|-+++|+-.-.|    +..+.++.-
T Consensus       126 GGlS~at~~~i~~ldAaG~DvIIVETVGvGQsev~-------I~~~--------aDt~~~v~~pg~G----D~~Q~iK~G  186 (323)
T COG1703         126 GGLSRATREAIKLLDAAGYDVIIVETVGVGQSEVD-------IANM--------ADTFLVVMIPGAG----DDLQGIKAG  186 (323)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH-------HHHH--------CCEEEEEECCCCC----CHHHHHHHH
T ss_conf             01668899999999861898899981478841557-------7652--------1668999657888----278888741


Q ss_pred             -CC-CCEEEEECCCCCCCHHH
Q ss_conf             -58-97699965457870699
Q gi|254780709|r  256 -AG-TTGLIMTKMDGTARGGG  274 (321)
Q Consensus       256 -~~-~~g~I~TKlD~ta~~G~  274 (321)
                       .. -|=+++.|.|   +.|+
T Consensus       187 imEiaDi~vINKaD---~~~A  204 (323)
T COG1703         187 IMEIADIIVINKAD---RKGA  204 (323)
T ss_pred             HHHHHHEEEEECCC---HHHH
T ss_conf             46540335672567---2658


No 46 
>cd02032 Bchl_like This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.
Probab=98.48  E-value=1.5e-05  Score=59.23  Aligned_cols=156  Identities=25%  Similarity=0.282  Sum_probs=90.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----------HHHHHHHHHHH---HH-----------HCC
Q ss_conf             231135444442478999999985226742677434512-----------45688999997---53-----------035
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR-----------SAAIDQLKIWA---DR-----------TSA  167 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR-----------~aA~eQL~~~a---~~-----------~~v  167 (321)
                      +|.+.|=-|+|||||.+-|++-|.+.|+||++|-||.-.           +--+|.|+...   +.           -|+
T Consensus         2 kiaiyGKGGIGKSTttaNl~aaLA~~G~kVl~IgcDpk~Dst~~L~g~~~~tvld~l~~~~~~~~~~~~~d~v~~g~~gv   81 (267)
T cd02032           2 VLAVYGKGGIGKSTTSSNLSVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTVIDILEEVDFHYEELWPEDVIYEGYGGV   81 (267)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCCCHHHHHHHHCCCHHHCCHHHHHHCCCCCC
T ss_conf             79997799657877899999999987995999778995155675269886839999986088666414778753076784


Q ss_pred             CCCCCCCCCCCH---------HHHHHHHHHHH-HHCCCEEEEECCCCCC--CHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             321223586612---------45422899996-5148759986543332--11577899998998763022234301123
Q gi|254780709|r  168 DFVCSEIGSDAA---------ALAYEAFKQAQ-AKKVDVLIIDTAGRLH--NNSILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       168 ~~~~~~~~~dp~---------~v~~~a~~~a~-~~~~DvvliDTAGR~~--~~~~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
                      .++  +.|.-++         ..+++-++... .+.||+|++|+.|---  --.+-+               ..-++++.
T Consensus        82 ~cv--EaGgP~pg~Gcagrgi~~~~~lL~~l~~~~~~D~Vl~DvlgdVvcgGFa~pi---------------~~Ad~~~i  144 (267)
T cd02032          82 DCV--EAGGPPAGAGCGGYVVGETVKLLKELNLFEEYDVILFDVLGDVVCGGFAAPL---------------NYADYALI  144 (267)
T ss_pred             EEE--ECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCC---------------CCCCEEEE
T ss_conf             576--6589999988776404899999987166434778999536654456656761---------------00688999


Q ss_pred             ECCCC--CCHHHHHHH---HHHHH--HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             10233--522577899---98764--3589769996545787069999999997698899
Q gi|254780709|r  236 VLDAT--TGQNALRQV---EMFHA--VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYF  288 (321)
Q Consensus       236 Vlda~--~gq~~~~~a---~~F~~--~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~f  288 (321)
                      |-+.-  .=.+|-+++   +.|..  .+.+.|+|..+.|+.   ..+=-++..++.|+.-
T Consensus       145 VTs~e~~sl~aAn~I~~~i~~~~~~~~~rl~GlI~Nr~~~~---~~i~~fa~~lg~~lig  201 (267)
T cd02032         145 VTDNDFDSIFAANRIAAAVREKAKTYKVRLAGLIANRTDKT---DLIDKFVEAVGMPVLA  201 (267)
T ss_pred             EECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCH---HHHHHHHHHHCCCEEE
T ss_conf             95671878999999999999975337976422787469857---8999999972994699


No 47 
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.
Probab=98.44  E-value=3e-06  Score=64.13  Aligned_cols=140  Identities=22%  Similarity=0.300  Sum_probs=80.7

Q ss_pred             EEC-CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             311-3544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  114 ILV-VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~-vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      |.+ .|==||||||+++-||..+.+.|++|+++-+|..       +....-.++.+       .++..-..+-+      
T Consensus         2 Iav~s~KGGVGKTT~a~NLA~aLa~~g~~vllvD~D~~-------~~~l~~~~~~~-------~~~~~~~~~vl------   61 (179)
T cd02036           2 IVVTSGKGGVGKTTTTANLGTALAQLGYKVVLIDADLG-------LRNLDLILGLE-------NRVVYTLHDVL------   61 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC-------CCCCHHHCCCC-------CCCCCHHHCCC------
T ss_conf             89973999870999999999999977991899958999-------99836661765-------56653131126------


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC--CHHHHHHHHHHHHH-CCCCEEEEECCCCC
Q ss_conf             4875998654333211577899998998763022234301123102335--22577899987643-58976999654578
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT--GQNALRQVEMFHAV-AGTTGLIMTKMDGT  269 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~--gq~~~~~a~~F~~~-~~~~g~I~TKlD~t  269 (321)
                      .-|+|+|||...+....  ..-|       .     +.+++++|.....  =.++....+.+++. .+.-|+|++|.+..
T Consensus        62 ~gD~viiD~ppg~~~~~--~~~l-------~-----~ad~vlvv~~p~~~sl~~~~~~~~~~~~~~~~~~~vv~Nr~~~~  127 (179)
T cd02036          62 AGDYILIDSPAGIERGF--ITAI-------A-----PADEALLVTTPEISSLRDADRVKGLLEALGIKVVGVIVNRVRPD  127 (179)
T ss_pred             CCCEEEEECCCCCCHHH--HHHH-------H-----HCCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             69999997999988899--9999-------8-----46812563788588999999999999825996469998454676


Q ss_pred             CC-HH-HHHHHHHHHCCCEE
Q ss_conf             70-69-99999999769889
Q gi|254780709|r  270 AR-GG-GLIPIVVTHKIPVY  287 (321)
Q Consensus       270 a~-~G-~~ls~~~~~~~Pi~  287 (321)
                      .. .+ ..-.+...++.|+.
T Consensus       128 ~~~~~~~~~~~~~~l~~~vl  147 (179)
T cd02036         128 MVEGGDMVEDIEEILGVPLL  147 (179)
T ss_pred             CCCHHHHHHHHHHHCCCCEE
T ss_conf             66367799999985599679


No 48 
>PRK10818 cell division inhibitor MinD; Provisional
Probab=98.39  E-value=5.5e-06  Score=62.32  Aligned_cols=151  Identities=16%  Similarity=0.240  Sum_probs=75.9

Q ss_pred             EEEC-CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH-----------HHHHHHHH------HH-------HCC
Q ss_conf             2311-35444442478999999985226742677434512456-----------88999997------53-------035
Q gi|254780709|r  113 VILV-VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA-----------IDQLKIWA------DR-------TSA  167 (321)
Q Consensus       113 vil~-vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA-----------~eQL~~~a------~~-------~~v  167 (321)
                      ||.+ .|==|||||||+.-||..+.++|+||+++-+|..-+..           .+-.....      +.       -++
T Consensus         4 vIaV~s~KGGVGKTT~avNLA~aLA~~G~kVlliD~D~~~~n~~~~lg~~~~~~~~~~~vl~g~~~l~~~~i~~~~~~~l   83 (270)
T PRK10818          4 IIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENL   83 (270)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCHHHHEEECCCCCCE
T ss_conf             99997899984189999999999997799689996899998887345767766666898836998588905446876997


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHH----HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC--
Q ss_conf             3212235866124542289999----6514875998654333211577899998998763022234301123102335--
Q gi|254780709|r  168 DFVCSEIGSDAAALAYEAFKQA----QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT--  241 (321)
Q Consensus       168 ~~~~~~~~~dp~~v~~~a~~~a----~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~--  241 (321)
                      .+.......+...+..+++...    +..+||+|||||+-=+.  ..-+.-|.            +.+++++|...-.  
T Consensus        84 ~ilpa~~~~~~~~~~~~~~~~~l~~l~~~~yDyIiID~ppgl~--~~~~~al~------------aad~vlvv~tpe~~a  149 (270)
T PRK10818         84 YILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIE--TGALMALY------------FADEAIITTNPEVSS  149 (270)
T ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC--HHHHHHHH------------HCCEEEEECCCCHHH
T ss_conf             9979996476755459999999997776599899988999866--89999998------------589689973897889


Q ss_pred             CHHHHHHHHHHHHH---C-----CC-CEEEEECCCC-CCCHHHHHH
Q ss_conf             22577899987643---5-----89-7699965457-870699999
Q gi|254780709|r  242 GQNALRQVEMFHAV---A-----GT-TGLIMTKMDG-TARGGGLIP  277 (321)
Q Consensus       242 gq~~~~~a~~F~~~---~-----~~-~g~I~TKlD~-ta~~G~~ls  277 (321)
                      =.++....+.|+..   .     ++ .++++|+.|. ....+..++
T Consensus       150 l~da~~ll~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  195 (270)
T PRK10818        150 VRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLS  195 (270)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCHHCCEEEEEECHHHCCHHHHCC
T ss_conf             9879999999998777653352010012588424531232110012


No 49 
>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702    This family describes the capsular exopolysaccharide proteins in bacteria. The exopolysaccharide gene cluster consists of several genes which encode a number of proteins which regulate the exoploysaccharide biosynthesis (EPS). At least 13 genes EpsA to EpsM in streptococcus species seem to direct the EPS proteins and share high homology. ; GO: 0030234 enzyme regulator activity, 0045227 capsule polysaccharide biosynthetic process.
Probab=98.38  E-value=5.9e-06  Score=62.12  Aligned_cols=145  Identities=21%  Similarity=0.303  Sum_probs=92.3

Q ss_pred             CCEEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH----------------------HHHHHHHHHH-HC
Q ss_conf             4123113-5444442478999999985226742677434512456----------------------8899999753-03
Q gi|254780709|r  111 PHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA----------------------IDQLKIWADR-TS  166 (321)
Q Consensus       111 p~vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA----------------------~eQL~~~a~~-~~  166 (321)
                      ..++++. -=.|.|||||.+=+|.=|.+.|+|++||-+|+-.+--                      .+|-=.--+. -+
T Consensus        19 ~K~l~itS~~~~eGKsT~S~NiA~~fAqaGyKTLlIDgD~R~sv~~~~Fk~~n~~~GLtn~L~g~~dl~~~i~~T~isen   98 (207)
T TIGR01007        19 IKVLLITSVKAGEGKSTTSANIAVSFAQAGYKTLLIDGDMRNSVMSGTFKSQNKIKGLTNFLSGNTDLSDAICETNISEN   98 (207)
T ss_pred             EEEEEEEECCCCCCCEEEEHHHHHHHHHCCCEEEEEECCCCCCCEEEEECCCCCCCCCHHHHCCCCCHHHHHHCCCCCCC
T ss_conf             05899841105888624107889999856855888754658660367865888765633322145453334202654678


Q ss_pred             CCCCCC-CCCCCCHHHH----HHHHHHHHHHCCCEEEEECCCC-CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-
Q ss_conf             532122-3586612454----2289999651487599865433-32115778999989987630222343011231023-
Q gi|254780709|r  167 ADFVCS-EIGSDAAALA----YEAFKQAQAKKVDVLIIDTAGR-LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-  239 (321)
Q Consensus       167 v~~~~~-~~~~dp~~v~----~~a~~~a~~~~~DvvliDTAGR-~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-  239 (321)
                      ..|+.+ +-.=.|.++.    |..|-..-.+.||+|||||+== .=+|...+      .+        ..+.++||++| 
T Consensus        99 L~vi~sG~vPPNPt~LL~s~~F~~l~e~~~~~fD~iiiDTPPig~V~DAai~------a~--------~~d~~~LV~~A~  164 (207)
T TIGR01007        99 LDVITSGPVPPNPTELLQSSNFKTLIETLRKYFDYIIIDTPPIGTVIDAAII------AR--------AVDASILVTDAG  164 (207)
T ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH------HH--------HHCCEEEEEECC
T ss_conf             7275178878775478888999999999871688899951886667889999------98--------729779887225


Q ss_pred             CCCHHHHHHHHHHHHHC--CCCEEEEECCCCC
Q ss_conf             35225778999876435--8976999654578
Q gi|254780709|r  240 TTGQNALRQVEMFHAVA--GTTGLIMTKMDGT  269 (321)
Q Consensus       240 ~~gq~~~~~a~~F~~~~--~~~g~I~TKlD~t  269 (321)
                      -+-.+.+.=|+.=-+..  .+=||||-|+|.+
T Consensus       165 ~~~k~~v~KAK~~LEq~G~~~LGvvLNK~d~s  196 (207)
T TIGR01007       165 KIKKREVKKAKEQLEQAGSKFLGVVLNKVDIS  196 (207)
T ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             32646789999999861784115888882576


No 50 
>pfam02492 cobW CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans.
Probab=98.37  E-value=4.6e-06  Score=62.87  Aligned_cols=143  Identities=22%  Similarity=0.274  Sum_probs=86.8

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH------HHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124------542289
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA------LAYEAF  186 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~------v~~~a~  186 (321)
                      |+++.|.=|+||||.+-.|... .+.|++++++..|.-..+ +|.-.  -..-+++++.-..|.-..+      .+.+++
T Consensus         2 v~iitGFLGsGKTTll~~ll~~-~~~~~~~avI~Ne~g~~~-iD~~l--l~~~~~~v~el~~GciCc~~~~d~~~~l~~l   77 (174)
T pfam02492         2 VTVLTGFLGSGKTTLLEHLLRD-NREGLKIAVIVNDFGETG-IDAEL--LRETGAEIVELNNGCICCTIREDLSMVLEAL   77 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH-CCCCCCEEEEEECCCCHH-HHHHH--HHHCCCEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             6999348878899999999984-448984799993365302-07999--8706961899748866454333699999999


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHC-CCCEEEEEC
Q ss_conf             9996514875998654333211577899998998763022234301123102335225778999876435-897699965
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVA-GTTGLIMTK  265 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~-~~~g~I~TK  265 (321)
                      ......++|+|+|-|.| +-.-.++++    +..      .-..+-++-|+||...++..+....|.+.+ --|-+|++|
T Consensus        78 ~~~~~~~~d~iiIE~sG-la~p~~i~~----~~~------~~~~~~~i~vvDa~~~~~~~~~~~~~~~Qi~~AD~vvlNK  146 (174)
T pfam02492        78 LELKLPRLDLLFIETTG-LACPAPVLD----LRS------DLGLDGVVTVVDVKNFTEGEDIPEKAPDQIAFADLIVINK  146 (174)
T ss_pred             HHCCCCCCCEEEEECCC-CCCHHHHHH----HHH------CCCCCEEEEEEECHHHHHCCCCHHHHHHHHHHCCEEEEEH
T ss_conf             85578999999995876-677077776----532------0265459999972343300200789999998769999846


Q ss_pred             CCCCC
Q ss_conf             45787
Q gi|254780709|r  266 MDGTA  270 (321)
Q Consensus       266 lD~ta  270 (321)
                      .|--+
T Consensus       147 ~Dl~~  151 (174)
T pfam02492       147 TDLAP  151 (174)
T ss_pred             HHCCC
T ss_conf             65378


No 51 
>PRK13768 GTPase; Provisional
Probab=98.37  E-value=4.5e-06  Score=62.94  Aligned_cols=170  Identities=21%  Similarity=0.311  Sum_probs=93.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH--------HH------HHHHCCCCCCCCCCC
Q ss_conf             4123113544444247899999998522674267743451245688999--------99------753035321223586
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLK--------IW------ADRTSADFVCSEIGS  176 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~--------~~------a~~~~v~~~~~~~~~  176 (321)
                      ++.++++||.||||||-|+.+..|+...|++|.+|..|.   |+ |.+.        .+      -+..+.    +|.| 
T Consensus         2 ~~~~~ViGpaGSGKsT~~~~l~~~l~~~~r~~~vvNLDP---A~-e~~pY~~~iDIRd~i~~~dVM~~~~L----GPNG-   72 (253)
T PRK13768          2 MYIVFFLGTAGSGKTTLVGALSDWLEEQGYDVAIVNLDP---AV-EYLPYKPDIDVREYVSAREIMRKYGL----GPNG-   72 (253)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---CC-CCCCCCCCCCHHHHCCHHHHHHHHCC----CCCH-
T ss_conf             718999899999889999999999997699759997898---66-58999988637861789999988198----9646-


Q ss_pred             CCHHHHHHHHHHHH-----------HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             61245422899996-----------5148759986543332115778999989987630222343011231023352257
Q gi|254780709|r  177 DAAALAYEAFKQAQ-----------AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA  245 (321)
Q Consensus       177 dp~~v~~~a~~~a~-----------~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~  245 (321)
                         ++.+ +++++.           ..+.|.+|+||.|-.-.-.. ..-+..|.+.+.+   ..+.-+.+++|+.--++.
T Consensus        73 ---ali~-~~e~l~~~~d~l~~~i~~~~~dY~i~D~PGQiElft~-~~~~~~i~~~L~~---~~~~~~v~l~D~~~~~~~  144 (253)
T PRK13768         73 ---ALIA-SVDLLLTKAEEIKEEIERLDADYVLVDTPGQMELFAF-RESGRYLVEKLSS---GSKSLSVYLIDAVLAKDP  144 (253)
T ss_pred             ---HHHH-HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEEC-CHHHHHHHHHHHC---CCCEEEEEEECHHHHCCH
T ss_conf             ---8999-9999999899999998515887599826874432223-4079999999863---686289998450563788


Q ss_pred             HHH--------HHHHHHHCCCC-EEEEECCCCCCCH------------------------------HHHHHHHHHHCCCE
Q ss_conf             789--------99876435897-6999654578706------------------------------99999999976988
Q gi|254780709|r  246 LRQ--------VEMFHAVAGTT-GLIMTKMDGTARG------------------------------GGLIPIVVTHKIPV  286 (321)
Q Consensus       246 ~~~--------a~~F~~~~~~~-g~I~TKlD~ta~~------------------------------G~~ls~~~~~~~Pi  286 (321)
                      ..-        .-.++  +++- =.|+||.|=-.+-                              ..++.+......++
T Consensus       145 ~~fiS~~L~a~s~m~~--l~lP~inVlsK~Dll~~~~~~~i~~~~~D~~~l~~~l~~~~~~~~~l~~~l~~~l~e~~~~v  222 (253)
T PRK13768        145 SDFVSLLLLALSVQLR--LGLPQIPVLNKIDLLSEEELERIRKWLEDPETLLEELKLDKGVQGDLAEELLSALEESGIPV  222 (253)
T ss_pred             HHHHHHHHHHHHHHHH--CCCCEEEEEEHHHCCCHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             7999999999999997--39997998676862783779999998629999999985061158999999999999846666


Q ss_pred             EEEEC----CCCCCCCC
Q ss_conf             99975----89813255
Q gi|254780709|r  287 YFLGV----GEGINDLE  299 (321)
Q Consensus       287 ~fig~----Ge~i~Dl~  299 (321)
                      .|++.    ||.++|+-
T Consensus       223 ~~ipvS~~~~eg~~~l~  239 (253)
T PRK13768        223 RVIPVSAKTGEGFEELY  239 (253)
T ss_pred             CEEEEECCCCCCHHHHH
T ss_conf             52775689878799999


No 52 
>cd03110 Fer4_NifH_child This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.
Probab=98.35  E-value=1.8e-05  Score=58.63  Aligned_cols=156  Identities=22%  Similarity=0.231  Sum_probs=83.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-HCCCCCCCCCCCCCH-------------
Q ss_conf             311354444424789999999852267426774345124568899999753-035321223586612-------------
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR-TSADFVCSEIGSDAA-------------  179 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~-~~v~~~~~~~~~dp~-------------  179 (321)
                      ....|==||||||+.+-||..+    ++|+++-||.+-+...--|..-.+. ..+........-+|.             
T Consensus         3 aV~SgKGGVGKTT~a~nLA~~l----~~V~liD~D~~~~n~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~   78 (179)
T cd03110           3 AVISGKGGTGKTTVTAALAALL----KNVVLADCDVDAPNLHLFLKPEIEEEEDFIVGGKKAVIDPELCISCGLCGKLVT   78 (179)
T ss_pred             EEEECCCCCHHHHHHHHHHHHC----CCCEEEEECCCCCCHHHHCCCCCCCCEEEEECCCCCEECHHHHHHCCCHHHHHH
T ss_conf             9995899860999999999974----287199941899857777187656321223046533515066532351768899


Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC--CHHHHHHHHHHHHH-C
Q ss_conf             45422899996514875998654333211577899998998763022234301123102335--22577899987643-5
Q gi|254780709|r  180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT--GQNALRQVEMFHAV-A  256 (321)
Q Consensus       180 ~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~--gq~~~~~a~~F~~~-~  256 (321)
                      ....+.......++||+|+|||+--+.  ...+.-+.            .-+.+++|.....  =.++.+.++.+++. +
T Consensus        79 ~~~~~~~~~~~~~~~D~viiD~Ppg~~--~~~~~al~------------~ad~~iiVttP~~~si~d~~r~i~l~~~~~~  144 (179)
T cd03110          79 EVRKHAKEIAKAEGAELIIIDGPPGIG--CPVIASLT------------GADAALLVTEPTPSGLHDLERAVELVRHFGI  144 (179)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCC--HHHHHHHH------------CCCEEEEECCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             999999998644379989981899975--78999997------------3994999819947899999999999998299


Q ss_pred             CCCEEEEECCCCCCCH-HHHHHHHHHHCCCEEEEE
Q ss_conf             8976999654578706-999999999769889997
Q gi|254780709|r  257 GTTGLIMTKMDGTARG-GGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       257 ~~~g~I~TKlD~ta~~-G~~ls~~~~~~~Pi~fig  290 (321)
                      ++ |+|+.|.|..... +.+-.++.++++|  |+|
T Consensus       145 ~~-gvV~Nr~~~~~~~~~~i~~~~~~~~vp--~LG  176 (179)
T cd03110         145 PV-GVVINKYDLNDEIAEEIEDYCEEEGIP--ILG  176 (179)
T ss_pred             CE-EEEEECCCCCCCCHHHHHHHHHHHCCC--EEE
T ss_conf             78-999968878876348999999980999--898


No 53 
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.
Probab=98.35  E-value=7.7e-06  Score=61.29  Aligned_cols=143  Identities=23%  Similarity=0.312  Sum_probs=85.6

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             31135444442478999999985226742677434512456889999975303532-12235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      ....|--|+||||+.+-||..+.+.|++|+++-+|.|-+.             +|. +.++.   ......+-+....-.
T Consensus         3 ~v~s~kggvgkst~~~~la~~l~~~g~~v~~~d~di~gps-------------ip~~~rGp~---~~~~i~q~l~~~~w~   66 (169)
T cd02037           3 AVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDADIYGPS-------------IPKMWRGPM---KMGAIKQFLTDVDWG   66 (169)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-------------CCEEEECHH---HHHHHHHHHHHCCCC
T ss_conf             9974999881999999999999987997899971379997-------------550120473---899999999852546


Q ss_pred             CCCEEEEECC-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHHHHHH-CCCCEEEEEC
Q ss_conf             4875998654-33321157789999899876302223430112310233522-----577899987643-5897699965
Q gi|254780709|r  193 KVDVLIIDTA-GRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEMFHAV-AGTTGLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTA-GR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~F~~~-~~~~g~I~TK  265 (321)
                      ++|++||||. |=.  |..+     .+.+.+      ..++.++|   ||.|     ++.+.++.|++. +++-|+|.-.
T Consensus        67 ~lDyLIID~PPGtg--D~~l-----t~~~~~------~~d~~IvV---TTP~~~s~~Da~r~i~~~~~~~i~i~GvVeNM  130 (169)
T cd02037          67 ELDYLVIDMPPGTG--DEHL-----TLAQSL------PIDGAVIV---TTPQEVALDDVRKAIDMFKKVNIPILGVVENM  130 (169)
T ss_pred             CCCEEEEECCCCCC--HHHH-----HHHHHC------CCCCEEEE---ECCCHHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             67889996899987--0778-----798750------56747999---46958899999999999997599707999879


Q ss_pred             CC----C--C----CCHHHHHHHHHHHCCCEEEEE
Q ss_conf             45----7--8----706999999999769889997
Q gi|254780709|r  266 MD----G--T----ARGGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       266 lD----~--t----a~~G~~ls~~~~~~~Pi~fig  290 (321)
                      --    .  .    -.-|.+-.++.++++|  |+|
T Consensus       131 s~~~c~~c~~~~~ifg~~~~~~la~~~~i~--~Lg  163 (169)
T cd02037         131 SYFVCPHCGKKIYIFGKGGGEKLAEELGVP--LLG  163 (169)
T ss_pred             CCCCCCCCCCEEECCCCCHHHHHHHHHCCC--EEE
T ss_conf             666079999735278884499999995999--898


No 54 
>PRK13231 nitrogenase reductase-like protein; Reviewed
Probab=98.33  E-value=2e-05  Score=58.44  Aligned_cols=158  Identities=16%  Similarity=0.163  Sum_probs=97.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----------HHHHHHHHHHHHH----------HCCCCCC
Q ss_conf             231135444442478999999985226742677434512-----------4568899999753----------0353212
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR-----------SAAIDQLKIWADR----------TSADFVC  171 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR-----------~aA~eQL~~~a~~----------~~v~~~~  171 (321)
                      -|.+-|=-|+|||||.+-||+-+. +|+||+++.||.-.           +--.+.|+.+.+.          -|+.++ 
T Consensus         4 ~iAiyGKGGIGKSTt~~NlaaalA-~g~rVl~igcDpk~dst~~L~G~~~ptvl~~l~~~~~~~~~dvv~~g~~gi~cv-   81 (264)
T PRK13231          4 KIAIYGKGGIGKSTTVSNMAAAYS-SDNSTLVIGCDPKADTTRTLVGKRIPTVLDTLKDNRQPELEDIIYEGYNNTLCV-   81 (264)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHH-CCCCEEEECCCCCCCHHHHHHCCCCCCHHHHHHHCCCCCHHHHEEECCCCEEEE-
T ss_conf             899978985478889999999998-799779985688850246761999883889863127777656312178984997-


Q ss_pred             CCCC-CCCH--------HHHHHHHHHHH--HHCCCEEEEECCCCC---CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             2358-6612--------45422899996--514875998654333---21157789999899876302223430112310
Q gi|254780709|r  172 SEIG-SDAA--------ALAYEAFKQAQ--AKKVDVLIIDTAGRL---HNNSILMAGIGKMIRVLKRLDPHAPHSVLQVL  237 (321)
Q Consensus       172 ~~~~-~dp~--------~v~~~a~~~a~--~~~~DvvliDTAGR~---~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVl  237 (321)
                       +.| ..|.        ..+++-++...  ..++|+|++|+.|-.   .....+              ....-+++++|.
T Consensus        82 -esGgpepg~gcagrgi~~~~~lLe~~~~~~~~~D~vl~Dvlgdvvcggfa~Pi--------------r~~~Adev~IVt  146 (264)
T PRK13231         82 -ESGGPEPGVGCAGRGVIVAMNLLEKLGVFDNDPDVVIYDVLGDVVCGGFSVPL--------------REDYADEVYIVT  146 (264)
T ss_pred             -ECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEECCC--------------CCCCCCEEEEEE
T ss_conf             -37998877665652176898999872642247987999435872056670455--------------426698899994


Q ss_pred             CC--CCCHHHHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEE
Q ss_conf             23--3522577899987643-58976999654578706999999999769889
Q gi|254780709|r  238 DA--TTGQNALRQVEMFHAV-AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVY  287 (321)
Q Consensus       238 da--~~gq~~~~~a~~F~~~-~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~  287 (321)
                      ++  +.=.+|-++++.+.++ ..+.|+|.+..+....-..+=..+..++.|+.
T Consensus       147 s~e~msLyaAnnI~~~i~~~~~rl~GiI~N~r~~~~e~~iv~~fa~~~g~~vl  199 (264)
T PRK13231        147 SGEYMSLYAANNIAKGIKKLKGKLGGIICNCRNVKNEVEIVSEFASLIGSRII  199 (264)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             78589999999999999995464420896068988779999999997199689


No 55 
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=98.33  E-value=1.8e-06  Score=65.75  Aligned_cols=39  Identities=33%  Similarity=0.627  Sum_probs=35.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             412311354444424789999999852267426774345
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      ..+++|.|=-||||||+.|=+|.++...|++|++|++|.
T Consensus         2 ~riv~f~GKGGVGKTT~aaA~A~~lA~~g~kvLlvStDP   40 (322)
T COG0003           2 TRIVFFTGKGGVGKTTIAAATAVKLAESGKKVLLVSTDP   40 (322)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             379999368854589999999999997599079998489


No 56 
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321   These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=98.33  E-value=2.5e-07  Score=71.75  Aligned_cols=196  Identities=19%  Similarity=0.252  Sum_probs=98.3

Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH--CCCCCCCC
Q ss_conf             9999999986056778999999999999973889899999999999875127899899999999987852--01001210
Q gi|254780709|r   26 LKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKM--LMPLSKPF  103 (321)
Q Consensus        26 ~~L~~~l~~l~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~--L~~~~~~~  103 (321)
                      +.+.+.+.++++..  .|..++++++. .+.|+++.+..-  .++|-....+.-+..-++..+-..|-.+  |+ +..+.
T Consensus        45 ~~~~~l~~~~l~~t--h~~~~~~f~~~-~E~Dfs~~~~~~--~RfRvN~f~QRg~~a~vlR~ip~~Ip~fe~LG-LP~~v  118 (350)
T TIGR01420        45 EDTQKLLREILSST--HEKQREEFEEN-GELDFSFSLPGL--ARFRVNAFKQRGGVALVLRLIPSKIPTFEELG-LPRPV  118 (350)
T ss_pred             HHHHHHHHHHCCCC--CHHHHHHHHHC-CCCCEEEEECCC--CEEEEHHHHHCCHHHHHHHHCCCCCCCHHHCC-CCHHH
T ss_conf             99999999863845--65777505650-664446630673--22122032350006423231153462166637-98789


Q ss_pred             CCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             0013-667412311354444424789999999852267426774345124568899999753035321223586612454
Q gi|254780709|r  104 NWDF-SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA  182 (321)
Q Consensus       104 ~~~~-~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~  182 (321)
                      .... ..+--.||+.||||||||||+|=+=.|.-++.... ++|.=       |-.+-.=..-..=+-.-+-|.|--+ .
T Consensus       119 ~~~~a~~~~GLiLVTGPTGSGKSTTlAsmIDyIN~~~~~H-IiTIE-------DPIEyvh~~~~sli~QREvG~DT~s-F  189 (350)
T TIGR01420       119 LRELAERPRGLILVTGPTGSGKSTTLASMIDYINKNKAGH-IITIE-------DPIEYVHKNKRSLINQREVGLDTLS-F  189 (350)
T ss_pred             HHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCC-CEEEE-------CCEEEEECCCEEEEECCCCCCCHHH-H
T ss_conf             9999836699389876889867899999997874038888-25631-------7731410477024543624675457-9


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC-HHHHHHHHHH
Q ss_conf             228999965148759986543332115778999989987630222343011231023352-2577899987
Q gi|254780709|r  183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG-QNALRQVEMF  252 (321)
Q Consensus       183 ~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g-q~~~~~a~~F  252 (321)
                      .+|+.+|-.++=|||||=          -|+-++-|.-++......     +||+ ||.. |+|+..+..+
T Consensus       190 ~~ALraALReDPDvILiG----------E~RD~ET~~~AL~AAETG-----HLV~-gTLHTnsA~~ti~RI  244 (350)
T TIGR01420       190 ANALRAALREDPDVILIG----------EMRDLETVELALTAAETG-----HLVF-GTLHTNSAAKTIERI  244 (350)
T ss_pred             HHHHHHHHCCCCCEEEEE----------CCCCHHHHHHHHHHHHHC-----CHHH-HHHHHHHHHHHHHHH
T ss_conf             999768410289889982----------556278999999874213-----1567-666642388876777


No 57 
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=98.31  E-value=0.00041  Score=49.15  Aligned_cols=132  Identities=23%  Similarity=0.303  Sum_probs=88.0

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-----CCCC---CCCCCH--HHH
Q ss_conf             231135444442478999999985226742677434512456889999975303532-----1223---586612--454
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-----VCSE---IGSDAA--ALA  182 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-----~~~~---~~~dp~--~v~  182 (321)
                      |+.++|-|||||||-+-|+..-. ..|.+..++.+-.-|+||+-=-+-.|+-+|.++     |...   .-++-.  ..+
T Consensus        91 Vvii~GeTGsGKTTQiPq~~le~-g~g~~~~I~~TQPRRiAA~svA~RVA~E~~~~lG~~VGY~VRf~~~~s~~t~i~~~  169 (1295)
T PRK11131         91 VVIVAGETGSGKTTQLPKICLEL-GRGIKGLIGHTQPRRLAARTVANRIAEELETELGGCVGYKVRFNDQVSDNTMVKLM  169 (1295)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHC-CCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEE
T ss_conf             69997689998788999999962-79999989977965999999999999981999899888894569887999779997


Q ss_pred             HHHHHHHH------HHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             22899996------5148759986543-332115778999989987630222343011231023352257789998764
Q gi|254780709|r  183 YEAFKQAQ------AKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA  254 (321)
Q Consensus       183 ~~a~~~a~------~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~  254 (321)
                      -+++--..      ..+|++||||-|- |+-+-.-|+-=|+++.   .    ..|+..+.+++||.  |+-.-++.|+.
T Consensus       170 TdGiLL~e~~~d~~L~~y~~iIiDEaHERsl~~D~LLg~Lk~ll---~----~R~dLKvIimSATi--d~e~fs~yF~~  239 (1295)
T PRK11131        170 TDGILLAEIQQDRLLMQYDTIIIDEAHERSLNIDFILGYLKELL---P----RRPDLKVIITSATI--DPERFSRHFNN  239 (1295)
T ss_pred             CCHHHHHHHHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHH---H----HCCCCEEEEECCCC--CHHHHHHHCCC
T ss_conf             65699998620998788777998685568801999999999998---3----39998899955868--97999965799


No 58 
>PRK13235 nifH nitrogenase reductase; Reviewed
Probab=98.30  E-value=2.1e-05  Score=58.18  Aligned_cols=166  Identities=15%  Similarity=0.232  Sum_probs=93.8

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH------------HHHHHHHHHHHCCC-C--------CC
Q ss_conf             231135444442478999999985226742677434512456------------88999997530353-2--------12
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA------------IDQLKIWADRTSAD-F--------VC  171 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA------------~eQL~~~a~~~~v~-~--------~~  171 (321)
                      -|.+.|==|+|||||++-||+-+.+.|+||++|-||.---+-            .+.|+..++...++ +        ..
T Consensus         3 ~iaiyGKGGVGKSTtt~NLaAALA~~GkkVl~IgcDPk~dsT~~L~gg~~~~tvld~l~~~~~~~~ledvi~~g~~gi~c   82 (274)
T PRK13235          3 KVAIYGKGGIGKSTTTQNTVAGLAEMGKKVMVVGCDPKADSTRLLLGGLQQKTVLDTLREEGEDVELEDIIKEGYGNTRC   82 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHCCCCCCCHHHHHHHCCCCCCHHHHEEECCCCEEE
T ss_conf             79997998554767899999999978997999898984536678738998997899998628776778944317898189


Q ss_pred             CCCCC-CCH--------HHHHHHHHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             23586-612--------45422899996----514875998654333211577899998998763022234301123102
Q gi|254780709|r  172 SEIGS-DAA--------ALAYEAFKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD  238 (321)
Q Consensus       172 ~~~~~-dp~--------~v~~~a~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVld  238 (321)
                      .+.+. .|.        ..+++-++...    ...+|+|++|..|=.--..--|    -       ......+++++|.+
T Consensus        83 veaggp~pg~gcagrgii~~~~~L~~l~~~~~~~~~DyVl~DvLGdvvcggFa~----p-------ir~~~A~eV~IVts  151 (274)
T PRK13235         83 TESGGPEPGVGCAGRGIITSVNLLEQLGAYDDEWNLDYVFYDVLGDVVCGGFAM----P-------IRDGKAEEIYIVCS  151 (274)
T ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCC----C-------CCCCCCCEEEEEEC
T ss_conf             868998756675763152589999881775433577689981378531245115----5-------10065878999916


Q ss_pred             CC-CC----HHHHHHHHHHHH--HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             33-52----257789998764--35897699965457870699999999976988999
Q gi|254780709|r  239 AT-TG----QNALRQVEMFHA--VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFL  289 (321)
Q Consensus       239 a~-~g----q~~~~~a~~F~~--~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fi  289 (321)
                      +- .-    +|...-++.|.+  .+.+.|+|++.-+-+..-..+=.++..++.|+..+
T Consensus       152 ~E~~AL~aannI~k~i~~~~~~~~~~l~Gii~N~r~~~~~~~~v~~fa~~~g~~vi~~  209 (274)
T PRK13235        152 GEMMAMYAANNICKGILKYADAGGVRLGGLICNSRKVDNEREMIEELARKLGTQMIHF  209 (274)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             8368999999999999999743795488999736778757899999999749936997


No 59 
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.
Probab=98.27  E-value=1.4e-06  Score=66.49  Aligned_cols=47  Identities=36%  Similarity=0.429  Sum_probs=41.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             44442478999999985226742677434512456889999975303532122358661245422899996514875998
Q gi|254780709|r  120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLII  199 (321)
Q Consensus       120 nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~Dvvli  199 (321)
                      =||||||++.-||+++.++|++|+++-+|..                                           ||+|+|
T Consensus         9 GGvGKtt~~~~la~~~a~~g~~vl~iD~DpQ-------------------------------------------yD~iiI   45 (104)
T cd02042           9 GGVGKTTTAVNLAAALARRGKRVLLIDLDPQ-------------------------------------------YDYIII   45 (104)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCCC-------------------------------------------CCEEEE
T ss_conf             9876899999999999977992999977988-------------------------------------------888999


Q ss_pred             ECCCCCCCHH
Q ss_conf             6543332115
Q gi|254780709|r  200 DTAGRLHNNS  209 (321)
Q Consensus       200 DTAGR~~~~~  209 (321)
                      ||+++.....
T Consensus        46 Dtpp~~~~~~   55 (104)
T cd02042          46 DTPPSLGLLT   55 (104)
T ss_pred             ECCCCCCHHH
T ss_conf             7949998999


No 60 
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.
Probab=98.26  E-value=3.3e-05  Score=56.86  Aligned_cols=124  Identities=20%  Similarity=0.297  Sum_probs=81.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             13544444247899999998522674267743451245688999997530353212235866124542289999651487
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVD  195 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~D  195 (321)
                      ..|--||||||.++-||..+.+.|++|+++-+|.                |.        +              .-+||
T Consensus         5 ~sgKgGvGkt~~~~nLa~~la~~G~~vll~D~D~----------------g~--------a--------------n~~~D   46 (139)
T cd02038           5 TSGKGGVGKTNISANLALALAKLGKRVLLLDADL----------------GL--------A--------------NLDYD   46 (139)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC----------------CC--------C--------------CCCCC
T ss_conf             6499998399999999999997899699998989----------------99--------6--------------57999


Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC--CCCHHHHHHHHHHHHHCCC--CEEEEECCCCCCC
Q ss_conf             59986543332115778999989987630222343011231023--3522577899987643589--7699965457870
Q gi|254780709|r  196 VLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA--TTGQNALRQVEMFHAVAGT--TGLIMTKMDGTAR  271 (321)
Q Consensus       196 vvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda--~~gq~~~~~a~~F~~~~~~--~g~I~TKlD~ta~  271 (321)
                      +|||||+...+.+..  .-+.            ..++.++|.-.  +.=.|+..-.+..++..+.  =.+|+.+..+.+.
T Consensus        47 ~viiD~~aG~~~~~~--~~~~------------~ad~~lvV~tpeptSi~DAYalIK~l~~~~~~~~~~lvvN~v~s~~e  112 (139)
T cd02038          47 YIIIDTGAGISDNVL--DFFL------------AADEVIVVTTPEPTSITDAYALIKKLAKQLRVLNFRVVVNRAESPKE  112 (139)
T ss_pred             EEEEECCCCCCHHHH--HHHH------------HCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHH
T ss_conf             999948999877899--9999------------58957999589706799999999999996399975999956899999


Q ss_pred             HHHHHHH-----HHHHCCCEEEEEC
Q ss_conf             6999999-----9997698899975
Q gi|254780709|r  272 GGGLIPI-----VVTHKIPVYFLGV  291 (321)
Q Consensus       272 ~G~~ls~-----~~~~~~Pi~fig~  291 (321)
                      +=..+.-     ...+++++.|+|.
T Consensus       113 a~~~~~~l~~v~~kfL~v~l~~lG~  137 (139)
T cd02038         113 GKKVFKRLSNVSNRFLGLSLDYLGF  137 (139)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             9999999999999980998310714


No 61 
>PRK13233 nifH nitrogenase reductase; Reviewed
Probab=98.26  E-value=6e-05  Score=55.03  Aligned_cols=165  Identities=16%  Similarity=0.186  Sum_probs=93.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHH------------HHHHHHHHH-H-----------H
Q ss_conf             412311354444424789999999852-26742677434512456------------889999975-3-----------0
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAA------------IDQLKIWAD-R-----------T  165 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA------------~eQL~~~a~-~-----------~  165 (321)
                      +..|.+.|==|+|||||.+-||+-+.+ +|+||++|-||.---.-            .+.|+.+++ .           .
T Consensus         2 ~~~iaiyGKGGIGKSTTt~NLaaALA~l~GkrVl~IgcDPk~dST~~l~g~~~~~tv~d~l~~~~~~~~~~e~ii~~g~~   81 (275)
T PRK13233          2 TRKIAIYGKGGIGKSTTTQNTAAAMAHFHDKKVFIHGCDPKADSTRLILGGKPQTTMMDTLRELGEEKVTPDKVIKTGFK   81 (275)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHCCCCCCCCHHHHHHHCCCCCCCHHHHHHCCCC
T ss_conf             73899989985446545999999999647988999797887613677608987883999998628875538888753789


Q ss_pred             CCCCCCCCCCCCCH--------HHHHHHHHHHH--HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             35321223586612--------45422899996--514875998654333211577899998998763022234301123
Q gi|254780709|r  166 SADFVCSEIGSDAA--------ALAYEAFKQAQ--AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       166 ~v~~~~~~~~~dp~--------~v~~~a~~~a~--~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
                      |+.++.. .+..|.        ..+++-++...  ..++|+|++|+.|=.--.-=.|.           ......+++++
T Consensus        82 gv~cVEa-Ggp~pG~gcagrgii~~~~lle~~~~~~~~~D~Vl~DvLGdVvcGgFa~P-----------ir~~~AdeV~I  149 (275)
T PRK13233         82 GIRCVES-GGPEPGVGCAGRGVITAITLMEEHGAYEDDLDFVFFDVLGDVVCGGFAMP-----------IRDGKAQEVYI  149 (275)
T ss_pred             CCEEEEC-CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCC-----------CCCCCCCEEEE
T ss_conf             8579868-99986665576312358888998097434688899841561105551034-----------31366888999


Q ss_pred             ECCCCC-C-HHHHHH---HHHHHH--HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEE
Q ss_conf             102335-2-257789---998764--358976999654578706999999999769889
Q gi|254780709|r  236 VLDATT-G-QNALRQ---VEMFHA--VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVY  287 (321)
Q Consensus       236 Vlda~~-g-q~~~~~---a~~F~~--~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~  287 (321)
                      |.++-- . ..+-++   ...|.+  .+.+.|+|++..+.+..--.+=..+..++.|+.
T Consensus       150 Vts~E~msL~aannI~~~l~~~~~~~~~~l~Gii~N~r~~~~e~~~v~~fa~~ig~~vi  208 (275)
T PRK13233        150 VASGEMMALYAANNICKGLVKYAEQSGVRLGGIICNSRNVDGELELLEEFTDAIGTQLI  208 (275)
T ss_pred             EECCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             94683799999999999999985058963899997178886079999999998599579


No 62 
>CHL00072 chlL photochlorophyllide reductase subunit L
Probab=98.25  E-value=0.00018  Score=51.66  Aligned_cols=182  Identities=19%  Similarity=0.202  Sum_probs=103.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----------HHHHHHHHHHH--------------HHHCC
Q ss_conf             231135444442478999999985226742677434512-----------45688999997--------------53035
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR-----------SAAIDQLKIWA--------------DRTSA  167 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR-----------~aA~eQL~~~a--------------~~~~v  167 (321)
                      .|.+.|=-|+|||||.+-|++-+...|+||++|-||.-.           +--++-|+.-.              ...|+
T Consensus         2 ~iaiyGKGGIGKSTtsaNlsaaLA~~GkkVl~IGcDpk~DsT~~L~g~~~~tvld~l~~~~~~~~~~~~edvi~~G~~gi   81 (271)
T CHL00072          2 KIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGV   81 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCHHHHHHCCCCCC
T ss_conf             69997898544858899999999987997999789973777740069988859999975378732164999985277884


Q ss_pred             CCCCCCCCCCC---------HHHHHHHHHHHHH-HCCCEEEEECCCCCC--CHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             32122358661---------2454228999965-148759986543332--11577899998998763022234301123
Q gi|254780709|r  168 DFVCSEIGSDA---------AALAYEAFKQAQA-KKVDVLIIDTAGRLH--NNSILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       168 ~~~~~~~~~dp---------~~v~~~a~~~a~~-~~~DvvliDTAGR~~--~~~~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
                      .++  +.|.-+         ...+++-++.... .++|+|++|..|---  --.+-++               .-++++.
T Consensus        82 ~cv--EaGGPepGvGCaGrgi~~~i~lL~~l~~~~d~D~V~yDvlgDVVCGGFa~Pi~---------------~Ad~~~i  144 (271)
T CHL00072         82 DCV--EAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLN---------------YADYCII  144 (271)
T ss_pred             EEE--ECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCC---------------CCCEEEE
T ss_conf             665--43899988777886519999999973762138889994477655654567500---------------0888999


Q ss_pred             ECCC--CCCHHHHHHH---HHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEE-EE----------CCCCCCC
Q ss_conf             1023--3522577899---987643--589769996545787069999999997698899-97----------5898132
Q gi|254780709|r  236 VLDA--TTGQNALRQV---EMFHAV--AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYF-LG----------VGEGIND  297 (321)
Q Consensus       236 Vlda--~~gq~~~~~a---~~F~~~--~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~f-ig----------~Ge~i~D  297 (321)
                      |-+.  |.=..|-+++   +.|.+.  +.+.|+|.-..++.   ..+=-.+..++.|+.. |-          -|+.+=.
T Consensus       145 Vts~e~malyaANnI~~~i~~~a~~~~~rl~GiI~N~~~~~---~~v~~fa~~~g~~~i~~iPrd~~V~~ae~~~~TviE  221 (271)
T CHL00072        145 ITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKR---DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFE  221 (271)
T ss_pred             EECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCH---HHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCCEEE
T ss_conf             95670889999999999999973046864443652268837---899999997399669856871166899974882042


Q ss_pred             CCCCCHH---------HHHHHHCCCC
Q ss_conf             5557789---------9999872865
Q gi|254780709|r  298 LEPFVAK---------DFSAVITGCL  314 (321)
Q Consensus       298 l~~f~~~---------~~~~~llG~g  314 (321)
                      ..|.+|.         .++++|++--
T Consensus       222 ~~p~s~~~~~~~~~Yr~LA~~I~~n~  247 (271)
T CHL00072        222 MAESEPSLNYVCDFYLNIADQLLSQP  247 (271)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             28998247899999999999997399


No 63 
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=98.25  E-value=1.5e-05  Score=59.30  Aligned_cols=92  Identities=15%  Similarity=0.187  Sum_probs=59.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH--H-CCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             412311354444424789999999852267426774345124568899999753--0-3532122358661245422899
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR--T-SADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~--~-~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      -.++.+.|+.|+||||-+-.+|....++|.+|+.+++.-|++.-+.|+....-.  + ++.++ .+..-++..-+-+.+.
T Consensus        23 G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYidtE~~~~er~~qi~~~~~~~~~~~i~~~-~~~~~~~~~~~i~~~~  101 (224)
T PRK09361         23 GTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYIDTEGLSPERFKQIAGEDFEELLSNIIIF-EPSSFEEQREAIQKAE  101 (224)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCHHHHHHCCEEE-CCCCHHHHHHHHHHHH
T ss_conf             879999899998599999999999997499099967876788999998565734542061472-4798899999999999


Q ss_pred             HHHHHCCCEEEEECCC
Q ss_conf             9965148759986543
Q gi|254780709|r  188 QAQAKKVDVLIIDTAG  203 (321)
Q Consensus       188 ~a~~~~~DvvliDTAG  203 (321)
                      ....+++++|+||..-
T Consensus       102 ~~~~~~~~lvVIDSi~  117 (224)
T PRK09361        102 KIAKENVGLIVLDSAT  117 (224)
T ss_pred             HHHHCCCCEEEEECCH
T ss_conf             8750587389996230


No 64 
>PRK00090 bioD dithiobiotin synthetase; Reviewed
Probab=98.24  E-value=0.00016  Score=52.10  Aligned_cols=174  Identities=20%  Similarity=0.298  Sum_probs=93.0

Q ss_pred             EEECCCC-CCCCHHHHHHHHHHHHHHCCCCEEEEE-----C-CCCCHHHHHHHHHHHHHHC-----CCC-CCCC------
Q ss_conf             2311354-444424789999999852267426774-----3-4512456889999975303-----532-1223------
Q gi|254780709|r  113 VILVVGV-NGVGKTTVIGKLSKKMSDAGLKVMLAA-----G-DTFRSAAIDQLKIWADRTS-----ADF-VCSE------  173 (321)
Q Consensus       113 vil~vG~-nG~GKTTT~aKLA~~~~~~g~kV~lva-----~-DtfR~aA~eQL~~~a~~~~-----v~~-~~~~------  173 (321)
                      ++++.|- +|||||+..+-|++.++++|.+|.-.=     + +..+.+-.+.++..+....     .|+ +..+      
T Consensus         1 ~ifI~GT~T~vGKT~vt~~L~~~l~~~G~~v~~~KPv~tG~~~~~~~~Da~~~~~~~~~~~~~~~~~p~~~~~p~sP~~a   80 (223)
T PRK00090          1 VLFVTGTDTGVGKTVVTAALAQALREQGYRVAGYKPVQSGCDGGLRNGDALALQRLSGLPLDYELVNPYRFEEPLSPHLA   80 (223)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECEEEECCCCCCCCHHHHHHHHHHCCCCCHHHHCCCCCCCCCCHHHH
T ss_conf             98998689997699999999999997899489975120489889972799999998089998676054025889898999


Q ss_pred             ---CCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC--CCCHH-HHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--
Q ss_conf             ---586--6124542289999651487599865433--32115-7789999899876302223430112310233522--
Q gi|254780709|r  174 ---IGS--DAAALAYEAFKQAQAKKVDVLIIDTAGR--LHNNS-ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--  243 (321)
Q Consensus       174 ---~~~--dp~~v~~~a~~~a~~~~~DvvliDTAGR--~~~~~-~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--  243 (321)
                         .+.  |... +.++++.. .+++|+++|.-||=  .+.+. ..+.+|.   +.+       .--++||.+...|-  
T Consensus        81 a~~~g~~i~~~~-i~~~~~~l-~~~~d~vlvEGaGGl~~Pl~~~~~~~Dla---~~l-------~~pvILV~~~~lG~in  148 (223)
T PRK00090         81 ARLEGVTIDLEK-ISAALREL-AQQADLVLVEGAGGLLVPLTDDLTLADLA---AQL-------QLPVILVVGVKLGCIN  148 (223)
T ss_pred             HHHHCCCCCHHH-HHHHHHHH-HHHCCEEEEECCCCCCCCCCCCCCHHHHH---HHH-------CCCEEEEECCCCCHHH
T ss_conf             999098468999-99999999-83189899946886556756787889999---996-------8898999769888099


Q ss_pred             HHHHHHHHH-HHHCCCCEEEEECCCCCCC--HHHHHHHHHHHCCCEEEEECCCCCCCCCC
Q ss_conf             577899987-6435897699965457870--69999999997698899975898132555
Q gi|254780709|r  244 NALRQVEMF-HAVAGTTGLIMTKMDGTAR--GGGLIPIVVTHKIPVYFLGVGEGINDLEP  300 (321)
Q Consensus       244 ~~~~~a~~F-~~~~~~~g~I~TKlD~ta~--~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~  300 (321)
                      .++-.++.. +.-+++-|+|+.++++...  --..-.+...+++|  .+|.==..+++.+
T Consensus       149 htllt~eal~~~gl~v~GvI~N~~~~~~~~~~~~~~~l~~~~gvP--vLG~iP~~~~~~~  206 (223)
T PRK00090        149 HTLLTLEAIRARGLPLAGWVANGVPPEGLRHAENLATLAELLPAP--LLGRLPYLAELSP  206 (223)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCC--EEEECCCCCCCCH
T ss_conf             999989999968994899999685883667776899999854998--8997589999895


No 65 
>PRK13232 nifH nitrogenase reductase; Reviewed
Probab=98.23  E-value=3.2e-05  Score=56.96  Aligned_cols=161  Identities=19%  Similarity=0.262  Sum_probs=88.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH------------HHHHHHHHHH------------HCCC
Q ss_conf             231135444442478999999985226742677434512456------------8899999753------------0353
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA------------IDQLKIWADR------------TSAD  168 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA------------~eQL~~~a~~------------~~v~  168 (321)
                      -|.+.|==|+|||||++-||+-+.+.|+||++|-||..-...            .+-|+.+++.            .|+.
T Consensus         3 ~iaiyGKGGVGKSTTt~NLaAALA~~GkkVL~IgcDPk~dsT~~l~gg~~~~tvld~l~~~~~~~~~l~~v~~~g~~gv~   82 (273)
T PRK13232          3 QIAIYGKGGIGKSTTTQNLTAALSTMGNKILLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGVDLDVVMQPGFGDIK   82 (273)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCCCCCCHHHHHHHCCCCCCCHHHEEECCCCCEE
T ss_conf             79997998665887899999999977996999897884427778858998887999998618565636661542889738


Q ss_pred             CCCCCCCC-CCHH-------H-HHHHHHHH--HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             21223586-6124-------5-42289999--651487599865433321157789999899876302223430112310
Q gi|254780709|r  169 FVCSEIGS-DAAA-------L-AYEAFKQA--QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVL  237 (321)
Q Consensus       169 ~~~~~~~~-dp~~-------v-~~~a~~~a--~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVl  237 (321)
                      ++  +.+. .|..       + .++-++..  -..++|+|++|+.|=..-..=-|- +          .....+++++|.
T Consensus        83 cv--e~ggp~~g~gcagrgii~~~~lle~l~~~~~~~Dyvl~Dvlgdvvcggfa~P-~----------~~~~A~evlIVt  149 (273)
T PRK13232         83 CV--ESGGPEPGVGCAGRGIITSIGLLENLGAYTDDLDYVFYDVLGDVVCGGFAMP-I----------REGKAKEIYIVA  149 (273)
T ss_pred             EE--ECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCC-C----------CCCCCCEEEEEE
T ss_conf             98--6899876765453047888889997083214798899941473323653144-2----------016576899980


Q ss_pred             CCCC----C-HHHHHHHHHHHH-HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCE
Q ss_conf             2335----2-257789998764-35897699965457870699999999976988
Q gi|254780709|r  238 DATT----G-QNALRQVEMFHA-VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPV  286 (321)
Q Consensus       238 da~~----g-q~~~~~a~~F~~-~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi  286 (321)
                      ++--    + +|..+-.+.|.+ ...+.|+|.+..+....--.+=-.+..++.|+
T Consensus       150 s~E~~slyaannI~k~i~~~~~~~~rl~GiI~n~r~~~~~~e~v~~fa~~~g~~v  204 (273)
T PRK13232        150 SGELMAIYAANNICKGLAKFAKGGARLGGIICNSRNVDGERELLEAFAKKLGSQL  204 (273)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCE
T ss_conf             7608889999999999999962188501488505577638999999999719966


No 66 
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=98.18  E-value=7.1e-06  Score=61.56  Aligned_cols=42  Identities=36%  Similarity=0.422  Sum_probs=32.8

Q ss_pred             CCEEECCCCC-CCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCH
Q ss_conf             4123113544-4442478999999985-2267426774345124
Q gi|254780709|r  111 PHVILVVGVN-GVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRS  152 (321)
Q Consensus       111 p~vil~vG~n-G~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~  152 (321)
                      +.+|.++..- |||||||+.=||+++. ..|+||+++-+|....
T Consensus         2 ~~iI~v~n~KGGvGKTT~a~nLa~~La~~~~~kVLliDlDpQ~s   45 (259)
T COG1192           2 MKIIAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLDPQGS   45 (259)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             76999985788851999999999999983899789997899941


No 67 
>KOG0924 consensus
Probab=98.18  E-value=1.9e-05  Score=58.59  Aligned_cols=155  Identities=26%  Similarity=0.283  Sum_probs=101.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCC--CCEEEEECCCCCHHHHHHHHHHHHHHCCCC-----CCC--CCCCCCHH--
Q ss_conf             1231135444442478999999985226--742677434512456889999975303532-----122--35866124--
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAG--LKVMLAAGDTFRSAAIDQLKIWADRTSADF-----VCS--EIGSDAAA--  180 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g--~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-----~~~--~~~~dp~~--  180 (321)
                      .||++||-+||||||-+++.   +-..|  .+=++.++-.-|+||+---+..++.+|+++     |+.  +.-+.+..  
T Consensus       372 ~vvvivgETGSGKTTQl~Qy---L~edGY~~~GmIGcTQPRRvAAiSVAkrVa~EM~~~lG~~VGYsIRFEdvT~~~T~I  448 (1042)
T KOG0924         372 QVVVIVGETGSGKTTQLAQY---LYEDGYADNGMIGCTQPRRVAAISVAKRVAEEMGVTLGDTVGYSIRFEDVTSEDTKI  448 (1042)
T ss_pred             CEEEEEECCCCCCHHHHHHH---HHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCEEE
T ss_conf             57999935889850166799---986224558715435722789999999999985876453112488852047876057


Q ss_pred             -------HHHHHHHHHHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             -------54228999965148759986543-3321157789999899876302223430112310233522577899987
Q gi|254780709|r  181 -------LAYEAFKQAQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF  252 (321)
Q Consensus       181 -------v~~~a~~~a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F  252 (321)
                             +..+.+.......|.+||+|-|- |+-|-.-||.=|++.   +++.    -+..++|.+||.  |+-.-...|
T Consensus       449 kymTDGiLLrEsL~d~~L~kYSviImDEAHERslNtDilfGllk~~---larR----rdlKliVtSATm--~a~kf~nfF  519 (1042)
T KOG0924         449 KYMTDGILLRESLKDRDLDKYSVIIMDEAHERSLNTDILFGLLKKV---LARR----RDLKLIVTSATM--DAQKFSNFF  519 (1042)
T ss_pred             EEECCCHHHHHHHHHHHHHHEEEEEECHHHHCCCCHHHHHHHHHHH---HHHH----CCCEEEEEECCC--CHHHHHHHH
T ss_conf             8742305779776330044401788511433030058999999999---8742----263599762202--489998872


Q ss_pred             HHH--CCCC------EEEEECCCCCCCHHHHHHH
Q ss_conf             643--5897------6999654578706999999
Q gi|254780709|r  253 HAV--AGTT------GLIMTKMDGTARGGGLIPI  278 (321)
Q Consensus       253 ~~~--~~~~------g~I~TKlD~ta~~G~~ls~  278 (321)
                      .+.  +.+-      -++.||.--....-+++.-
T Consensus       520 gn~p~f~IpGRTyPV~~~~~k~p~eDYVeaavkq  553 (1042)
T KOG0924         520 GNCPQFTIPGRTYPVEIMYTKTPVEDYVEAAVKQ  553 (1042)
T ss_pred             CCCCEEEECCCCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             7886010158764237775268558899998765


No 68 
>pfam06564 YhjQ YhjQ protein. This family consists of several bacterial YhjQ proteins. The function of this family is unknown. However, the family does contain a P-loop sequence motif suggesting a nucleotide binding function.
Probab=98.18  E-value=3.6e-05  Score=56.64  Aligned_cols=149  Identities=13%  Similarity=0.171  Sum_probs=77.7

Q ss_pred             EEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH------HHHHHHHHHH---------------HHCCCCC
Q ss_conf             23113-544444247899999998522674267743451245------6889999975---------------3035321
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA------AIDQLKIWAD---------------RTSADFV  170 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~a------A~eQL~~~a~---------------~~~v~~~  170 (321)
                      ||.++ +==|||||||++-||+-+.+.|++|++|-+|..-..      ..++-..|+.               .-|+.++
T Consensus         3 iIai~s~KGGVGKTT~t~nLa~aLa~~G~rVLlID~Dpq~~l~~~~g~~~~~~~g~~~~~l~~~~~~~~~~~~~~gl~ll   82 (244)
T pfam06564         3 VLALQGVRGGVGTTSLTAALGWALQQLGESVLVIDASPDNLLRLHFNVDFDHSDGWARAELDGRPWRDAALRYTPGLDLL   82 (244)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHCCCCHHHHHEEECCCEEEE
T ss_conf             99996699986199999999999997799589996898742102358886434414899875997777444526975897


Q ss_pred             CCCCCCCC-HHH------------HHHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             22358661-245------------422899996-5148759986543332115778999989987630222343011231
Q gi|254780709|r  171 CSEIGSDA-AAL------------AYEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       171 ~~~~~~dp-~~v------------~~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
                      .  .|.-+ +..            ..+.+.... ..+||+|||||.--+.  ...++-|            .+-++++.|
T Consensus        83 P--~g~l~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~yD~iliD~Pp~l~--~l~~~al------------~aad~vLv~  146 (244)
T pfam06564        83 P--FGQLTGAERENLQQLQPDLGAWAQRLQLLKASGQYRWILLDLPQGFS--PLTRQLL------------ELADVTLAV  146 (244)
T ss_pred             E--CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCH--HHHHHHH------------HHCCCEEEE
T ss_conf             2--89974789998986544379999987642135789999997999968--9999999------------976960899


Q ss_pred             CCCCCCHHHHHHHHHHHH-HCCCCEEEEECCCCCCCHHHH-HHHHHH
Q ss_conf             023352257789998764-358976999654578706999-999999
Q gi|254780709|r  237 LDATTGQNALRQVEMFHA-VAGTTGLIMTKMDGTARGGGL-IPIVVT  281 (321)
Q Consensus       237 lda~~gq~~~~~a~~F~~-~~~~~g~I~TKlD~ta~~G~~-ls~~~~  281 (321)
                      +-+-.    ...+..-.. .....++++|.+|...+...- +.+..+
T Consensus       147 v~~d~----~s~~~l~~~~~~~~~~ilvn~~d~~~~l~~d~~~~~~~  189 (244)
T pfam06564       147 VHADA----NCHIRLHQQALPAGCHLLINDFRIGSQLQDDLYQLWLQ  189 (244)
T ss_pred             ECCCH----HHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             68885----89999732334467748864245576899999999998


No 69 
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional
Probab=98.17  E-value=0.00015  Score=52.15  Aligned_cols=186  Identities=19%  Similarity=0.197  Sum_probs=102.5

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----------HHHHHHHHHHH---HH-----------HC
Q ss_conf             1231135444442478999999985226742677434512-----------45688999997---53-----------03
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR-----------SAAIDQLKIWA---DR-----------TS  166 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR-----------~aA~eQL~~~a---~~-----------~~  166 (321)
                      .+|.+.|=-|+|||||.+-|++-+.+.|+||++|-||.-.           +--++.|+...   +.           .|
T Consensus         3 ~~iaiyGKGGIGKSTttaNlsaALA~~GkkV~~IgcDPk~DsT~~L~g~~~~tild~l~~~~~~~~~~~~ed~~~~G~~g   82 (269)
T PRK13185          3 LVLAVYGKGGIGKSTTSSNLSAALAKLGKKVLQIGCDPKHDSTFTLTGKLVPTVIDILEEVDFHSEELRPEDFVFEGYNG   82 (269)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHHHCCCCHHHCCHHHHHHCCCCC
T ss_conf             39999789954788899999999997699389981899732301125998787899997438760212566776337677


Q ss_pred             CCCCCCCCCCCC---------HHHHHHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             532122358661---------245422899996-5148759986543332115778999989987630222343011231
Q gi|254780709|r  167 ADFVCSEIGSDA---------AALAYEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       167 v~~~~~~~~~dp---------~~v~~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
                      +.++  +.|.-+         ...+++-++... .+.||+|++|..|=-----=-| .+.            .-++++.|
T Consensus        83 v~cv--EaGGP~pG~GCaGrgi~~~~~~L~~~~~~~~~D~Vl~DvlgdVvCGGFa~-Pi~------------~Ad~~~IV  147 (269)
T PRK13185         83 VDCV--EAGGPPAGTGCGGYVVGETVKLLKEHHLLDDYDVILFDVLGDVVCGGFAA-PLQ------------YADYALIV  147 (269)
T ss_pred             CEEE--ECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCC-CHH------------CCCEEEEE
T ss_conf             0566--43899998776764318999999872874337879995367433365557-510------------08889999


Q ss_pred             CCCCC--CHHHHHHH---HHHHH--HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEE-----------ECCCCCCCC
Q ss_conf             02335--22577899---98764--35897699965457870699999999976988999-----------758981325
Q gi|254780709|r  237 LDATT--GQNALRQV---EMFHA--VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFL-----------GVGEGINDL  298 (321)
Q Consensus       237 lda~~--gq~~~~~a---~~F~~--~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fi-----------g~Ge~i~Dl  298 (321)
                      -+.-.  =..|-+++   +.|.+  .+.+.|+|.-+.++..   .+=..+..++.|+.-.           --|+.+=..
T Consensus       148 ts~e~~al~aAnnI~~~i~~~a~~~~~rl~GiI~Nr~~~~d---~v~~fa~~~g~~vl~~IP~~~~V~~se~~g~TviE~  224 (269)
T PRK13185        148 TANDFDSIFAANRIAAAIQAKAKNYKVRLAGVIANRSGGTD---QIDKFNERVGLRTLAHVPDLDAIRRSRLKGKTLFEM  224 (269)
T ss_pred             ECCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHH---HHHHHHHHHCCCEEEECCCCHHHHHHHHCCCEEEEE
T ss_conf             25308789999999999986530158532325761688377---999999986997699789978899998749867885


Q ss_pred             CCCCH--------HHHHHHHCCCCC
Q ss_conf             55778--------999998728656
Q gi|254780709|r  299 EPFVA--------KDFSAVITGCLD  315 (321)
Q Consensus       299 ~~f~~--------~~~~~~llG~gd  315 (321)
                      .|-++        .+++++|++-.+
T Consensus       225 ~p~~~~a~v~~~Yr~LA~~i~~~~~  249 (269)
T PRK13185        225 EETDELEEVQNEYLRLADQLLAGPE  249 (269)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8998178999999999999982899


No 70 
>PRK13705 plasmid-partitioning protein SopA; Provisional
Probab=98.16  E-value=4.2e-06  Score=63.15  Aligned_cols=43  Identities=37%  Similarity=0.472  Sum_probs=33.9

Q ss_pred             CCCCCEEECCCC-CCCCHHHHHHHHHHHHHHCCCCEEEEEC-CCC
Q ss_conf             667412311354-4444247899999998522674267743-451
Q gi|254780709|r  108 SHRPHVILVVGV-NGVGKTTVIGKLSKKMSDAGLKVMLAAG-DTF  150 (321)
Q Consensus       108 ~~~p~vil~vG~-nG~GKTTT~aKLA~~~~~~g~kV~lva~-Dtf  150 (321)
                      ..+|.||.++-- =|||||||+.-||+++..+|+||++|-| |..
T Consensus       103 g~~~~VIAVaNqKGGvGKTTTavnLA~~LAl~G~RVLlID~LDPQ  147 (388)
T PRK13705        103 DEFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQ  147 (388)
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             998728999527888559999999999999779908999587888


No 71 
>PRK11670 putative ATPase; Provisional
Probab=98.15  E-value=9.1e-05  Score=53.78  Aligned_cols=163  Identities=21%  Similarity=0.270  Sum_probs=88.2

Q ss_pred             CCEEEC-CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH--------------HCCCCCCCC--
Q ss_conf             412311-354444424789999999852267426774345124568899999753--------------035321223--
Q gi|254780709|r  111 PHVILV-VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR--------------TSADFVCSE--  173 (321)
Q Consensus       111 p~vil~-vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~--------------~~v~~~~~~--  173 (321)
                      .+||++ .|==|||||||.+-||.-|.+.|+||+++-+|.|=+..---|-.-.++              -|+.+....  
T Consensus       107 ~~vIAVaSGKGGVGKSTvavNLA~ALA~~G~kVgllDADi~Gpsip~mlG~~~~~~~~~d~~~i~P~~~~gi~~~S~g~l  186 (369)
T PRK11670        107 KNIIAVSSGKGGVGKSSTAVNLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMAHGLATNSIGYL  186 (369)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHCCCCCCCCCCCCCEECCCCCCCEEEEECCCC
T ss_conf             88999985899888999999999999966993789824788876502306654566468896637600058125302202


Q ss_pred             CCCCCHHHHH-----HHHHHHHH----HCCCEEEEECC-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH
Q ss_conf             5866124542-----28999965----14875998654-33321157789999899876302223430112310233522
Q gi|254780709|r  174 IGSDAAALAY-----EAFKQAQA----KKVDVLIIDTA-GRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ  243 (321)
Q Consensus       174 ~~~dp~~v~~-----~a~~~a~~----~~~DvvliDTA-GR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq  243 (321)
                      ...+.+.+++     .++..+..    .++|++|||+. |=.  |..|     .+.+.+.      .+..++|   +|.|
T Consensus       187 ~~~~~~~iwRgp~~~~al~q~l~~~~wg~lDyLIID~PPGtg--Di~L-----tl~q~v~------~~gavvV---TTPq  250 (369)
T PRK11670        187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTG--DIQL-----TLAQNIP------VTGAVVV---TTPQ  250 (369)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC--HHHH-----HHHHHCC------CCEEEEE---CCCC
T ss_conf             376640222130167999998777433788889983799875--2777-----8876457------6607996---2773


Q ss_pred             -----HHHHHHHHHHH-HCCCCEEEEEC-------CCCCCC---HHHHHHHHHHHCCCEEEEEC
Q ss_conf             -----57789998764-35897699965-------457870---69999999997698899975
Q gi|254780709|r  244 -----NALRQVEMFHA-VAGTTGLIMTK-------MDGTAR---GGGLIPIVVTHKIPVYFLGV  291 (321)
Q Consensus       244 -----~~~~~a~~F~~-~~~~~g~I~TK-------lD~ta~---~G~~ls~~~~~~~Pi~fig~  291 (321)
                           |+.+....|++ .+++-|+|-.-       +.....   -|..=-++..+++|  |+|.
T Consensus       251 ~~Al~Da~k~i~m~~k~~vpilGiVeNMs~~~c~~c~~~~~iFg~gg~e~~a~~~~v~--lLG~  312 (369)
T PRK11670        251 DIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAEKLAEKYHTQ--LLGQ  312 (369)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCEECCCCCHHHHHHHHCCC--EEEE
T ss_conf             7699999999999985488850688636333368999710013666099999983998--7997


No 72 
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]
Probab=98.14  E-value=4.3e-05  Score=56.04  Aligned_cols=134  Identities=21%  Similarity=0.223  Sum_probs=89.9

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-----CCCCCC-----CCCHHH
Q ss_conf             1231135444442478999999985226742677434512456889999975303532-----122358-----661245
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-----VCSEIG-----SDAAAL  181 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-----~~~~~~-----~dp~~v  181 (321)
                      .|+.++|++|+||||-+-+.-...-. +..-.++.++--|.||..=-+-.|+.+|.++     |.....     .-...+
T Consensus        66 ~vvii~getGsGKTTqlP~~lle~g~-~~~g~I~~tQPRRlAArsvA~RvAeel~~~~G~~VGY~iRfe~~~s~~Trik~  144 (845)
T COG1643          66 QVVIIVGETGSGKTTQLPQFLLEEGL-GIAGKIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKV  144 (845)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHC-CCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCCCCCEEEE
T ss_conf             78998679988758788999996001-66875996584389999999999998389867654379996226787714689


Q ss_pred             HHHHHHH------HHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             4228999------965148759986543-332115778999989987630222343011231023352257789998764
Q gi|254780709|r  182 AYEAFKQ------AQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA  254 (321)
Q Consensus       182 ~~~a~~~------a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~  254 (321)
                      +-+++--      ....+|++||||-|- |+-+-.-+|.=|+++....      .|+..++|++||.  |+-+-.+.|.+
T Consensus       145 mTdGiLlrei~~D~~Ls~ys~vIiDEaHERSl~tDilLgllk~~~~~r------r~DLKiIimSATl--d~~rfs~~f~~  216 (845)
T COG1643         145 MTDGILLREIQNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARR------RDDLKLIIMSATL--DAERFSAYFGN  216 (845)
T ss_pred             ECCHHHHHHHHHCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHHHHC------CCCCEEEEEECCC--CHHHHHHHCCC
T ss_conf             514799999843802045877997013355688899999999998646------8870599972535--88999976289


No 73 
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129   Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK  resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=98.14  E-value=1.9e-05  Score=58.61  Aligned_cols=143  Identities=25%  Similarity=0.350  Sum_probs=90.5

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---CCHHHH--H--HHHHHH------HHHCCCCCCCCC
Q ss_conf             667412311354444424789999999852267426774345---124568--8--999997------530353212235
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT---FRSAAI--D--QLKIWA------DRTSADFVCSEI  174 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt---fR~aA~--e--QL~~~a------~~~~v~~~~~~~  174 (321)
                      .++-++|=+.|++|+||.|-+-||...+.++|++|++||.|-   |==||+  |  -++-++      .-=||-+=+.+.
T Consensus        35 ~GnA~~vG~TG~PGaGKSTl~~~l~~~lrRrG~~VaViAvDP~SPfTGGsiLGDr~Rm~~~asrkqlW~dPg~FIRs~pt  114 (333)
T TIGR00750        35 TGNAHVVGITGVPGAGKSTLVEKLIMELRRRGLKVAVIAVDPSSPFTGGSILGDRLRMQRLASRKQLWTDPGVFIRSMPT  114 (333)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCC
T ss_conf             27907876646888857779999989997659768999887975975514545688775442222332289856767766


Q ss_pred             CCC---CHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             866---12454228999965148759986543332115778999989987630222343011231023352257789998
Q gi|254780709|r  175 GSD---AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM  251 (321)
Q Consensus       175 ~~d---p~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~  251 (321)
                      ...   .+.-+.+.+.-+-+-|||+|||-|-|=-|-..       .|.+++.       .-+++.| +-+|    ++.+.
T Consensus       115 rG~lGGls~at~~~~~lldA~G~DVI~vETVGVGQSEV-------di~~~aD-------T~v~v~~-pg~G----Dd~Q~  175 (333)
T TIGR00750       115 RGSLGGLSKATRELVKLLDAAGYDVILVETVGVGQSEV-------DIINMAD-------TFVVVTI-PGTG----DDVQG  175 (333)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHH-------HHHHHHC-------EEEEEEC-CCCC----CHHHH
T ss_conf             67525787999999999986389879998415752487-------8873415-------0589854-8878----34666


Q ss_pred             HHHHC-CC-CEEEEECCCCC
Q ss_conf             76435-89-76999654578
Q gi|254780709|r  252 FHAVA-GT-TGLIMTKMDGT  269 (321)
Q Consensus       252 F~~~~-~~-~g~I~TKlD~t  269 (321)
                      .+.-+ .+ |=+++-|-|..
T Consensus       176 iKaG~mEiaDI~VVNKaD~~  195 (333)
T TIGR00750       176 IKAGVMEIADIYVVNKADGE  195 (333)
T ss_pred             HHHHHHEEEEEEEEECCCCC
T ss_conf             65443023248788168876


No 74 
>CHL00175 minD septum-site determining protein; Validated
Probab=98.12  E-value=7.7e-05  Score=54.27  Aligned_cols=163  Identities=17%  Similarity=0.240  Sum_probs=84.4

Q ss_pred             CEEEC-CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH--------------HHHHHH---HHH-------HHC
Q ss_conf             12311-35444442478999999985226742677434512456--------------889999---975-------303
Q gi|254780709|r  112 HVILV-VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA--------------IDQLKI---WAD-------RTS  166 (321)
Q Consensus       112 ~vil~-vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA--------------~eQL~~---~a~-------~~~  166 (321)
                      .||.+ .|==|||||||++-||.-+.+.|+||+++-+|..-+..              .+.+..   +.+       .-+
T Consensus        14 kiIaV~s~KGGVGKTT~a~NLa~aLA~~G~kVlliD~D~~~~n~~~~lg~~~~~~~~~~~vl~g~~~l~~~~i~~~~~~~   93 (279)
T CHL00175         14 RIIVITSGKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLDLLLGLENRVVYTAMEVLEGECRLDQALIRDKRWPN   93 (279)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCEEECCCCCC
T ss_conf             69999748998448999999999999789988999578999987532686666667476640787664301342577787


Q ss_pred             CCCCCCCCCCCCHHHHHHH----HHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC-
Q ss_conf             5321223586612454228----99996514875998654333211577899998998763022234301123102335-
Q gi|254780709|r  167 ADFVCSEIGSDAAALAYEA----FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT-  241 (321)
Q Consensus       167 v~~~~~~~~~dp~~v~~~a----~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~-  241 (321)
                      +.+........-..+..+.    ++....++||+|||||..=+  +...+.-|.            +-+++++|...-. 
T Consensus        94 l~ll~~~~~~~~~~~~~~~~~~ll~~l~~~~yDyiiID~ppgl--~~~~~~al~------------aad~viIvttpe~~  159 (279)
T CHL00175         94 LSLLPISKNRQRYNVTRKNMNMLVDSLKERNYDYILIDCPAGI--DVGFINAIA------------PAKEAIVVTTPEIT  159 (279)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCC--CHHHHHHHH------------HCCEEEEECCCCHH
T ss_conf             7999789705445741999999999997279999998189988--899999999------------78906997899789


Q ss_pred             -CHHHHHHHHHHHH-HCCCCEEEEECCCCCCCH-H---HHHHHHHHHCCCEEEEE
Q ss_conf             -2257789998764-358976999654578706-9---99999999769889997
Q gi|254780709|r  242 -GQNALRQVEMFHA-VAGTTGLIMTKMDGTARG-G---GLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       242 -gq~~~~~a~~F~~-~~~~~g~I~TKlD~ta~~-G---~~ls~~~~~~~Pi~fig  290 (321)
                       =.|+...++.|+. .++.-++|+.+....... .   ..-.+....+.|  |+|
T Consensus       160 al~da~~~i~~~~~~~~~~~~lvvN~~~~~~~~~~~~~~~~~~~~~l~v~--~lg  212 (279)
T CHL00175        160 AIRDADRVAGLLEANGIYNIKLLVNRVRPDMIKANDMMSVRDVQEMLGIP--LLG  212 (279)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHCCC--EEE
T ss_conf             99999999999997599862135335645543545534499999971993--465


No 75 
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=98.11  E-value=3.9e-06  Score=63.33  Aligned_cols=50  Identities=38%  Similarity=0.567  Sum_probs=44.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      ++.+.|..||||||+++-||.++.++|++|+++-                                              
T Consensus         1 ~i~~~~~kGvGKTT~a~~La~~la~~g~~Vl~vD----------------------------------------------   34 (99)
T cd01983           1 VIVVTGKGGVGKTTLAANLAAALAKRGKRVLLID----------------------------------------------   34 (99)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC----------------------------------------------
T ss_conf             9898589977689999999999998899699986----------------------------------------------


Q ss_pred             CCCEEEEECCCCCCCHHH
Q ss_conf             487599865433321157
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSI  210 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~  210 (321)
                        |+|+|||+|.......
T Consensus        35 --d~iiiD~~~~~~~~~~   50 (99)
T cd01983          35 --DYVLIDTPPGLGLLVL   50 (99)
T ss_pred             --CCEEECCCCCCCHHHH
T ss_conf             --7178858998884689


No 76 
>pfam00009 GTP_EFTU Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains.
Probab=98.11  E-value=5.2e-05  Score=55.48  Aligned_cols=155  Identities=23%  Similarity=0.225  Sum_probs=80.2

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      ..|.++|..++||||-+-.|-.....-......-...+..--..||-      -|+.+       +...+.      +..
T Consensus         4 rnVaivG~~n~GKSTL~n~Ll~~~~~i~~~~~~~~~~~~d~~~~E~~------rgiTi-------~~~~~~------~~~   64 (185)
T pfam00009         4 RNIGIIGHVDHGKTTLTDALLYVTGAIDKRGEVKQEGELDRLKEERE------RGITI-------KIAAVS------FET   64 (185)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHH------CCEEE-------EEEEEE------EEE
T ss_conf             78999938994499999999715487654643100333365588885------78269-------876999------960


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH-----HHHHHHHHHHCCCCEEEEECC
Q ss_conf             148759986543332115778999989987630222343011231023352257-----789998764358976999654
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA-----LRQVEMFHAVAGTTGLIMTKM  266 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~-----~~~a~~F~~~~~~~g~I~TKl  266 (321)
                      +++.+.+|||+|  |.  ..+.++.   +.+.     ..+-.+||+||..|-..     +..++..  .+| -=++++|+
T Consensus        65 ~~~~i~~iDtPG--h~--~f~~~~~---~~l~-----~aD~~vlVvda~~G~~~qt~~~~~~~~~~--~~p-~iv~vNKi  129 (185)
T pfam00009        65 KKRHINIIDTPG--HV--DFTKEMI---RGAA-----QADGAILVVDAVEGVMPQTREHLLLAKQL--GVP-IIVFINKM  129 (185)
T ss_pred             CCCEEEEEECCC--CC--CHHHHHH---HHHH-----HCCCCEEEEECCCCCCCCCHHHHHHHHHH--CCC-EEEEEECC
T ss_conf             893689998998--71--4399999---9986-----46564299986768532309999999982--898-79999773


Q ss_pred             CCC--CCHHHHHHHHH-H---------HCCCEEEEEC--CCCCCCCCC
Q ss_conf             578--70699999999-9---------7698899975--898132555
Q gi|254780709|r  267 DGT--ARGGGLIPIVV-T---------HKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       267 D~t--a~~G~~ls~~~-~---------~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      |--  ++.-..+.-.. .         -..|+.+++.  |+++++|..
T Consensus       130 D~v~~~~~~~~~~e~~~~ll~~~~~~~~~~pivpiSA~~G~gv~~Ll~  177 (185)
T pfam00009       130 DRVDDAELDEVVEEISRELLEKYGFGGETIPVIPGSALTGEGIDTLLE  177 (185)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             277767699999999999888732489988699967899979899999


No 77 
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=98.10  E-value=1.9e-05  Score=58.55  Aligned_cols=137  Identities=26%  Similarity=0.300  Sum_probs=74.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH----------HHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
Q ss_conf             135444442478999999985226742677434512456----------8899999753035321223586612454228
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA----------IDQLKIWADRTSADFVCSEIGSDAAALAYEA  185 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA----------~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a  185 (321)
                      ++||.||||||-++.+..++...|++|.+|-.|.   |+          +..+-++.+.+.= .--++.|+    +. -+
T Consensus         1 ViGpaGSGKTT~~~~l~~~l~~~~r~~~vvNLDP---A~e~~pY~~~iDIrd~i~~~dvM~~-~~LGPNGa----li-~~   71 (234)
T pfam03029         1 VVGGAGSGKTTFVGALSEILPLRGRSVYVVNLDP---AAENLPYEADIDIRELITVADVMED-YGLGPNGA----LT-VA   71 (234)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---CCCCCCCCCCCCHHHHCCHHHHHHH-CCCCCCHH----HH-HH
T ss_conf             9898989889999999999997799759997898---6658999877717874679999998-29897389----99-99


Q ss_pred             HHHHH----------HHCCCEEEEECCCC--CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH----
Q ss_conf             99996----------51487599865433--321157789999899876302223430112310233522577899----
Q gi|254780709|r  186 FKQAQ----------AKKVDVLIIDTAGR--LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV----  249 (321)
Q Consensus       186 ~~~a~----------~~~~DvvliDTAGR--~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a----  249 (321)
                      ++++.          ....|.+|+||.|-  +-+..+-|.   .+.+.+.+   . +--..+++|+.-=++...-.    
T Consensus        72 me~l~~~~d~l~~~l~~~~~y~l~DtPGQiElf~~~~~~~---~i~~~L~~---~-~~~~v~l~D~~~~~d~~~fis~~L  144 (234)
T pfam03029        72 MDFGRITLDWLLEELEYEDDYYLFDTPGQIELFTHWDSLA---RGVEALEA---S-RLGAVYLVDTRRLTDPIDFFSGLL  144 (234)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEEECCHHHH---HHHHHHHC---C-CEEEEEEECHHHHCCHHHHHHHHH
T ss_conf             9999999999999852557769983698357654002699---99999712---8-738999842577468888999999


Q ss_pred             ----HHHHHHCCC-CEEEEECCCCCC
Q ss_conf             ----987643589-769996545787
Q gi|254780709|r  250 ----EMFHAVAGT-TGLIMTKMDGTA  270 (321)
Q Consensus       250 ----~~F~~~~~~-~g~I~TKlD~ta  270 (321)
                          -.++  .++ .=.++||.|--+
T Consensus       145 ~a~s~m~~--l~lP~vnvlsK~Dl~~  168 (234)
T pfam03029       145 YALSIMLR--LGLPFVVALNKFDLLS  168 (234)
T ss_pred             HHHHHHHH--CCCCEEEEECCHHCCC
T ss_conf             99999997--4899443100041354


No 78 
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated
Probab=98.09  E-value=0.00012  Score=52.92  Aligned_cols=163  Identities=25%  Similarity=0.290  Sum_probs=93.2

Q ss_pred             EEECCCCC-CCCHHHHHHHHHHHHHHCCCCEEEEEC--CCCCHHHHH-HHHHHHHHHCCCCCCCCCCCCCHHH----HHH
Q ss_conf             23113544-444247899999998522674267743--451245688-9999975303532122358661245----422
Q gi|254780709|r  113 VILVVGVN-GVGKTTVIGKLSKKMSDAGLKVMLAAG--DTFRSAAID-QLKIWADRTSADFVCSEIGSDAAAL----AYE  184 (321)
Q Consensus       113 vil~vG~n-G~GKTTT~aKLA~~~~~~g~kV~lva~--DtfR~aA~e-QL~~~a~~~~v~~~~~~~~~dp~~v----~~~  184 (321)
                      -+|+.|+. |+||||-++=|++.|+++|.+|.---|  | |    ++ ++.  +...|.|.+.    -||.-.    +..
T Consensus         5 ~lmI~gt~S~~GKT~vt~gL~r~l~~rG~~VapFK~GPD-y----Idp~~~--~~a~g~~~~n----LD~~l~~~~~v~~   73 (451)
T PRK01077          5 ALVIAAPASGSGKTTVTLGLMRALRRRGLRVQPFKVGPD-Y----IDPAFH--AAATGRPSRN----LDSWMMGEDLVRA   73 (451)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC-C----CCHHHH--HHHHCCCCCC----CCHHHCCHHHHHH
T ss_conf             799986899997899999999999968794575357857-6----298999--9997897535----8834489999999


Q ss_pred             HHHHHHHHCCCEEEEECC-----CCCCCHH-HHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC-CHHHHHHHHHHH---H
Q ss_conf             899996514875998654-----3332115-77899998998763022234301123102335-225778999876---4
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTA-----GRLHNNS-ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT-GQNALRQVEMFH---A  254 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTA-----GR~~~~~-~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~-gq~~~~~a~~F~---~  254 (321)
                      ...+ ..+++|+++|--+     |...+.. .--.|+.++   ++     .|  ++||+|+.- ++....++..|.   .
T Consensus        74 ~~~~-~~~~~D~~viEG~mGlyDG~~~~~~~gS~aeiA~~---l~-----~P--ViLViD~~~~~~s~aa~v~G~~~~~~  142 (451)
T PRK01077         74 LFAR-AAGGADIAVIEGVMGLFDGAGGDPDKGSTADIARL---LG-----AP--VVLVVDASGMAQSAAALVLGFARFDP  142 (451)
T ss_pred             HHHH-HCCCCCEEEEEECHHCCCCCCCCCCCCCHHHHHHH---HC-----CC--EEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             9997-54668889985010113454567777778999987---09-----98--89998466208999999999997597


Q ss_pred             HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCC
Q ss_conf             358976999654578706999999999769889997589813255
Q gi|254780709|r  255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE  299 (321)
Q Consensus       255 ~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~  299 (321)
                      .+.+-|+|+.|+-++...-.+=.....+++|  .+|+=-+.+++.
T Consensus       143 ~~~I~GvIlNk~~g~~h~~ll~~~ie~~gvp--vlG~lP~~~~l~  185 (451)
T PRK01077        143 DLNIAGVILNRVGSERHYQLLREALEELGLP--VLGALPRDAALA  185 (451)
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHCCCC--EEEEECCCCCCC
T ss_conf             7877489962478766899999999863995--798615763345


No 79 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=98.08  E-value=0.00016  Score=52.07  Aligned_cols=147  Identities=20%  Similarity=0.323  Sum_probs=78.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .|.++|...|||+|-+-.|.      |.++..++ +  .|+             ..       .||..-.+      ...
T Consensus         5 ~V~ivG~pN~GKSsL~N~L~------~~~~a~vs-~--~~g-------------tT-------r~~~~~~~------~~~   49 (168)
T cd04163           5 FVAIVGRPNVGKSTLLNALV------GQKISIVS-P--KPQ-------------TT-------RNRIRGIY------TDD   49 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHH------CCCEEEEC-C--CCC-------------EE-------ECCCEEEE------EEC
T ss_conf             89999999999999999995------89703323-8--898-------------26-------34423689------849


Q ss_pred             CCCEEEEECCCCCCCHHHHHHH-H-HHHHHHHHCCCCCCCCEEEEECCCCCCHHH--HHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             4875998654333211577899-9-989987630222343011231023352257--78999876435897699965457
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAG-I-GKMIRVLKRLDPHAPHSVLQVLDATTGQNA--LRQVEMFHAVAGTTGLIMTKMDG  268 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~E-L-~ki~~v~~~~~~~~p~~~~lVlda~~gq~~--~~~a~~F~~~~~~~g~I~TKlD~  268 (321)
                      ++.++++||+|=. ...+.+.+ + +...+.++     ..+-+++|+|++-+-..  ....+...+.-.--=++++|.|-
T Consensus        50 ~~~~~l~DtpG~~-~~~~~~~~~~~~~~~~~l~-----~~D~il~vvD~~~~~~~~d~~i~~~l~~~~~~~iivlNK~Dl  123 (168)
T cd04163          50 DAQIIFVDTPGIH-KPKKKLGERMVKAAWSALK-----DVDLVLFVVDASEPIGEGDEFILELLKKSKTPVILVLNKIDL  123 (168)
T ss_pred             CEEEEEEECCCCC-CCHHHHHHHHHHHHHHHHH-----CCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECEEE
T ss_conf             9789999589866-5145677899999998651-----365589999789898667799999999809985999978870


Q ss_pred             CCCHHHHHHHHHH-----HCCCEEEEEC--CCCCCCCCC
Q ss_conf             8706999999999-----7698899975--898132555
Q gi|254780709|r  269 TARGGGLIPIVVT-----HKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       269 ta~~G~~ls~~~~-----~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      -.+-.........     ...|+.+|+.  |+.+++|..
T Consensus       124 ~~~~~~~~~~~~~~~~~~~~~~vi~iSA~~g~Gid~L~~  162 (168)
T cd04163         124 VKDKEDLLPLLEKLKELGPFAEIFPISALKGENVDELLE  162 (168)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
T ss_conf             478778999999999618999689997778969999999


No 80 
>PRK09401 reverse gyrase; Reviewed
Probab=98.08  E-value=1.7e-05  Score=58.81  Aligned_cols=57  Identities=18%  Similarity=0.292  Sum_probs=48.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCE-EEEECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             231135444442478999999985226742-677434512456889999975303532
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKV-MLAAGDTFRSAAIDQLKIWADRTSADF  169 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV-~lva~DtfR~aA~eQL~~~a~~~~v~~  169 (321)
                      -+.++-|||+||||.-.=+|.|+.++|+|+ ++..+-+-=.-+++-|+.||++.|+++
T Consensus        95 SFaiiAPTG~GKTtfgl~~sly~a~kgkks~~i~PT~~Lv~Q~~~kl~~~~~~~~~~~  152 (1176)
T PRK09401         95 SFAIIAPTGVGKTTFGLVMALYLAKKGKKSYIIFPTRLLVEQVVEKLRKLAEKVGVKV  152 (1176)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             7489888998888999999999986598399996888999999999999999709984


No 81 
>PRK13230 nitrogenase reductase-like protein; Reviewed
Probab=98.08  E-value=6.5e-05  Score=54.81  Aligned_cols=38  Identities=32%  Similarity=0.504  Sum_probs=35.0

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             23113544444247899999998522674267743451
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF  150 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf  150 (321)
                      .|.+-|==|||||||+.-||+-+...|+||++|-||..
T Consensus         3 ~ia~yGKGGVGKTTTavNLAaALA~~GkkVLlID~DPq   40 (292)
T PRK13230          3 QIAFYGKGGIGKSTTVCNLAAALSKSGKKVIVVGCDPK   40 (292)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             79991799857898999999999987995999776797


No 82 
>PHA02519 plasmid partition protein SopA; Reviewed
Probab=98.06  E-value=9.2e-06  Score=60.74  Aligned_cols=42  Identities=29%  Similarity=0.400  Sum_probs=33.5

Q ss_pred             CCCCCEEECCCC-CCCCHHHHHHHHHHHHHHCCCCEEEEEC-CC
Q ss_conf             667412311354-4444247899999998522674267743-45
Q gi|254780709|r  108 SHRPHVILVVGV-NGVGKTTVIGKLSKKMSDAGLKVMLAAG-DT  149 (321)
Q Consensus       108 ~~~p~vil~vG~-nG~GKTTT~aKLA~~~~~~g~kV~lva~-Dt  149 (321)
                      ...|.||.++-- =|||||||+.-||+++..+|++|++|-| |.
T Consensus       103 ~~~~~VIAVaN~KGGVGKTTTavnLA~~LAl~G~RVL~ID~lDP  146 (387)
T PHA02519        103 DKNPVVLAVMSHKGGVYKTSSAVHTAQWLALQGHRVLLIEGNDP  146 (387)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             88752899861688776999999999999976996899959885


No 83 
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]
Probab=98.05  E-value=3.9e-05  Score=56.33  Aligned_cols=120  Identities=23%  Similarity=0.271  Sum_probs=74.8

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-----CCHHHH------------HHHHHHHHHHCCCCC
Q ss_conf             667412311354444424789999999852267426774345-----124568------------899999753035321
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-----FRSAAI------------DQLKIWADRTSADFV  170 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-----fR~aA~------------eQL~~~a~~~~v~~~  170 (321)
                      ...+.++|++|+..|||||-++=||+.+..+|++|.++-+|.     +=||.+            +||.-+.-.    |+
T Consensus        70 ~~~~~~vmvvG~vDSGKSTLt~~LaN~~l~rG~~v~iiDaDvGQ~ei~pPg~ISL~~~~s~~~~L~~l~~~~~~----Fv  145 (398)
T COG1341          70 AGKVGVVMVVGPVDSGKSTLTTYLANKLLARGRKVAIIDADVGQSEIGPPGFISLAFPESPVISLSELEPFTLY----FV  145 (398)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEECCCCCCCCHHHCCCCCEE----EE
T ss_conf             06873899989867678899999998876447418999689997666797467741256777777775865227----98


Q ss_pred             CC-CCCCCCHHH---HHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             22-358661245---4228999965148759986543332115778999989987630222343011231023
Q gi|254780709|r  171 CS-EIGSDAAAL---AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA  239 (321)
Q Consensus       171 ~~-~~~~dp~~v---~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda  239 (321)
                      ++ .+...|...   +-...+.|+.. .|++||||.|--+- ..=|+=+..+.++++      |+.++.+-++
T Consensus       146 G~isP~~~~~~~i~~v~rL~~~a~~~-~~~ilIdT~GWi~G-~~g~elk~~li~~ik------P~~Ii~l~~~  210 (398)
T COG1341         146 GSISPQGFPGRYIAGVARLVDLAKKE-ADFILIDTDGWIKG-WGGLELKRALIDAIK------PDLIIALERA  210 (398)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHCC-CCEEEECCCCCEEC-CHHHHHHHHHHHHCC------CCEEEEECCC
T ss_conf             51477777689999999999986516-87799969984307-427899999886509------7789993144


No 84 
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=98.03  E-value=0.00026  Score=50.61  Aligned_cols=171  Identities=18%  Similarity=0.195  Sum_probs=90.3

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             99999878520100121000136674123113544444247899999998522674267743451245688999997530
Q gi|254780709|r   86 YDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRT  165 (321)
Q Consensus        86 ~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~  165 (321)
                      ..|.+.+.+.|......  ......|.-|.+||=..|||.|    |.+.+..+.+.+.                  ++.-
T Consensus       188 ~dLld~i~~~l~~~~~~--~~~~~~~~rIAIvGrPNvGKSt----L~N~llg~~r~iv------------------s~~~  243 (474)
T PRK03003        188 ADLLDAVLAALPEVPEV--GSAVGGPRRVALVGKPNVGKSS----LLNKLAGEERSVV------------------HDVA  243 (474)
T ss_pred             HHHHHHHHHHCCCCCCC--CCCCCCCCEEEEECCCCCCHHH----HHHHHHCCCCEEE------------------CCCC
T ss_conf             99999999748776644--3345776279998089987889----9999858975674------------------5899


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC-----CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             353212235866124542289999651487599865433-----321157789999899876302223430112310233
Q gi|254780709|r  166 SADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGR-----LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT  240 (321)
Q Consensus       166 ~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR-----~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~  240 (321)
                      |.       -.||..+.+      ..++..+.||||||=     ...+.+.+.    ..+.++...  ..+-++||+||+
T Consensus       244 GT-------TRDsI~~~~------~~~~~~~~liDTAGiRrk~kv~~~iE~~s----~~rtl~aI~--~advvilviDa~  304 (474)
T PRK03003        244 GT-------TVDPVDSLI------ELGGKVWRFVDTAGLRRKVGQASGHEFYA----SLRTHAAID--AAEVAVVLIDAS  304 (474)
T ss_pred             CC-------CCCCEEEEE------EECCEEEEEEECCCCCCCCCCCCCHHHHH----HHHHHHHHH--HCCEEEEEEECC
T ss_conf             85-------154405899------99998999998987663553343145899----999999987--335579998546


Q ss_pred             CCHH--HHHHHHHHHHHCCCCEEEEECCCCCCCHH-HHH------HHHHHHCCCEEEEEC--CCCCCCCC
Q ss_conf             5225--77899987643589769996545787069-999------999997698899975--89813255
Q gi|254780709|r  241 TGQN--ALRQVEMFHAVAGTTGLIMTKMDGTARGG-GLI------PIVVTHKIPVYFLGV--GEGINDLE  299 (321)
Q Consensus       241 ~gq~--~~~~a~~F~~~~~~~g~I~TKlD~ta~~G-~~l------s~~~~~~~Pi~fig~--Ge~i~Dl~  299 (321)
                      -|-.  -..+|..-.+.=---=+++.|.|--.+-. ..+      ........||.||+.  |++++.|-
T Consensus       305 egit~QD~~Ia~~v~~~gk~~IivvNKwDLv~~~~~~~~~~~i~~~l~~~~~~piv~ISA~~g~~i~kL~  374 (474)
T PRK03003        305 EPLTEQDQRVLSMVIEAGRALVLAFNKWDLVDEDRRYYLEREIDRELAQVRWAPRVNISAKTGRAVQKLV  374 (474)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHH
T ss_conf             5874999999999998099579999714416867899999999864554489856999810487989999


No 85 
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=98.02  E-value=5.9e-05  Score=55.11  Aligned_cols=167  Identities=20%  Similarity=0.296  Sum_probs=113.8

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC---CHHHHHHH
Q ss_conf             674123113544444247899999998522674267743451245688999997530353212235866---12454228
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD---AAALAYEA  185 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~d---p~~v~~~a  185 (321)
                      ....++-+++-.||||||.+-+....++.+ .++++|.+|..-.--.|.++.    .|+|++..+.|.-   -|..+.+|
T Consensus       102 ~gv~~lNl~sSPGSGKTtLLe~ti~~L~~~-~~~aVIeGD~~T~~DA~RI~~----~Gv~avQInTG~~CHLDA~MV~~a  176 (290)
T PRK10463        102 RKQLVLNLVSSPGSGKTTLLTETLMRLKDS-VPCAVIEGDQQTVNDAARIRA----TGTPAIQVNTGKGCHLDAQMIADA  176 (290)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHCC-CCEEEEEECCCCHHHHHHHHH----CCCCEEEECCCCCCCCCHHHHHHH
T ss_conf             791899930699878899999999987336-757999604235667999997----699589954799767599999999


Q ss_pred             HHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-HHHHHHHHHHHCCCCEEEEE
Q ss_conf             99996514875998654333211577899998998763022234301123102335225-77899987643589769996
Q gi|254780709|r  186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-ALRQVEMFHAVAGTTGLIMT  264 (321)
Q Consensus       186 ~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-~~~~a~~F~~~~~~~g~I~T  264 (321)
                      +......+.|+++|.-.|-|-               +.....---+....|++.+-|-| -+.--.+|..+   +-+|+|
T Consensus       177 l~~l~l~~~dllfIENVGNLV---------------CPA~FDLGE~~kVvvlSVtEGeDKPlKYP~mF~~a---d~vlin  238 (290)
T PRK10463        177 APRLPLDDNGILFIENVGNLV---------------CPASFDLGEKHKVAVLSVTEGEDKPLKYPHMFAAA---SLMLLN  238 (290)
T ss_pred             HHHCCCCCCCEEEEECCCCCC---------------CCCCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHC---CEEEEE
T ss_conf             984898779899981278843---------------55120367761799997068888644476676425---789986


Q ss_pred             CCCCCCCHH----HHHHHHHH--HCCCEEEEE--CCCCCCCC
Q ss_conf             545787069----99999999--769889997--58981325
Q gi|254780709|r  265 KMDGTARGG----GLIPIVVT--HKIPVYFLG--VGEGINDL  298 (321)
Q Consensus       265 KlD~ta~~G----~~ls~~~~--~~~Pi~fig--~Ge~i~Dl  298 (321)
                      |.|--...+    ....-+..  -++||..++  +||.++..
T Consensus       239 KiDLlp~~dFD~~~~~~~~~~vNp~~~v~~vSa~tGeGld~W  280 (290)
T PRK10463        239 KVDLLPYLNFDVEKCIACAREVNPEIEIILISATSGEGMDQW  280 (290)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHH
T ss_conf             565122028899999999998698985899756888789999


No 86 
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=98.02  E-value=0.0004  Score=49.28  Aligned_cols=147  Identities=21%  Similarity=0.314  Sum_probs=78.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      +|.+||.+-|||+|-+-+|+.      .++.+.                    +.|+-+    .||..   ..+.  ...
T Consensus        43 ~VaivG~PNvGKSTLlN~L~g------~~~~v~--------------------~~~~tT----~d~~~---~~i~--~~~   87 (204)
T cd01878          43 TVALVGYTNAGKSTLFNALTG------ADVYAE--------------------DQLFAT----LDPTT---RRLR--LPD   87 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHHC------CCCEEE--------------------CCCCCC----CCCEE---EEEE--ECC
T ss_conf             799988999989999999948------996341--------------------567764----57636---6899--569


Q ss_pred             CCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--HHHHHHHHHHHHCCCC----EEEEEC
Q ss_conf             48759986543-3321157789999899876302223430112310233522--5778999876435897----699965
Q gi|254780709|r  193 KVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--NALRQVEMFHAVAGTT----GLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--~~~~~a~~F~~~~~~~----g~I~TK  265 (321)
                      ++.++++|||| -.+...++.+..+.-.+.+.     ..+-+++|+|++...  ...++...+-+.++..    =++++|
T Consensus        88 ~~~i~l~DT~G~i~~~p~~lie~~~~tle~i~-----~AD~il~vvD~s~~~~~~~~~~~~~~l~~l~~~~k~~i~V~NK  162 (204)
T cd01878          88 GREVLLTDTVGFIRDLPHQLVEAFRSTLEEVA-----EADLLLHVVDASDPDYEEQIETVEKVLKELGAEDIPMILVLNK  162 (204)
T ss_pred             CCEEEEEECCCCCCCCCHHHHHHHHHHHHHHH-----HCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             97799983686446783789999999999997-----3989999997998536677999999999806555760788867


Q ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             45787069999999997698899975--898132555
Q gi|254780709|r  266 MDGTARGGGLIPIVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       266 lD~ta~~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      .|--... ...........|+.+|+.  |+.++.|..
T Consensus       163 iDl~~~~-~~~~~~~~~~~~~i~ISA~~g~Gid~L~~  198 (204)
T cd01878         163 IDLLDDE-ELEERLEAGRPDAVFISAKTGEGLDELLE  198 (204)
T ss_pred             CCCCCCH-HHHHHHHHCCCCEEEEECCCCCCHHHHHH
T ss_conf             0479957-58999970899879998868949999999


No 87 
>KOG0922 consensus
Probab=98.01  E-value=7.9e-05  Score=54.19  Aligned_cols=159  Identities=23%  Similarity=0.333  Sum_probs=103.4

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHH--HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-----CCCC--CCCCC-HHH
Q ss_conf             12311354444424789999999--85226742677434512456889999975303532-----1223--58661-245
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKK--MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-----VCSE--IGSDA-AAL  181 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~--~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-----~~~~--~~~dp-~~v  181 (321)
                      .++.++|-||+||||-+-.+-+.  |..+|+   ++.+---|+||+-=-+-.|+-++..+     |...  ..+.+ -.|
T Consensus        67 qvlIviGeTGsGKSTQipQyL~eaG~~~~g~---I~~TQPRRVAavslA~RVAeE~~~~lG~~VGY~IRFed~ts~~Tri  143 (674)
T KOG0922          67 QVLIVIGETGSGKSTQIPQYLAEAGFASSGK---IACTQPRRVAAVSLAKRVAEEMGCQLGEEVGYTIRFEDSTSKDTRI  143 (674)
T ss_pred             CEEEEECCCCCCCCCCHHHHHHHCCCCCCCC---EEEECCCHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCEEE
T ss_conf             7799984898985332769998626566882---7750671677888999999985897676222699845667873369


Q ss_pred             HH--HH------HHHHHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             42--28------999965148759986543-3321157789999899876302223430112310233522577899987
Q gi|254780709|r  182 AY--EA------FKQAQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF  252 (321)
Q Consensus       182 ~~--~a------~~~a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F  252 (321)
                      .|  |+      +..-...+|++||+|-|- |+-+-.-|+.=|+++.+-       .|+..+.|++||.  |+..-.+.|
T Consensus       144 kymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~~-------R~~LklIimSATl--da~kfS~yF  214 (674)
T KOG0922         144 KYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILKK-------RPDLKLIIMSATL--DAEKFSEYF  214 (674)
T ss_pred             EEECCHHHHHHHHCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHHHC-------CCCCEEEEEEEEE--CHHHHHHHH
T ss_conf             9961359999885087645444899832231015788999999998732-------7783699992352--489999986


Q ss_pred             HHH--CCCCE------EEEECCCCCCCHHHHHHHHHHH
Q ss_conf             643--58976------9996545787069999999997
Q gi|254780709|r  253 HAV--AGTTG------LIMTKMDGTARGGGLIPIVVTH  282 (321)
Q Consensus       253 ~~~--~~~~g------~I~TKlD~ta~~G~~ls~~~~~  282 (321)
                      +++  +.+-|      +..||-..+....+++-.+.+.
T Consensus       215 ~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~I  252 (674)
T KOG0922         215 NNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQI  252 (674)
T ss_pred             CCCCEEEECCCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             47956766688775568863688504678999999998


No 88 
>KOG1805 consensus
Probab=97.97  E-value=3.7e-05  Score=56.53  Aligned_cols=52  Identities=33%  Similarity=0.470  Sum_probs=37.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             3113544444247899999998522674267743451245688999997530353
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~  168 (321)
                      .|+.|..|.|||||+.-|-..+...|+||+|.+   |---||+-+=.=-...+++
T Consensus       688 ~LI~GMPGTGKTTtI~~LIkiL~~~gkkVLLts---yThsAVDNILiKL~~~~i~  739 (1100)
T KOG1805         688 ALILGMPGTGKTTTISLLIKILVALGKKVLLTS---YTHSAVDNILIKLKGFGIY  739 (1100)
T ss_pred             HEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEE---HHHHHHHHHHHHHHCCCCC
T ss_conf             203269989812259999999997388189985---0567889999987506711


No 89 
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]
Probab=97.97  E-value=0.00014  Score=52.49  Aligned_cols=170  Identities=24%  Similarity=0.307  Sum_probs=100.0

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHH----------------HHHHHH-----------
Q ss_conf             23113544444247899999998522-67426774345124568899----------------999753-----------
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDA-GLKVMLAAGDTFRSAAIDQL----------------KIWADR-----------  164 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~-g~kV~lva~DtfR~aA~eQL----------------~~~a~~-----------  164 (321)
                      +|.++|=-||||||-+|=||+++..+ |++|+.|-||- -++=.+||                +..-..           
T Consensus         2 kIaI~GKGG~GKTtiaalll~~l~~~~~~~VLvVDaDp-d~nL~~~LGve~~~~~lg~~~e~~~k~~~a~~~~~~~~~fk   80 (255)
T COG3640           2 KIAITGKGGVGKTTIAALLLKRLLSKGGYNVLVVDADP-DSNLPEALGVEEPMKYLGGKRELLKKRTGAEPGGPPGEMFK   80 (255)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCC-CCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             69996599765899999999999864895499994899-99907762999987553008999999861478999553001


Q ss_pred             ------------------HCCCCCCCCC--C---CCCH-HHHHHHHHHHHHHCCCEEEEECC-CCCCCHHHHHHHHHHHH
Q ss_conf             ------------------0353212235--8---6612-45422899996514875998654-33321157789999899
Q gi|254780709|r  165 ------------------TSADFVCSEI--G---SDAA-ALAYEAFKQAQAKKVDVLIIDTA-GRLHNNSILMAGIGKMI  219 (321)
Q Consensus       165 ------------------~~v~~~~~~~--~---~dp~-~v~~~a~~~a~~~~~DvvliDTA-GR~~~~~~lm~EL~ki~  219 (321)
                                        +.+-+.+...  |   .=|+ +++++=+.+...+.+|+|++||- |==|.-           
T Consensus        81 ~~~~~~di~~e~~~e~~~~~LLvmGkie~~GeGC~Cp~~allR~~l~~l~~~~~e~VivDtEAGiEHfg-----------  149 (255)
T COG3640          81 ENPLVSDLPDEYLVENGDIDLLVMGKIEEGGEGCACPMNALLRRLLRHLILNRYEVVIVDTEAGIEHFG-----------  149 (255)
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHC-----------
T ss_conf             375433516988500688007995255679974316278999999999751667489996334566656-----------


Q ss_pred             HHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHC---CC--CEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             8763022234301123102335225778999876435---89--769996545787069999999997698899975898
Q gi|254780709|r  220 RVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVA---GT--TGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG  294 (321)
Q Consensus       220 ~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~---~~--~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~  294 (321)
                          +-.....|-++.|+|.+.  .++..|+.+.+-.   ++  =.+|+.|.|+.  ...+.-.....++|  ++|    
T Consensus       150 ----Rg~~~~vD~vivVvDpS~--~sl~taeri~~L~~elg~k~i~~V~NKv~e~--e~~~~~~~~~~~~~--vlg----  215 (255)
T COG3640         150 ----RGTIEGVDLVIVVVDPSY--KSLRTAERIKELAEELGIKRIFVVLNKVDEE--EELLRELAEELGLE--VLG----  215 (255)
T ss_pred             ----CCCCCCCCEEEEEECCCH--HHHHHHHHHHHHHHHHCCCEEEEEEEECCCH--HHHHHHHHHCCCCE--EEE----
T ss_conf             ----563257877999957877--8888899999999871875499999503411--57777653227974--899----


Q ss_pred             CCCCCCCCHHHHHHHHC
Q ss_conf             13255577899999872
Q gi|254780709|r  295 INDLEPFVAKDFSAVIT  311 (321)
Q Consensus       295 i~Dl~~f~~~~~~~~ll  311 (321)
                         .-|+||+-+---+-
T Consensus       216 ---~iP~d~~v~~~dl~  229 (255)
T COG3640         216 ---VIPYDPEVVEADLK  229 (255)
T ss_pred             ---ECCCCHHHHHCCCC
T ss_conf             ---71698788742256


No 90 
>TIGR03348 VI_IcmF type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems.
Probab=97.93  E-value=3.8e-05  Score=56.45  Aligned_cols=133  Identities=25%  Similarity=0.292  Sum_probs=69.9

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      -+|++|+.|+||||-+       .+.|.+--+.          |++....- -|   +++..+.|    ++-      .+
T Consensus       113 WYlviG~~gsGKTt~l-------~~Sgl~fPl~----------~~~~~~~~-~g---~ggt~~cd----wwf------t~  161 (1169)
T TIGR03348       113 WYLVIGPPGSGKTTLL-------QNSGLKFPLA----------ERLGAAAL-RG---VGGTRNCD----WWF------TD  161 (1169)
T ss_pred             EEEEECCCCCCHHHHH-------HHCCCCCCCC----------CCCCHHHC-CC---CCCCCCCC----EEE------EC
T ss_conf             5899789998668999-------8379988774----------10011221-58---89985557----165------27


Q ss_pred             CCCEEEEECCCCCCCHHHH----HHHHHHHHHHHHCCCCCCCC-EEEEECCC--CCCHHH--H-HH-------HHHHHHH
Q ss_conf             4875998654333211577----89999899876302223430-11231023--352257--7-89-------9987643
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSIL----MAGIGKMIRVLKRLDPHAPH-SVLQVLDA--TTGQNA--L-RQ-------VEMFHAV  255 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~l----m~EL~ki~~v~~~~~~~~p~-~~~lVlda--~~gq~~--~-~~-------a~~F~~~  255 (321)
                        +-|+||||||.-+..+.    -.|=...-+.+++.-+..|. =++|++|.  +.+++.  . ..       ....++.
T Consensus       162 --~AVliDtaGry~~Q~~~~~~d~~~W~~fL~lLkk~R~r~piNGvil~is~~~Ll~~~~~~~~~~a~~lr~Rl~El~~~  239 (1169)
T TIGR03348       162 --EAVLIDTAGRYTTQDSDPEEDAAAWLGFLGLLRKHRRRQPLNGVVVTVSLADLLTADPAERKAHARAIRQRLQELREQ  239 (1169)
T ss_pred             --CEEEEECCCCEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             --879994797602688864001899999999998648989987689997899974789999999999999999999998


Q ss_pred             CCCC---EEEEECCCCCCCHHHHHHH
Q ss_conf             5897---6999654578706999999
Q gi|254780709|r  256 AGTT---GLIMTKMDGTARGGGLIPI  278 (321)
Q Consensus       256 ~~~~---g~I~TKlD~ta~~G~~ls~  278 (321)
                      +++.   -++|||+|-=+=...-++.
T Consensus       240 lg~~~PVYv~~TK~Dll~GF~eff~~  265 (1169)
T TIGR03348       240 LGARFPVYLVLTKADLLAGFEEFFAD  265 (1169)
T ss_pred             HCCCCCEEEEEECHHHHHCHHHHHHH
T ss_conf             29987759986640123069999985


No 91 
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=97.91  E-value=5.9e-05  Score=55.11  Aligned_cols=94  Identities=15%  Similarity=0.141  Sum_probs=60.5

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH---------HHCC-CCCCCC---CCC
Q ss_conf             741231135444442478999999985226742677434512456889999975---------3035-321223---586
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD---------RTSA-DFVCSE---IGS  176 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~---------~~~v-~~~~~~---~~~  176 (321)
                      +.+++++.|+.|+||||-+..+++...++|.+++.++++.-+..-+.|.+.++-         ++.+ |+....   ...
T Consensus        31 ~g~~~li~G~~G~GKt~~~~~f~~~~~~~g~~~~~~~~ee~~~~~~~~~~~~g~dl~~~~~~G~L~i~~~~~~~~~~~~~  110 (241)
T PRK06067         31 FGSLILIEGENDTGKSVLSQQFVWGALNQGKRGLAITTENTSKSYLKQMESLKLDISDFFIWGYLRIFPLNTEGFEWNSE  110 (241)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHCCCCHHHHHHCCCCEEEECCCCCCCCCHH
T ss_conf             99089998079988799999999999867982999994289999999999839985999866970578324111342155


Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             612454228999965148759986543
Q gi|254780709|r  177 DAAALAYEAFKQAQAKKVDVLIIDTAG  203 (321)
Q Consensus       177 dp~~v~~~a~~~a~~~~~DvvliDTAG  203 (321)
                      ++..+...-++..+..+.++|+||+--
T Consensus       111 ~~~~ll~~l~~~v~~~~~~~vVIDSls  137 (241)
T PRK06067        111 LAEKLLDLIIEFIKRRREEVIIIDSLT  137 (241)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEECCHH
T ss_conf             689999999999997199899992801


No 92 
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=97.91  E-value=0.00052  Score=48.45  Aligned_cols=56  Identities=20%  Similarity=0.149  Sum_probs=44.1

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHH-HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             7412311354444424789999999-85226742677434512456889999975303532
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKK-MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF  169 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~-~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~  169 (321)
                      +.+++++.|++|+||||-+..+++. +.++|.+|+.++.+.-    .+|+...+..+|.++
T Consensus        18 ~gs~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis~ee~----~~~l~~~~~~~g~~~   74 (231)
T pfam06745        18 EGRVVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVTLEEP----PEDLRENAKSFGWDL   74 (231)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCC----HHHHHHHHHHCCCCH
T ss_conf             996999985897259999999999999865896899981379----999999999829985


No 93 
>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=97.90  E-value=7.3e-05  Score=54.42  Aligned_cols=103  Identities=20%  Similarity=0.239  Sum_probs=62.4

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC--CCCCCCCCCCHHHHHH
Q ss_conf             36674123113544444247899999998522674267743451245688999997530353--2122358661245422
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD--FVCSEIGSDAAALAYE  184 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~--~~~~~~~~dp~~v~~~  184 (321)
                      ...+|..|++.|.+|+||||.+..+...+.  +..+..|..|.||.--    -.|.+...-+  -.......+...++..
T Consensus         8 ~~~~Pkai~laG~pGAGKS~~~~~~~~~~~--~~~~v~In~D~~r~~~----P~y~~l~~~~~~~~~~~~~~~a~~~~~~   81 (191)
T pfam06414         8 PQERPVAVLLGGQPGAGKTELARALLEELG--GGNVVRIDPDELRTYH----PDYDELQKADPKDASELTQPDASRWVEK   81 (191)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHCC--CCCCEEECCHHHHHHH----HHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             876987999957998888999999987537--8993897135878877----7478655407677899989999999999


Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCHH-HHHHHHH
Q ss_conf             8999965148759986543332115-7789999
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGRLHNNS-ILMAGIG  216 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR~~~~~-~lm~EL~  216 (321)
                      .++++..++++ ++|||.+|..... .+++.|+
T Consensus        82 ~~~~a~~~r~n-~iiegT~~~~~~~~~~~~~lk  113 (191)
T pfam06414        82 LIDYAIERGYN-IILEGTLRSPDVARKLARKLK  113 (191)
T ss_pred             HHHHHHHCCCC-EEEECCCCCHHHHHHHHHHHH
T ss_conf             99999975999-898577789799999999999


No 94 
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]
Probab=97.90  E-value=0.00055  Score=48.31  Aligned_cols=164  Identities=21%  Similarity=0.257  Sum_probs=87.8

Q ss_pred             CCEEECC-CCCCCCHHHHHHHH-HHHHHHCCCCEEEEECCCCCHHH----------------------HHHHHHHHHHHC
Q ss_conf             4123113-54444424789999-99985226742677434512456----------------------889999975303
Q gi|254780709|r  111 PHVILVV-GVNGVGKTTVIGKL-SKKMSDAGLKVMLAAGDTFRSAA----------------------IDQLKIWADRTS  166 (321)
Q Consensus       111 p~vil~v-G~nG~GKTTT~aKL-A~~~~~~g~kV~lva~DtfR~aA----------------------~eQL~~~a~~~~  166 (321)
                      .++|.++ |==|+||||+.|-| |..++..|++|+++-+|..-+.=                      ++.....+.+-|
T Consensus         2 ~~~Iav~SgKGGvGKTtitanlga~~~~~~~k~V~~iDaD~g~~nL~~~~g~~~~~~~l~dvL~~~~~~~Di~~~~~~~g   81 (262)
T COG0455           2 TKVIAVVSGKGGVGKTTITANLGAALAALGGKVVLLIDADLGLGNLSLLLGVESKPTTLHDVLAGEASIEDIIYETPQDG   81 (262)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHCCCCCCCCHHHHHHCCCCHHHEEEECCCCC
T ss_conf             78999984588756898998699999964897699996588887288885888885509999707787768023157689


Q ss_pred             CCCCCCCCCCCCHHHHH------HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             53212235866124542------289999651487599865433321157789999899876302223430112310233
Q gi|254780709|r  167 ADFVCSEIGSDAAALAY------EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT  240 (321)
Q Consensus       167 v~~~~~~~~~dp~~v~~------~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~  240 (321)
                      +.+++...+  +.....      ..+-..-.+.+|+|+|||.+=++.+.  +.-+.           . -++.++|..-.
T Consensus        82 l~vipg~~~--~~~~~~~~~~~~~~~~~~l~~~~D~iliD~~aGl~~~~--~~~~~-----------~-sd~~viVt~pe  145 (262)
T COG0455          82 LYVLPGGSG--LEDLAKLDPEDLEDVIKELEELYDYILIDTGAGLSRDT--LSFIL-----------S-SDELVIVTTPE  145 (262)
T ss_pred             EEEEECCCC--HHHHHHCCHHHHHHHHHHHHHCCCEEEEECCCCCCHHH--HHHHH-----------H-CCCEEEEECCC
T ss_conf             899607887--68886169888999999987529999996899966888--99987-----------3-68179992798


Q ss_pred             C--CHHHHHHHHH-HHHHCCCCE--EEEECCCCCCCH----HHHHHHHHHHCCCEEEEEC
Q ss_conf             5--2257789998-764358976--999654578706----9999999997698899975
Q gi|254780709|r  241 T--GQNALRQVEM-FHAVAGTTG--LIMTKMDGTARG----GGLIPIVVTHKIPVYFLGV  291 (321)
Q Consensus       241 ~--gq~~~~~a~~-F~~~~~~~g--~I~TKlD~ta~~----G~~ls~~~~~~~Pi~fig~  291 (321)
                      .  =+|+....+. .+...+..+  +|+.+.++...+    -.+...+.+.- |+.|++.
T Consensus       146 ~~si~~A~~~i~~~~~~~~~~~~~~vV~N~v~~~~e~~~~~~~~~~~~~~~~-~~~~i~~  204 (262)
T COG0455         146 PTSITDAYKTIKILSKLGLDLLGRRVVLNRVRSTKEGVDVAALLIQVVKQVP-VLQVIPF  204 (262)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEECC
T ss_conf             5208999999999997387643315899703666654678999999997077-4347156


No 95 
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=97.89  E-value=0.00017  Score=51.91  Aligned_cols=147  Identities=18%  Similarity=0.187  Sum_probs=89.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-------C---CCCCCCC------
Q ss_conf             41231135444442478999999985226742677434512456889999975303-------5---3212235------
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTS-------A---DFVCSEI------  174 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~-------v---~~~~~~~------  174 (321)
                      -.++++.|++|+|||+-+...++...+.|.+|+.|+.|--+.-=.++.+.++-...       .   +.+....      
T Consensus        23 g~~~lI~G~pGsGKT~f~~qfl~~~~~~ge~vlyvs~~e~~~~l~~~~~~~g~d~~~~~~~g~l~i~d~~~~~~~~~~~~  102 (260)
T COG0467          23 GSVVLITGPPGTGKTIFALQFLYEGAREGEPVLYVSTEESPEELLENARSFGWDLEVYIEKGKLAILDAFLSEKGLVSIV  102 (260)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHHCCCCHHHHHHCCEEEEEECCCCCCCCCCCC
T ss_conf             97899993899868999999999776269858999920698999999988099778975444068763121112542010


Q ss_pred             ---CCCCHHHHHHHHHHHH-HHCCCEEEEECCC--CCCCHHHHH--HHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH
Q ss_conf             ---8661245422899996-5148759986543--332115778--9999899876302223430112310233522577
Q gi|254780709|r  175 ---GSDAAALAYEAFKQAQ-AKKVDVLIIDTAG--RLHNNSILM--AGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL  246 (321)
Q Consensus       175 ---~~dp~~v~~~a~~~a~-~~~~DvvliDTAG--R~~~~~~lm--~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~  246 (321)
                         ..+..++. +.+..+. ..+.+.++||...  .+..+...+  .++..+.+..++    .....+++.++..++...
T Consensus       103 ~~~~~~~~~l~-~~I~~~~~~~~~~~~ViDsi~~~~~~~~~~~~~r~~~~~l~~~~~~----~~~t~~~~~~~~~~~~~~  177 (260)
T COG0467         103 VGDPLDLEELL-DRIREIVEKEGADRVVIDSITELTLYLNDPALVRRILLLLKRFLKK----LGVTSLLTTEAPVEERGE  177 (260)
T ss_pred             CCCCCCHHHHH-HHHHHHHHHCCCCEEEEECCHHHHHHCCCHHHHHHHHHHHHHHHHH----CCEEEEEEECCCCCCCCC
T ss_conf             46652289999-9999999862898899966307766527825789999999987650----684899997443346665


Q ss_pred             H-HHHHHHHHCCCCEEEEECCC
Q ss_conf             8-99987643589769996545
Q gi|254780709|r  247 R-QVEMFHAVAGTTGLIMTKMD  267 (321)
Q Consensus       247 ~-~a~~F~~~~~~~g~I~TKlD  267 (321)
                      . ..+    + -++|+|-=...
T Consensus       178 ~~~~~----~-~vdgvI~l~~~  194 (260)
T COG0467         178 SGVEE----Y-IVDGVIRLDLK  194 (260)
T ss_pred             CCCEE----E-EEEEEEEEEEE
T ss_conf             66142----1-68999999777


No 96 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.89  E-value=9.5e-05  Score=53.64  Aligned_cols=79  Identities=23%  Similarity=0.282  Sum_probs=55.3

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      .+.-+++.||.|+||||.+.-+|+.+...+..+..+.|..+.............                 ..+......
T Consensus        18 ~~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~~~   80 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHF-----------------LVRLLFELA   80 (151)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEHHHCCHHHHHHHHHHHH-----------------HHHHHHHHH
T ss_conf             998089989999886599999999712137982785477704677775760577-----------------889899999


Q ss_pred             HHHCCCEEEEECCCCC
Q ss_conf             6514875998654333
Q gi|254780709|r  190 QAKKVDVLIIDTAGRL  205 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~  205 (321)
                      ...+..+++||=+.++
T Consensus        81 ~~~~~~vl~iDEi~~l   96 (151)
T cd00009          81 EKAKPGVLFIDEIDSL   96 (151)
T ss_pred             HHCCCCEEEEECHHHC
T ss_conf             9769986982016655


No 97 
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=97.85  E-value=0.00042  Score=49.10  Aligned_cols=93  Identities=23%  Similarity=0.312  Sum_probs=55.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH-HHHHHHCCCC-CCCCCCCCCHHHHHHHHHH
Q ss_conf             4123113544444247899999998522674267743451245688999-9975303532-1223586612454228999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLK-IWADRTSADF-VCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~-~~a~~~~v~~-~~~~~~~dp~~v~~~a~~~  188 (321)
                      -.++++.|+.|+||||-+--+|....+.|.+|+.+++-..-+.-+.|+. .-.+++.-.+ +..+..-+....+-+-++.
T Consensus        19 G~it~i~G~pG~GKStl~lq~a~~~~~~g~~v~YidtE~~~~er~~qi~~~~~~~~~~~i~v~~~~~~~~~~~~i~~~~~   98 (218)
T cd01394          19 GTVTQVYGPPGTGKTNIAIQLAVETAGQGKKVAYIDTEGLSSERFRQIAGDRPERAASSIIVFEPMDFNEQGRAIQETET   98 (218)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHH
T ss_conf             87999989999849999999999986369869999665567699999987536665305146267876889999999997


Q ss_pred             HHHHCCCEEEEECCC
Q ss_conf             965148759986543
Q gi|254780709|r  189 AQAKKVDVLIIDTAG  203 (321)
Q Consensus       189 a~~~~~DvvliDTAG  203 (321)
                      ...++.++|+||..-
T Consensus        99 ~~~~~~~lvViDSi~  113 (218)
T cd01394          99 FADEKVDLVVVDSAT  113 (218)
T ss_pred             HHHCCCCEEEEECCH
T ss_conf             641477299991404


No 98 
>PRK12374 putative dithiobiotin synthetase; Provisional
Probab=97.85  E-value=0.0028  Score=43.35  Aligned_cols=180  Identities=17%  Similarity=0.159  Sum_probs=102.6

Q ss_pred             EECCCC-CCCCHHHHHHHHHHHHHHCCCCEEE-----EE----CCCCCHHHHHHHHHHHHHHC-----CCCCCCCCCC-C
Q ss_conf             311354-4444247899999998522674267-----74----34512456889999975303-----5321223586-6
Q gi|254780709|r  114 ILVVGV-NGVGKTTVIGKLSKKMSDAGLKVML-----AA----GDTFRSAAIDQLKIWADRTS-----ADFVCSEIGS-D  177 (321)
Q Consensus       114 il~vG~-nG~GKTTT~aKLA~~~~~~g~kV~l-----va----~DtfR~aA~eQL~~~a~~~~-----v~~~~~~~~~-d  177 (321)
                      +++.|- +++|||...+-|++.++++|++|.-     -.    .|.+|.+-...|+..+...-     -|+...+... .
T Consensus         5 ~FITGTDTdVGKT~vsaaL~~~l~~~G~~v~~~KPVasG~~~~~~g~~~~Da~~l~~~~~~~~~~~~vnP~~~~~~~aa~   84 (231)
T PRK12374          5 FFITGTDTSVGKTVVSRALLQALASQGKSVAGYKPVAKGSKETPEGLRNKDALVLQSVSTIELPYEAVNPIALSEEESSV   84 (231)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCH
T ss_conf             79987899953999999999999978994888856883996689987247899999873789998871976688665774


Q ss_pred             C--HHH----HHHHHHHHHHHCCCEEEEECCCCC--CCH-HHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--HHH
Q ss_conf             1--245----422899996514875998654333--211-57789999899876302223430112310233522--577
Q gi|254780709|r  178 A--AAL----AYEAFKQAQAKKVDVLIIDTAGRL--HNN-SILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--NAL  246 (321)
Q Consensus       178 p--~~v----~~~a~~~a~~~~~DvvliDTAGR~--~~~-~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--~~~  246 (321)
                      .  ..+    ..+++... .+.+|+++|--||=.  +.+ ...|..+.   +.++       --++||.+.-.|-  .++
T Consensus        85 ~~~~~id~~~i~~~~~~l-~~~~d~vlVEGAGG~~vPl~~~~~~~Dl~---~~l~-------lPVILV~~~~LG~INHtL  153 (231)
T PRK12374         85 AHSCPINYTLISNGLANL-TDKVDHVVVEGTGGWRSLMNDLRPLSEWV---VQEQ-------LPVLMVVGIQEGCINHAL  153 (231)
T ss_pred             HHCCCCCHHHHHHHHHHH-HHHCCEEEEECCCCEEECCCCCCHHHHHH---HHCC-------CCEEEEECCCCCHHHHHH
T ss_conf             454857899999999998-85579799977986213047651499999---9839-------999999889868488999


Q ss_pred             HHHHH-HHHHCCCCEEEEECCCCCCCH--HHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             89998-764358976999654578706--9999999997698899975898132555778999998
Q gi|254780709|r  247 RQVEM-FHAVAGTTGLIMTKMDGTARG--GGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV  309 (321)
Q Consensus       247 ~~a~~-F~~~~~~~g~I~TKlD~ta~~--G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~  309 (321)
                      =.++. -+.-+++-|+|+.++|.+-..  -.+-.+...++.|  ++|   .+.-|..+++..+.+.
T Consensus       154 LT~eal~~~gl~l~G~I~N~~~p~~~~~~e~i~~L~~~~~~P--~LG---~iP~l~~~~~~~~~~~  214 (231)
T PRK12374        154 LTAQAIANDGLPLIGWVANRINPGLAHYAEIIDVLGKKLPAP--LIG---ELPYLPRAEQRELGQY  214 (231)
T ss_pred             HHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHHHHHHHCCCC--EEE---ECCCCCCCCHHHHHHH
T ss_conf             999999978995799999836797046788999999855999--788---6899999898999975


No 99 
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=97.85  E-value=0.00044  Score=48.96  Aligned_cols=51  Identities=29%  Similarity=0.387  Sum_probs=42.3

Q ss_pred             CCCEEE-CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             741231-135444442478999999985226742677434512456889999
Q gi|254780709|r  110 RPHVIL-VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKI  160 (321)
Q Consensus       110 ~p~vil-~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~  160 (321)
                      ..++|+ ..|.-|+||+|+.+-||.-+...|+||+++-||.|.+.--.-|..
T Consensus        56 ~~~~I~V~S~kgGvGKStva~nLA~alA~~G~rVlliDaD~~gps~~~~l~~  107 (265)
T COG0489          56 VKNVIAVTSGKGGVGKSTVAVNLAAALAQLGKRVLLLDADLRGPSIPRMLGL  107 (265)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHCCC
T ss_conf             6618999758998756899999999999639938999674669863554089


No 100
>PRK06526 transposase; Provisional
Probab=97.84  E-value=0.00019  Score=51.51  Aligned_cols=153  Identities=14%  Similarity=0.232  Sum_probs=89.8

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHH----HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             999999999973889899999999999875127899899999----9999878520100121000136674123113544
Q gi|254780709|r   45 VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLY----DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN  120 (321)
Q Consensus        45 ~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~----~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~n  120 (321)
                      ..+|.-..|+++-+...-.+.+...++........+-+++..    .+.......|..    ..+  =....-++|+|++
T Consensus        34 s~~e~L~~Lle~E~~~R~~rr~~rrlk~A~fp~~ktLe~fd~~~~~~l~~~~i~~La~----~~f--i~~~~Nvil~G~~  107 (254)
T PRK06526         34 SHEEFLAACLQREVAARESHGGEGRIRAARFPSRKSLEEFDFDHQRSLKRDTIAHLGT----LDF--VTGKENVVFLGPP  107 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCCCCHHHHHHHHC----CCH--HHCCCCEEEECCC
T ss_conf             9999999999999999999899999997797998898767865678989999999863----717--7658878998999


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             44424789999999852267426774345124568899999753035321223586612454228999965148759986
Q gi|254780709|r  121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIID  200 (321)
Q Consensus       121 G~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliD  200 (321)
                      |+|||--+-=||+..-++|++|..+.++..    +++|+.-          ...++     ..+.+  .+...+|++|||
T Consensus       108 GtGKThLA~Alg~~A~~~G~~v~f~~~~~L----~~~L~~a----------~~~g~-----~~~~~--~~l~~~dLLIiD  166 (254)
T PRK06526        108 GTGKTHLAIGLGIRACQAGHRVLFATAAQW----VARLAAA----------HHAGR-----LQDEL--VKLGRIPLLIVD  166 (254)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEEHHHH----HHHHHHH----------HHCCC-----HHHHH--HHHHCCCEEEEE
T ss_conf             986899999999999986996799877999----9999998----------85580-----99999--985136877650


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             543332115778999989987630222
Q gi|254780709|r  201 TAGRLHNNSILMAGIGKMIRVLKRLDP  227 (321)
Q Consensus       201 TAGR~~~~~~lm~EL~ki~~v~~~~~~  227 (321)
                      --|..+.+..-.+-   +.+++....+
T Consensus       167 e~g~~~~~~~~a~~---lf~li~~Rye  190 (254)
T PRK06526        167 EVGYIPFEAEAANL---FFQLVSSRYE  190 (254)
T ss_pred             CCCCCCCCHHHHHH---HHHHHHHHHC
T ss_conf             21364478899999---9999999974


No 101
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=97.83  E-value=0.00017  Score=51.78  Aligned_cols=95  Identities=24%  Similarity=0.231  Sum_probs=58.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH---HCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             2311354444424789999999852267426774345124568899999753---0353212235866124542289999
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR---TSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~---~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      ++++.|+.|+||||-+.-+|.....+|.+|+.+++.--+.--.++.......   .+.-++......++..-......++
T Consensus         1 ~~li~g~~g~GKttl~~~~~~~~~~~~~~~~~~~~ee~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (165)
T cd01120           1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLIIVFATADDPAAARLLSKAERL   80 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             98999899998999999999998763997999986664489999999862246713079993599976999999999999


Q ss_pred             H-HHCCCEEEEECCCCCCC
Q ss_conf             6-51487599865433321
Q gi|254780709|r  190 Q-AKKVDVLIIDTAGRLHN  207 (321)
Q Consensus       190 ~-~~~~DvvliDTAGR~~~  207 (321)
                      . ..+.++++||..=|+..
T Consensus        81 ~~~~~~vliiiDSit~~~~   99 (165)
T cd01120          81 RERGGDDLIILDELTRLVR   99 (165)
T ss_pred             HHCCCCEEEEEECHHHHHH
T ss_conf             9869977999928899887


No 102
>PRK13236 nitrogenase reductase; Reviewed
Probab=97.81  E-value=0.0013  Score=45.69  Aligned_cols=168  Identities=13%  Similarity=0.131  Sum_probs=100.4

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH------------HHHHHHHHHHH------------
Q ss_conf             674123113544444247899999998522674267743451245------------68899999753------------
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA------------AIDQLKIWADR------------  164 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~a------------A~eQL~~~a~~------------  164 (321)
                      ++...|.+-|=-|.||+||.+-|++-+...|+||++|.||.-.-.            -.+.++.++..            
T Consensus         4 ~~mk~IAiYGKGGIGKSTts~NlsAAlA~~G~rVl~IGCDPK~DSTr~Llgg~~~~tvld~~~e~~~~ed~~ledvv~~G   83 (295)
T PRK13236          4 ENIRQIAFYGKGGIGKSTTSQNTLAAMAEMGQRILIVGCDPKADSTRLMLHSKAQTTVLHLAAERGAVEDLELEEVMLTG   83 (295)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCCCCCCHHHHHHHHCCCCCCCHHHHHHCC
T ss_conf             77618999679843475789999999997799699978898026678763899997188888760984445488874226


Q ss_pred             -HCCCCCCCCCCCCCH--------HHHHHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             -035321223586612--------45422899996-51487599865433321157789999899876302223430112
Q gi|254780709|r  165 -TSADFVCSEIGSDAA--------ALAYEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL  234 (321)
Q Consensus       165 -~~v~~~~~~~~~dp~--------~v~~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~  234 (321)
                       -||.++.. .|-+|.        -.+++-++... .+++|+|+.|..|------=-|-           ......++++
T Consensus        84 ~~Gi~CvEs-GGPePGvGCAGRGIitai~lLee~ga~e~~D~V~yDVLGDVVCGGFAmP-----------ir~g~A~evy  151 (295)
T PRK13236         84 FRGVRCVES-GGPEPGVGCAGRGIITAINFLEENGAYQDLDFVSYDVLGDVVCGGFAMP-----------IREGKAQEIY  151 (295)
T ss_pred             CCCCEEEEC-CCCCCCCCCCCCEEEEHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCC-----------CCCCCCCEEE
T ss_conf             588379878-9999989888862540566798719855699898850577532675465-----------6678764899


Q ss_pred             EECCC--CCCHHHHHH---HHHHHH--HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             31023--352257789---998764--3589769996545787069999999997698899
Q gi|254780709|r  235 QVLDA--TTGQNALRQ---VEMFHA--VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYF  288 (321)
Q Consensus       235 lVlda--~~gq~~~~~---a~~F~~--~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~f  288 (321)
                      +|-++  |.=+.|-++   ++.|.+  .+.+.|+|....+.+..-..+-..+..++.|+..
T Consensus       152 iVtSge~malyAANNI~~~i~~~a~~g~~rlgGiI~N~r~~~~e~~~v~~fa~~~gt~ii~  212 (295)
T PRK13236        152 IVTSGEMMAMYAANNIARGILKYAHTGGVRLGGLICNSRNVDREIELIETLAKRLNTQMIH  212 (295)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             9956818899999999999999974269703589960788874799999999981992699


No 103
>PRK09183 transposase/IS protein; Provisional
Probab=97.81  E-value=0.00029  Score=50.21  Aligned_cols=154  Identities=17%  Similarity=0.176  Sum_probs=84.7

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHH----HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             999999999973889899999999999875127899899999----9999878520100121000136674123113544
Q gi|254780709|r   45 VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLY----DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN  120 (321)
Q Consensus        45 ~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~----~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~n  120 (321)
                      ..++.-..|+++-+...-.+.+...++........+-+++..    .+.+.....|..    ..+  =....-++|+||+
T Consensus        37 s~~e~L~~Ll~~E~~~R~~rr~~r~lk~A~fp~~ktle~fDf~~~~~l~~~~i~~La~----~~f--i~~~~Nvil~G~~  110 (258)
T PRK09183         37 SYMDFLEHLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRS----LSF--IERNENIVLLGPS  110 (258)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCCCCHHHHHHHHC----CCH--HHCCCCEEEECCC
T ss_conf             9999999999999999999999999997799998777555654688623899998825----816--6558867998999


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             44424789999999852267426774345124568899999753035321223586612454228999965148759986
Q gi|254780709|r  121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIID  200 (321)
Q Consensus       121 G~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliD  200 (321)
                      |+|||--+.=||+..-++|++|..+++..    -+++|+.--          ..++     ....+.. ....+|++|||
T Consensus       111 GtGKThLA~Alg~~A~~~G~~v~f~~~~~----L~~~L~~a~----------~~~~-----~~~~l~r-~l~~~dLLIiD  170 (258)
T PRK09183        111 GVGKTHLAIALGYEAVRAGIKVRFTTAAD----LLLQLSTAQ----------RQGR-----YKTTLQR-GVMAPRLLIID  170 (258)
T ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEEEHHH----HHHHHHHHH----------HCCC-----HHHHHHH-HHCCCCEEEEH
T ss_conf             98689999999999998799399978999----999999998----------7685-----9999998-74346514431


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             543332115778999989987630222
Q gi|254780709|r  201 TAGRLHNNSILMAGIGKMIRVLKRLDP  227 (321)
Q Consensus       201 TAGR~~~~~~lm~EL~ki~~v~~~~~~  227 (321)
                      --|-.+.+..-.+   .+.++|....+
T Consensus       171 dlG~~~~~~~~~~---~lfeli~~Rye  194 (258)
T PRK09183        171 EIGYLPFSQEEAN---LFFQVIAKRYE  194 (258)
T ss_pred             HHHCCCCCHHHHH---HHHHHHHHHHC
T ss_conf             3315468888999---99999999857


No 104
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=97.81  E-value=0.00016  Score=52.04  Aligned_cols=94  Identities=21%  Similarity=0.335  Sum_probs=58.2

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      ..|++.||+||||+||+|-+-.|+-++..+..+-=-|        -.+-.-+.-..-+..-+-|.|-.+- .+|+.+|-.
T Consensus       126 GLILVTGpTGSGKSTTlAamId~iN~~~~~HIlTIED--------PIE~vh~skkslI~QREvG~dT~sF-~~aLraALR  196 (353)
T COG2805         126 GLILVTGPTGSGKSTTLAAMIDYINKHKAKHILTIED--------PIEYVHESKKSLINQREVGRDTLSF-ANALRAALR  196 (353)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEECC--------CHHHHHCCHHHHHHHHHHCCCHHHH-HHHHHHHHH
T ss_conf             6699867999967879999999984147751687237--------4686504327666687745427889-999999860


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             148759986543332115778999989987630
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKR  224 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~  224 (321)
                      ++-|||||-          -|+.+..|.-++..
T Consensus       197 eDPDVIlvG----------EmRD~ETi~~ALtA  219 (353)
T COG2805         197 EDPDVILVG----------EMRDLETIRLALTA  219 (353)
T ss_pred             CCCCEEEEE----------CCCCHHHHHHHHHH
T ss_conf             299979982----------13469999999989


No 105
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=97.81  E-value=0.00018  Score=51.73  Aligned_cols=237  Identities=15%  Similarity=0.142  Sum_probs=130.8

Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHHCCC---CCHHHHHHHHHHHHHHHCCCC-CCC----CCCCCCCCCCEEECCCC
Q ss_conf             9999999738898999999999998751278---998999999999878520100-121----00013667412311354
Q gi|254780709|r   48 ELEDLLIRSDIGVAVAQKIVEELLTKRYAKD---VSVQRVLYDVSELIHKMLMPL-SKP----FNWDFSHRPHVILVVGV  119 (321)
Q Consensus        48 eLee~LL~ADVg~~va~~Iie~ik~~~~~~~---i~~~~i~~~l~~~L~~~L~~~-~~~----~~~~~~~~p~vil~vG~  119 (321)
                      =|-..|..+.+.+..|-+|.-.+++....++   ++.+++...+.+.+.+.-.+. ...    -.+.....|-+||+.|.
T Consensus        21 il~rslt~~gi~~~~A~~ia~ei~~~L~~~~~~~i~~~el~~~v~~~l~~~~~~~~a~rY~~~r~~r~~~~pliILigGt  100 (306)
T PRK04220         21 ILARSLTAAGMKPDLAYEIASEIEEELKKEGITKITKEELRRRVYYKLIEKDYEEIAEKYLLWRRIRKSKEPIIILIGGA  100 (306)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEECHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             99999998089888999999999999986577163599999999999998440999999999999853699879998589


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCCC----------CCCC---------H
Q ss_conf             44442478999999985226742677434512456889999975303532-12235----------8661---------2
Q gi|254780709|r  120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSEI----------GSDA---------A  179 (321)
Q Consensus       120 nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~~----------~~dp---------~  179 (321)
                      .|+||+|-...||.++--    .-++++|+-|    |=|+..-..--.|. +.+.+          ..+|         +
T Consensus       101 sGvGKSTlA~~LA~rLgI----~~visTD~IR----EVmR~~~~~el~P~Lh~SSy~Awk~l~~~~~~~~~~I~Gf~~Q~  172 (306)
T PRK04220        101 SGVGTSTIAFELASRLGI----RSVIGTDSIR----EVMRKIISKELLPTLHESSYTAWKSLRRPPWEEPDHILGFERHV  172 (306)
T ss_pred             CCCCHHHHHHHHHHHHCC----CEEECCHHHH----HHHHHCCCCCCCCHHHCCCHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             988789999999997098----8342221699----99985248301751322751310023678778657999999999


Q ss_pred             HHHHHH----HHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             454228----9999651487599865433321157789999899876302223430112310233522577899987643
Q gi|254780709|r  180 ALAYEA----FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV  255 (321)
Q Consensus       180 ~v~~~a----~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~  255 (321)
                      +.+..+    ++.+..++.++||=   | .|....+|.+.-+          ..|.-+.+++-.  . |--..-+.|...
T Consensus       173 ~~V~~gI~aiI~Ra~~eg~slIIE---G-VHlvP~~i~~~~~----------~~~~vi~fll~i--~-dEe~H~~RF~~R  235 (306)
T PRK04220        173 EPVLVGVEAVIERALKEGISVIIE---G-VHIVPGFIKEKYL----------NMPNVFMFVLTL--S-DEETHKARFYAR  235 (306)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEE---E-ECCCHHHHHHHHH----------CCCCEEEEEEEE--C-CHHHHHHHHHHH
T ss_conf             999999999999999729968998---4-3037788777764----------388389999997--8-889999999985


Q ss_pred             CCCCEEEEECCCCCCCH-----------HHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             58976999654578706-----------9999999997698899975898132555778999998728656463
Q gi|254780709|r  256 AGTTGLIMTKMDGTARG-----------GGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGE  318 (321)
Q Consensus       256 ~~~~g~I~TKlD~ta~~-----------G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~~~  318 (321)
                      ...+     +-... ++           --++.-+..+++|+.   ....+|.=...--+.+++++.++.+...
T Consensus       236 a~~~-----~R~~~-rYl~~f~~IR~IQ~yLv~~A~~~~vPiI---~N~~id~tv~~i~~~i~~r~~~~~~~~~  300 (306)
T PRK04220        236 ARVS-----KRPAE-RYLKHFDEIREIQDYIVEKAKEHGVPVI---ENVSIEETVDKILEIITERLSEINEEKG  300 (306)
T ss_pred             CCCC-----CCCHH-HHHHHHHHHHHHHHHHHHHHHHHCCCEE---CCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             0447-----89878-9999799999999999999888099810---6866899999999999999999874368


No 106
>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=97.81  E-value=0.00047  Score=48.77  Aligned_cols=90  Identities=13%  Similarity=0.131  Sum_probs=58.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCC-CCHHH--HHHHH
Q ss_conf             41231135444442478999999985-2267426774345124568899999753035321223586-61245--42289
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGS-DAAAL--AYEAF  186 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~-dp~~v--~~~a~  186 (321)
                      -..+++.|.+|+||||.+--+|..+. +.|++|++++..--+-  .-..|..+...++|+..-..+. +....  +.++.
T Consensus        19 G~l~vi~g~pg~GKS~~~~~~a~~~a~~~g~~Vl~~slEm~~~--~~~~R~~a~~~~v~~~~i~~~~~~~~~~~~~~~~~   96 (186)
T pfam03796        19 GDLIIIAARPSMGKTAFALNIARNAALKQDKPVLFFSLEMSAE--QLAERLLSSESRISSSKLRSGQLSDEDWERLAEAA   96 (186)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHH--HHHHHHHHHHHCCCHHHHHCCCHHHHHHHHHHHHH
T ss_conf             8179999679998799999999999997099668754755299--99999999862676555412512167999999999


Q ss_pred             HHHHHHCCCEEEEECCCC
Q ss_conf             999651487599865433
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGR  204 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR  204 (321)
                      .  +..++.+.+.|+.+-
T Consensus        97 ~--~~~~~~l~i~~~~~~  112 (186)
T pfam03796        97 G--ELSEAPLYIDDTPGL  112 (186)
T ss_pred             H--HHHCCCEEEECCCCC
T ss_conf             9--985398688479999


No 107
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=97.80  E-value=0.00025  Score=50.65  Aligned_cols=162  Identities=21%  Similarity=0.299  Sum_probs=88.7

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             99998785201001210001366741231135444442478999999985226742677434512456889999975303
Q gi|254780709|r   87 DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTS  166 (321)
Q Consensus        87 ~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~  166 (321)
                      .+.+.+.+++........+   .....++++|++-+||.|-.=.|+      |+..++|+                    
T Consensus       195 ~l~~~i~~ll~~~~~g~~l---~~G~~v~i~G~PN~GKSSL~N~L~------~~drAIVS--------------------  245 (445)
T PRK05291        195 ELIAELEKLLASAKQGELL---REGLKVVIAGRPNVGKSSLLNALL------GEERAIVT--------------------  245 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHH---HCCCEEEEECCCCCCHHHHHHHHH------CCCCEEEC--------------------
T ss_conf             9999999999998741786---359869988999876899999985------78746731--------------------


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH
Q ss_conf             5321223586612454228999-965148759986543-33211577899998998763022234301123102335225
Q gi|254780709|r  167 ADFVCSEIGSDAAALAYEAFKQ-AQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN  244 (321)
Q Consensus       167 v~~~~~~~~~dp~~v~~~a~~~-a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~  244 (321)
                           ..+|+     -+|.++. ....++-+.|+|||| |-..|  ..+ -.-|.|..+....  .+-+++|+|++.+.+
T Consensus       246 -----~ipGT-----TRD~ie~~l~l~G~~v~l~DTAGiR~t~d--~IE-~~GI~ra~~~~~~--ADlil~v~D~s~~~~  310 (445)
T PRK05291        246 -----DIAGT-----TRDVIEEHINLDGIPLRLIDTAGIRETED--EVE-KIGIERSRKAIEE--ADLVLLVLDASEPLT  310 (445)
T ss_pred             -----CCCCC-----CCCEEEEEEEECCEEEEEEECCCCCCCCC--HHH-HHHHHHHHHHHHH--CCEEEEEEECCCCCC
T ss_conf             -----89997-----40402236899998999998997665574--588-9999999999983--999999987998887


Q ss_pred             HHHHHHHHHHHC--CCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEE--CCCCCCCCCCCC
Q ss_conf             778999876435--8976999654578706999999999769889997--589813255577
Q gi|254780709|r  245 ALRQVEMFHAVA--GTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLG--VGEGINDLEPFV  302 (321)
Q Consensus       245 ~~~~a~~F~~~~--~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig--~Ge~i~Dl~~f~  302 (321)
                      ..+.. .. +..  .-.=+|++|.|=..+        ...+.++.+|+  +|+.++.|...-
T Consensus       311 ~~~~~-~~-~~~~~~~~i~V~NK~DL~~~--------~~~~~~~i~iSak~g~Gi~~L~~~i  362 (445)
T PRK05291        311 EEDKE-IL-EEFKNKPVIVVLNKADLTGE--------KIDGLPVIRISAKTGEGIDELEEAL  362 (445)
T ss_pred             CCHHH-HH-HHCCCCCEEEEEEHHHCCCC--------CCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             22599-99-85179987999851204665--------3478975999837886999999999


No 108
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=97.78  E-value=0.00019  Score=51.46  Aligned_cols=90  Identities=22%  Similarity=0.205  Sum_probs=61.5

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCC-------CCCCHH--
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235-------866124--
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI-------GSDAAA--  180 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~-------~~dp~~--  180 (321)
                      +-++++++||.|+||||.....++.-.++|.++++++-+--    .+||...++.+|+|+-....       ..+|..  
T Consensus       265 ~GsstLi~Gp~GtGKTtla~qFl~~~a~~GE~~l~~~FeE~----~~~l~~~a~~~G~dl~~~~~~G~l~i~~~~p~~~~  340 (501)
T PRK09302        265 RGSIILVSGATGTGKTLLVSKFAEAACRRGERCLLFAFEES----RAQLVRNATSWGIDLEEMERKGLLKIICARPESTG  340 (501)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECC----HHHHHHHHHHCCCCHHHHHHCCCEEEEEECCCCCC
T ss_conf             89469998899988899999999999865990899999679----99999999973998488874894799983700059


Q ss_pred             ---HHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             ---54228999965148759986543
Q gi|254780709|r  181 ---LAYEAFKQAQAKKVDVLIIDTAG  203 (321)
Q Consensus       181 ---v~~~a~~~a~~~~~DvvliDTAG  203 (321)
                         .+..-.+.-+..+.+.|+||.--
T Consensus       341 ~~e~~~~i~~~v~~~~~~rVvIDsls  366 (501)
T PRK09302        341 LEDHLQIIKREIEEFKPSRVAVDPLS  366 (501)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCHH
T ss_conf             89999999999997299899995806


No 109
>PRK13234 nifH nitrogenase reductase; Reviewed
Probab=97.77  E-value=0.0025  Score=43.64  Aligned_cols=164  Identities=13%  Similarity=0.107  Sum_probs=99.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH-----------H-HHHHHHH--H-----------HH
Q ss_conf             41231135444442478999999985226742677434512456-----------8-8999997--5-----------30
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA-----------I-DQLKIWA--D-----------RT  165 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA-----------~-eQL~~~a--~-----------~~  165 (321)
                      ..-|.+-|=-|.||+||.+-|++-+...|+||++|.||.-.-.-           + +.++.-+  +           --
T Consensus         4 mr~IAiYGKGGIGKSTtssNlsAAlA~~G~rVl~IGCDPK~DSTr~Llgg~~~~Tvld~~~~~~~~ed~~ledvv~~G~~   83 (293)
T PRK13234          4 LRQIAFYGKGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADSTRLILNAKAQDTVLSLAAEAGSVEDLELEDVMKIGYK   83 (293)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCCCCCCHHHHHHHCCCCCCCCHHHHHHCCCC
T ss_conf             75799977984458778999999999779969997489831656876289999708899876498121538789743779


Q ss_pred             CCCCCCCCCCCCCH--------HHHHHHHHHHH-HHCCCEEEEECCCCC---CCHHHHHHHHHHHHHHHHCCCCCCCCEE
Q ss_conf             35321223586612--------45422899996-514875998654333---2115778999989987630222343011
Q gi|254780709|r  166 SADFVCSEIGSDAA--------ALAYEAFKQAQ-AKKVDVLIIDTAGRL---HNNSILMAGIGKMIRVLKRLDPHAPHSV  233 (321)
Q Consensus       166 ~v~~~~~~~~~dp~--------~v~~~a~~~a~-~~~~DvvliDTAGR~---~~~~~lm~EL~ki~~v~~~~~~~~p~~~  233 (321)
                      ||.++.. .|-+|.        ..+++-++... .+++|+|+.|..|--   -.-..+              .....+++
T Consensus        84 gI~CVEs-GGPePGvGCAGRGIitai~~Le~lga~ed~D~V~yDVLGDVVCGGFAmPi--------------r~g~A~ev  148 (293)
T PRK13234         84 GIKCVES-GGPEPGVGCAGRGVITSINFLEENGAYDDVDYVSYDVLGDVVCGGFAMPI--------------RENKAQEI  148 (293)
T ss_pred             CEEEEEC-CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCC--------------CCCCCCEE
T ss_conf             8489768-99899888777131467888877187657999999567766514755665--------------45887689


Q ss_pred             EEECCC--CCCHHHHHHH---HHHHH--HCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             231023--3522577899---98764--35897699965457870699999999976988999
Q gi|254780709|r  234 LQVLDA--TTGQNALRQV---EMFHA--VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFL  289 (321)
Q Consensus       234 ~lVlda--~~gq~~~~~a---~~F~~--~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fi  289 (321)
                      ++|-++  |.=+.|-+++   +.|.+  .+.+.|+|....+....--.+=..+.+++.|+...
T Consensus       149 yIVtSge~mslyAANnI~~~i~~~~~~g~~rlgGlI~N~r~~~~e~~~v~~fa~~~gt~ii~~  211 (293)
T PRK13234        149 YIVMSGEMMALYAANNIAKGILKYANSGGVRLGGLICNERQTDRELELAEALAKRLGSKLIHF  211 (293)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCEEEE
T ss_conf             999467187999999999999998632696246899717898537999999999849937997


No 110
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=97.77  E-value=0.00014  Score=52.51  Aligned_cols=96  Identities=23%  Similarity=0.307  Sum_probs=57.9

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             67412311354444424789999999852267426774345124568899999753035321223586612454228999
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~  188 (321)
                      .=++.+||.||-|+||||++                              |++|..+|++ -...........+ .++. 
T Consensus        34 ri~HAYLF~GpRGtGKTS~A------------------------------RIfAKaLNC~-~~~~~PCn~C~~C-~~i~-   80 (363)
T TIGR02397        34 RIAHAYLFSGPRGTGKTSIA------------------------------RIFAKALNCQ-GPDGEPCNECESC-KEIN-   80 (363)
T ss_pred             CCCCEEEECCCCCCCHHHHH------------------------------HHHHHHHCCC-CCCCCCCCCCCHH-HHHH-
T ss_conf             96623450285997635589------------------------------9999986588-7877877775022-7765-


Q ss_pred             HHHHCCCEEEEECCCCCCCHHHHHHHHHHH-------------------------HHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             965148759986543332115778999989-------------------------98763022234301123102335
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKM-------------------------IRVLKRLDPHAPHSVLQVLDATT  241 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~~~~~lm~EL~ki-------------------------~~v~~~~~~~~p~~~~lVlda~~  241 (321)
                       ..+..||+=||=|-+  |..+-|+||.+=                         .+++=|..++.|.+|.|++ |||
T Consensus        81 -~g~~~DviEiDAASN--~gVD~IR~l~e~v~y~P~~~kYKvYIIDEVHMLS~~AFNALLKTLEEPP~hV~FIl-ATT  154 (363)
T TIGR02397        81 -SGSSLDVIEIDAASN--NGVDDIRELRENVKYAPSKGKYKVYIIDEVHMLSKSAFNALLKTLEEPPEHVVFIL-ATT  154 (363)
T ss_pred             -CCCCCCEEEECCCCC--CCHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEE-ECC
T ss_conf             -289866688648656--87889999987303687554433588732302865689998765227987628887-348


No 111
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=97.76  E-value=0.00037  Score=49.46  Aligned_cols=95  Identities=18%  Similarity=0.184  Sum_probs=67.9

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH----------CCCCCCCCCC-CCC
Q ss_conf             74123113544444247899999998522674267743451245688999997530----------3532122358-661
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRT----------SADFVCSEIG-SDA  178 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~----------~v~~~~~~~~-~dp  178 (321)
                      +.+.+++.|-+|+|||+-+..+++-+.++|.+|..+++.--+-.=++|.+.++--+          =+|++..-.+ .+-
T Consensus        23 ~gs~~li~G~~GtGKsi~~~~~~~~~l~~g~~~~yis~e~t~~~~i~qm~s~g~di~~~~~~G~l~~i~~~~~~~~~~~~  102 (230)
T PRK08533         23 FGSIILIEGDESTGKSILSQRLAYGFLQNGYSVSYVSSQLTTTEFIKQMMSLGYDINKKLISGKLLYIPVYPLLSGNSEK  102 (230)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHCCCCCHHHHHCCCEEEEECCCCCCCHHHH
T ss_conf             98489998689987899999999999878986999994389999999999869981799757967999613433540457


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             24542289999651487599865433
Q gi|254780709|r  179 AALAYEAFKQAQAKKVDVLIIDTAGR  204 (321)
Q Consensus       179 ~~v~~~a~~~a~~~~~DvvliDTAGR  204 (321)
                      .....+-+...+..+.|+|+|||..-
T Consensus       103 ~~~L~~ll~~~~~~~~dvIIIDSlS~  128 (230)
T PRK08533        103 RDFLDKLMNTRRFYEKDVVIIDSLSS  128 (230)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCHH
T ss_conf             89999997326643798999905318


No 112
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222   This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterised, is about 800 amino acids long. Related characterised eukaryotic proteins are RNA helicases associated with pre-mRNA processing.; GO: 0005524 ATP binding, 0008026 ATP-dependent helicase activity.
Probab=97.76  E-value=0.0025  Score=43.63  Aligned_cols=205  Identities=19%  Similarity=0.297  Sum_probs=131.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCH--H--HHHHHHHHHHHCCCCHHHHHHHHHHHHHH-------HHCCCCCHHH
Q ss_conf             99999999999999999998605677899--9--99999999997388989999999999987-------5127899899
Q gi|254780709|r   15 RKLTKGFASTSLKLKEGITDIISSRRLDD--G--VREELEDLLIRSDIGVAVAQKIVEELLTK-------RYAKDVSVQR   83 (321)
Q Consensus        15 ~kLk~gL~kt~~~L~~~l~~l~~~~~lde--~--~leeLee~LL~ADVg~~va~~Iie~ik~~-------~~~~~i~~~~   83 (321)
                      +.|-.-+-.=+..|+..|.++.+.++-|.  .  .|.++.+.          +++=++++..+       ...++++...
T Consensus         3 ~~Ld~~m~~Dr~~lRRrL~~l~k~~~~d~~~aPh~L~~~~~~----------~~~a~~~V~~R~~~~P~i~YPd~LPvS~   72 (1320)
T TIGR01967         3 EDLDHVMLRDRHRLRRRLHKLRKEKDQDRKEAPHALAKLREK----------IDAACDKVEAREQAVPEIRYPDNLPVSA   72 (1320)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH----------HHHHHHHHHHHHHCCCEEECCCCCCHHH
T ss_conf             468889887577888888874388776564555999999999----------9999999999997098430878887111


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             99999998785201001210001366741231135444442478999999985226742677434512456889999975
Q gi|254780709|r   84 VLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD  163 (321)
Q Consensus        84 i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~  163 (321)
                      -...+.+.|.+              +  -||.+.|=|||||||=+=|++-=|-+ |.+=++.-+=--|.||--=-.-.|+
T Consensus        73 kRedI~~AI~~--------------n--QVviiAGETGSGKTTQLPKICLELGr-G~~GlIGHTQPRRlAAR~VA~R~Ae  135 (1320)
T TIGR01967        73 KREDIAKAIAE--------------N--QVVIIAGETGSGKTTQLPKICLELGR-GSRGLIGHTQPRRLAARSVAERVAE  135 (1320)
T ss_pred             HHHHHHHHHHH--------------C--CEEEEECCCCCCCCCCCHHHHHHHCC-CCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             18999999984--------------8--98999724487620232167775427-8765412471468899999999999


Q ss_pred             HHCCCC---------CCCCC-CCCCHHHHHHHHHHHH------HHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             303532---------12235-8661245422899996------5148759986543-33211577899998998763022
Q gi|254780709|r  164 RTSADF---------VCSEI-GSDAAALAYEAFKQAQ------AKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLD  226 (321)
Q Consensus       164 ~~~v~~---------~~~~~-~~dp~~v~~~a~~~a~------~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~  226 (321)
                      -+|-|+         |...- ..--+++.-|+|=-|.      .+.||-||||=|= ||=|=.=|+-=|+.|       .
T Consensus       136 ELgtplGe~VGYkVRF~D~v~~~t~VKLmTDGiLLAE~Q~DRfL~~YDTIIIDEAHERSLNIDFLLGYLK~l-------L  208 (1320)
T TIGR01967       136 ELGTPLGELVGYKVRFEDQVSSNTLVKLMTDGILLAETQQDRFLERYDTIIIDEAHERSLNIDFLLGYLKQL-------L  208 (1320)
T ss_pred             HHCCCCCCCCCCEEEECCCCCCCCEEEEHHHHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHHHHHHH-------C
T ss_conf             838898861320366314268854363032235899852002221067336511231123388999888763-------2


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             23430112310233522577899987643
Q gi|254780709|r  227 PHAPHSVLQVLDATTGQNALRQVEMFHAV  255 (321)
Q Consensus       227 ~~~p~~~~lVlda~~gq~~~~~a~~F~~~  255 (321)
                      +.-||..+..-+||+  |.-.=+++|+++
T Consensus       209 ~rRPDLKiIITSATI--D~ERFs~HFn~A  235 (1320)
T TIGR01967       209 PRRPDLKIIITSATI--DPERFSRHFNNA  235 (1320)
T ss_pred             CCCCCCCEEEECCCC--CHHHHHHHHCCC
T ss_conf             668865257400235--744687862278


No 113
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=97.76  E-value=0.00055  Score=48.27  Aligned_cols=58  Identities=16%  Similarity=0.227  Sum_probs=39.1

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             41231135444442478999999985-2267426774345124568899999753035321
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV  170 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~  170 (321)
                      -.++++.|.+|+||||-+.-+|..+. +.|++|++.++-.-.---  ..+..+...++++.
T Consensus        30 GeL~viaarpg~GKT~f~~~~a~~~~~~~g~~vl~~SlEm~~~~~--~~Rlls~~~g~~~~   88 (271)
T cd01122          30 GELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISLEEPVVRT--ARRLLGQYAGKRLH   88 (271)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHH--HHHHHHHHHCCCHH
T ss_conf             808999968998699999999999999769908999704999999--99999998299711


No 114
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=97.75  E-value=0.0031  Score=43.03  Aligned_cols=129  Identities=16%  Similarity=0.151  Sum_probs=64.8

Q ss_pred             CCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCCCCCCCHHHHHH
Q ss_conf             36674-1231135444442478999999985226742677434512456889999975303532-122358661245422
Q gi|254780709|r  107 FSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSEIGSDAAALAYE  184 (321)
Q Consensus       107 ~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~~~~dp~~v~~~  184 (321)
                      .+++| .++||+||+|||||-++--||.++-....+..-+-+--|     ..=-..+.-+|.|= |.+..   ..-...+
T Consensus       590 dp~rP~GsFlf~GptGvGKTELAKaLAe~Lfg~~~~LIriDMSEy-----~E~hsvsrLiGaPPGYVGy~---egG~Lte  661 (852)
T TIGR03346       590 DPNRPIGSFLFLGPTGVGKTELAKALAEFLFDDEDAMVRIDMSEY-----MEKHSVARLIGAPPGYVGYE---EGGQLTE  661 (852)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECHHHH-----CCHHHHHHHCCCCCCCCCCC---CCCEECH
T ss_conf             899974589986788776899999999998558520698430443-----01224778558999767768---7874239


Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCCHHHH
Q ss_conf             899996514875998654333211-577899998998763022-23430112310233522577
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGRLHNN-SILMAGIGKMIRVLKRLD-PHAPHSVLQVLDATTGQNAL  246 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR~~~~-~~lm~EL~ki~~v~~~~~-~~~p~~~~lVlda~~gq~~~  246 (321)
                      ++   +.+-|-|||.|---.-|-+ -|++-++-.--+.-.... ...-.-++.++-++.|...+
T Consensus       662 ~v---r~~PysVvL~DEIEKAh~~V~~~lLQilD~G~ltD~~Gr~vdF~NtiiimTSN~Ga~~i  722 (852)
T TIGR03346       662 AV---RRKPYSVVLFDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSQFI  722 (852)
T ss_pred             HH---HHCCCEEEEECCHHHHCHHHHHHHHHHHCCCEEECCCCCEEEEEEEEEEEECCCCHHHH
T ss_conf             89---81988799853054307689999998823674307999888535568986154065999


No 115
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=97.73  E-value=0.00061  Score=47.98  Aligned_cols=151  Identities=22%  Similarity=0.343  Sum_probs=76.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      |--|.++|..-+||+|-+-+|.      |.++.+++ +               .-|..       .|+....+      .
T Consensus         2 ~~~V~ivG~pN~GKSTL~N~l~------g~~~~~vs-~---------------~pgtT-------r~~~~~~~------~   46 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNALL------GEERVIVS-D---------------IAGTT-------RDSIDVPF------E   46 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHH------CCCCEEEC-C---------------CCCCE-------EECCEEEE------E
T ss_conf             9899999899998999999983------89844434-9---------------99915-------73328999------9


Q ss_pred             HHCCCEEEEECCCC---CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH--HHHHHHHHHCCCCEEEEEC
Q ss_conf             51487599865433---321157789999899876302223430112310233522577--8999876435897699965
Q gi|254780709|r  191 AKKVDVLIIDTAGR---LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL--RQVEMFHAVAGTTGLIMTK  265 (321)
Q Consensus       191 ~~~~DvvliDTAGR---~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~--~~a~~F~~~~~~~g~I~TK  265 (321)
                      .++..+.++||+|=   .+.... ++.+ .+.+.+...  ...+-+++|+||..+-...  ...+...+.-..-=++++|
T Consensus        47 ~~~~~~~~vDtpGi~~~~~~~~~-~e~~-~~~~~~~~i--~~~dvil~viDa~~~~~~~d~~i~~~l~~~~~p~iiv~NK  122 (174)
T cd01895          47 YDGKKYTLIDTAGIRRKGKVEEG-IEKY-SVLRTLKAI--ERADVVLLVIDATEGITEQDLRIAGLILEEGKALVIVVNK  122 (174)
T ss_pred             ECCEEEEEEECCCCCCCCCCCCH-HHHH-HHHHHHHHH--HHCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             99988999857884213442106-8899-999999999--8428658997589899889999999999859986999856


Q ss_pred             CCCCCCHHHHHHH-H----H----HHCCCEEEEEC--CCCCCCCCC
Q ss_conf             4578706999999-9----9----97698899975--898132555
Q gi|254780709|r  266 MDGTARGGGLIPI-V----V----THKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       266 lD~ta~~G~~ls~-~----~----~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      .|--.+-...+.- .    .    ....||.+++.  |+.+++|..
T Consensus       123 ~Dli~~~~~~~~~~~~~~~~~~~~~~~~~ii~iSA~~g~Gi~~L~~  168 (174)
T cd01895         123 WDLVEKDSKTMKEFKKEIRRKLPFLDYAPIVFISALTGQGVDKLFD  168 (174)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHH
T ss_conf             7526764778999999999873416899289997447989999999


No 116
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=97.73  E-value=0.0001  Score=53.36  Aligned_cols=79  Identities=22%  Similarity=0.379  Sum_probs=49.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             123113544444247899999998522-6742677434512456889999975303532122358661245422899996
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDA-GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~-g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      ..|+++|++|||||||++-+..++.+. ++++.-+ -|.     +|-+  +.... .-+...+.+.|..+- .+++..+.
T Consensus         2 GliLitG~TGSGKTTtl~all~~i~~~~~~~IiTi-EDP-----iE~~--~~~~~-~~i~q~e~g~~~~sf-~~~lr~aL   71 (198)
T cd01131           2 GLVLVTGPTGSGKSTTLAAMIDYINKNKTHHILTI-EDP-----IEFV--HESKR-SLINQREVGLDTLSF-ENALKAAL   71 (198)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEE-CCC-----HHHH--CCCCC-EEEEECCCCCCCCCH-HHHHHHHH
T ss_conf             38999899999799999999985363788369996-473-----7752--36764-488733307886379-99999998


Q ss_pred             HHCCCEEEEE
Q ss_conf             5148759986
Q gi|254780709|r  191 AKKVDVLIID  200 (321)
Q Consensus       191 ~~~~DvvliD  200 (321)
                      .++-|+|+|.
T Consensus        72 R~~PDvI~vG   81 (198)
T cd01131          72 RQDPDVILVG   81 (198)
T ss_pred             HHCCCEEECC
T ss_conf             5488857527


No 117
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.
Probab=97.72  E-value=0.00011  Score=53.23  Aligned_cols=80  Identities=24%  Similarity=0.332  Sum_probs=50.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC--------CCCC--C-C--CCH-
Q ss_conf             311354444424789999999852267426774345124568899999753035321--------2235--8-6--612-
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV--------CSEI--G-S--DAA-  179 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~--------~~~~--~-~--dp~-  179 (321)
                      |.+.|=-|+||||..+-||.++.++|++|+++-+|.=         .+-+++.++..        ....  + .  =|+ 
T Consensus         2 ia~~GKGGvGKtt~~~~la~~l~~~g~~vl~iD~Dp~---------dlpe~~~~~~~~~~~l~~lg~~~~~g~GC~C~~n   72 (116)
T cd02034           2 IAITGKGGVGKTTIAALLARYLAEKGKPVLAIDADPD---------DLPERLSVEVGEIKLLLVMGMGRPGGEGCYCPEN   72 (116)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC---------CCHHHHCEECCCCCEEEEEECCCCCCCCEECCHH
T ss_conf             7898899774999999999999978996999989897---------1235542331787079999734358994088257


Q ss_pred             HHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             45422899996514875998654
Q gi|254780709|r  180 ALAYEAFKQAQAKKVDVLIIDTA  202 (321)
Q Consensus       180 ~v~~~a~~~a~~~~~DvvliDTA  202 (321)
                      .+.++-+++...+++|+|++||.
T Consensus        73 ~ll~~~l~~l~~~~~~~VvvD~e   95 (116)
T cd02034          73 ALLNALLRHLVLTRDEQVVVDTE   95 (116)
T ss_pred             HHHHHHHHHHCCCCCCEEEEECC
T ss_conf             89999999970679989999678


No 118
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=97.71  E-value=0.00047  Score=48.77  Aligned_cols=131  Identities=15%  Similarity=0.132  Sum_probs=76.8

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-----CCCCCC---CCC--HHHH
Q ss_conf             231135444442478999999985226742677434512456889999975303532-----122358---661--2454
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-----VCSEIG---SDA--AALA  182 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-----~~~~~~---~dp--~~v~  182 (321)
                      +++++|++|+||||-+--.  .+......--++.+---|.||.-=-+-.|+.+|-++     |.....   +.-  ..++
T Consensus        22 ~~vl~a~tGsGKtTqvP~~--ll~~~~~~g~I~~~qPRR~AA~s~A~RvA~e~~e~~G~~VGY~vR~e~~~s~~Tri~~~   99 (812)
T PRK11664         22 QVLLKAPTGAGKSTWLPLQ--LLQQGGINGKIIMLEPRRLAARNVAQRLAEQLGEKPGETVGYRMRAESKVGPNTRLEVV   99 (812)
T ss_pred             EEEEEECCCCCHHHHHHHH--HHHCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEE
T ss_conf             7999908999989999999--99646889938993883999999999999972999998675782567788998579997


Q ss_pred             HHHHHH------HHHHCCCEEEEECCCCCCCHHHH-HHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             228999------96514875998654333211577-89999899876302223430112310233522577899987643
Q gi|254780709|r  183 YEAFKQ------AQAKKVDVLIIDTAGRLHNNSIL-MAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV  255 (321)
Q Consensus       183 ~~a~~~------a~~~~~DvvliDTAGR~~~~~~l-m~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~  255 (321)
                      .+++--      -...+|++||+|-+---+.+.++ +.=+.++.+.+      .|+..++||+||.  |+    ..|.++
T Consensus       100 T~GiLlr~l~~dp~L~~~~~vI~DE~HER~l~~Dl~l~l~~~~~~~~------r~dLklvvMSATl--d~----~~~~~~  167 (812)
T PRK11664        100 TEGILTRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGL------RDDLKLLIMSATL--DN----DRLQQL  167 (812)
T ss_pred             CHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHH------CCCCEEEEECCCC--CH----HHHHHH
T ss_conf             55899999724977677888999575468751899999999999861------8982899984788--84----889975


Q ss_pred             CC
Q ss_conf             58
Q gi|254780709|r  256 AG  257 (321)
Q Consensus       256 ~~  257 (321)
                      ++
T Consensus       168 ~~  169 (812)
T PRK11664        168 LP  169 (812)
T ss_pred             CC
T ss_conf             89


No 119
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=97.71  E-value=5.9e-05  Score=55.08  Aligned_cols=92  Identities=22%  Similarity=0.356  Sum_probs=55.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .|+|+|..||||||-+..|+.++..+|..|.+++.|.+|-.    +..|-+..         +...-+..+.+++.+..+
T Consensus         1 Livl~GlP~SGKSt~a~~L~~~l~~~~~~~i~~~~d~~~~~----~~~~~~~~---------Ek~~r~~~~~~v~~~l~~   67 (249)
T TIGR03574         1 LIILTGLPGVGKSTFSKELSKKLSEKNIDNIILGTDLIRES----FPVWKEKY---------EEFIRDSTLYLIKTALKN   67 (249)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCHHH----HHHCCHHH---------HHHHHHHHHHHHHHHHCC
T ss_conf             97896789998999999999999982996599655200212----00033677---------999899999999998433


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             48759986543332115778999989987
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRV  221 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v  221 (321)
                      + ++||+|.--   .-...--||-.+.|.
T Consensus        68 ~-~~vI~D~~n---YiKg~RYEL~clAk~   92 (249)
T TIGR03574        68 K-YSVIVDDTN---YYNSKRRDLINIAKE   92 (249)
T ss_pred             C-CEEEECCCC---HHHHHHHHHHHHHHH
T ss_conf             7-669972732---788999999999998


No 120
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=97.71  E-value=0.00091  Score=46.75  Aligned_cols=144  Identities=20%  Similarity=0.259  Sum_probs=80.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |.++|.+-+||||-+-+|.      |.++.+++-                   .|..+    .|+....      ....+
T Consensus         4 ValvG~pN~GKStL~N~l~------g~~~~ivs~-------------------~pgtT----rd~~~~~------~~~~~   48 (157)
T cd04164           4 VVIVGKPNVGKSSLLNALA------GRDRAIVSD-------------------IAGTT----RDVIEES------IDIGG   48 (157)
T ss_pred             EEEECCCCCCHHHHHHHHH------CCCCEEECC-------------------CCCEE----EECCEEE------EEECC
T ss_conf             9998899998999999996------897334328-------------------89847----8632678------95399


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHCCCCEEEEECCCCCCCH
Q ss_conf             87599865433321157789999899876302223430112310233522577899-98764358976999654578706
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~~~~g~I~TKlD~ta~~  272 (321)
                      +.+.++||+|= +...+.++ ...+.+.....  ...+-+++|+|+..+....+.. .......| -=++++|.|--..-
T Consensus        49 ~~i~l~DTpG~-~~~~~~~e-~~~~~~~~~~i--~~aDlil~vvD~~~~~~~~~~~~~~~~~~~p-~i~v~NKiDl~~~~  123 (157)
T cd04164          49 IPVRLIDTAGI-RETEDEIE-KIGIERAREAI--EEADLVLFVIDASRGLDEEDLEILELPADKP-IIVVLNKSDLLPDS  123 (157)
T ss_pred             EEEEEEECCCC-CCCCCHHH-HHHHHHHHHHC--CCCCEEEEEEECCCCCCHHHHHHHHHHCCCC-EEEEEECCCCCCCH
T ss_conf             88999726775-44457899-99999998630--1576799998898778888999998514799-89999676014866


Q ss_pred             HHHHHHHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             9999999997698899975--898132555
Q gi|254780709|r  273 GGLIPIVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       273 G~~ls~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      -.   .....+.|+.+|+.  |+.+++|..
T Consensus       124 ~~---~~~~~~~~vi~ISA~~g~Gi~~L~~  150 (157)
T cd04164         124 EL---LSLLAGKPIIAISAKTGEGLDELKE  150 (157)
T ss_pred             HH---HHHCCCCCEEEEECCCCCCHHHHHH
T ss_conf             67---9852899779998527959999999


No 121
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=97.69  E-value=0.00017  Score=51.79  Aligned_cols=116  Identities=21%  Similarity=0.257  Sum_probs=62.8

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCC----CCCCHHHHHH
Q ss_conf             674123113544444247899999998522674267743451245688999997530353212235----8661245422
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI----GSDAAALAYE  184 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~----~~dp~~v~~~  184 (321)
                      .-|+.++|.||.|+||||++-=+|+.+--.+.....-+|..-+.         +.....+++....    +-|-+.-..+
T Consensus        38 RIaHAYLF~GPRGvGKTT~ARIfAKaLNC~~~~d~~~pC~~C~~---------~~~~s~DViEIDAASn~gVDdIReLie  108 (718)
T PRK07133         38 KISHAYLFSGPHGTGKTSVAKIFANALNCSHKTDLIEPCQNCIE---------NFNNNLDIIEMDAASNNGVDEIRELRE  108 (718)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHH---------CCCCCCCEEEECCCCCCCHHHHHHHHH
T ss_conf             97505862389986889999999999679999999997702143---------047898737754556688899999999


Q ss_pred             HHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH
Q ss_conf             899996-51487599865433321157789999899876302223430112310233522
Q gi|254780709|r  185 AFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ  243 (321)
Q Consensus       185 a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq  243 (321)
                      .+.+.- ..+|-|.|||-|-+|....  .+-|-       +..+..|..+++++ |||--
T Consensus       109 ~v~y~P~~gkYKVyIIDEvHMLS~~A--fNALL-------KtLEEPP~hvvFIL-aTTep  158 (718)
T PRK07133        109 NVKNLPQISKYKIYIIDEVHMLSKSA--FNALL-------KTLEEPPKHVIFIL-ATTDV  158 (718)
T ss_pred             HHCCCCCCCCEEEEEEECCCCCCHHH--HHHHH-------HHHCCCCCCCEEEE-EECCH
T ss_conf             82558877872499996620079999--99999-------85027987827999-70882


No 122
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=97.69  E-value=0.00019  Score=51.50  Aligned_cols=177  Identities=17%  Similarity=0.239  Sum_probs=96.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCE-EEEECCCCCHHHHHHHHHHHHHHC-CCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             231135444442478999999985226742-677434512456889999975303-532122358661245422899996
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKV-MLAAGDTFRSAAIDQLKIWADRTS-ADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV-~lva~DtfR~aA~eQL~~~a~~~~-v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -+.++-|+|+||||...=.|.|+..+|+++ .++.+-|-=.-+.+-|+.+++..+ ..+-....+.-|..--..+++...
T Consensus        99 SFaiiAPTGvGKTTfg~~~sl~~a~kgkr~yii~PT~~Lv~Q~~~kl~~~~e~~~~~~~~~~yh~~l~~~ekee~le~i~  178 (1187)
T COG1110          99 SFAIIAPTGVGKTTFGLLMSLYLAKKGKRVYIIVPTTTLVRQVYERLKKFAEDAGSLDVLVVYHSALPTKEKEEALERIE  178 (1187)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             44898278876547999999998755874999966789999999999998865378524665312366577999999986


Q ss_pred             HH----------------------CCCEEEEECC------CCCCCHHHHH------------HHHHHHHHHHH-------
Q ss_conf             51----------------------4875998654------3332115778------------99998998763-------
Q gi|254780709|r  191 AK----------------------KVDVLIIDTA------GRLHNNSILM------------AGIGKMIRVLK-------  223 (321)
Q Consensus       191 ~~----------------------~~DvvliDTA------GR~~~~~~lm------------~EL~ki~~v~~-------  223 (321)
                      +.                      ++|+|+||-.      +|. .|.-|+            -++.++++.++       
T Consensus       179 ~gdfdIlitTs~FL~k~~e~L~~~kFdfifVDDVDA~LkaskN-vDriL~LlGf~eE~i~~a~~~~~lr~~~~~~~~~~~  257 (1187)
T COG1110         179 SGDFDILITTSQFLSKRFEELSKLKFDFIFVDDVDAILKASKN-VDRLLRLLGFSEEVIESAYELIKLRRKLYGEKRAER  257 (1187)
T ss_pred             CCCCCEEEEEHHHHHHHHHHHCCCCCCEEEECCHHHHHHCCCC-HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5996399974787886699840457778998047889863444-888999808887888888999999998632236778


Q ss_pred             ------C----CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC---------EEEEECCCCCCCHHHHHHHHHHHCC
Q ss_conf             ------0----22234301123102335225778999876435897---------6999654578706999999999769
Q gi|254780709|r  224 ------R----LDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTT---------GLIMTKMDGTARGGGLIPIVVTHKI  284 (321)
Q Consensus       224 ------~----~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~---------g~I~TKlD~ta~~G~~ls~~~~~~~  284 (321)
                            .    .....-....||+.+.||.-.-.-+..|.+-+++.         .++=+-. .+...+..++++..+|.
T Consensus       258 ~~e~~~~~e~~~~~~r~k~g~LvvsSATg~~rg~R~~LfReLlgFevG~~~~~LRNIvD~y~-~~~~~e~~~elvk~lG~  336 (1187)
T COG1110         258 VREELREVEREREKKRRKLGILVVSSATGKPRGSRLKLFRELLGFEVGSGGEGLRNIVDIYV-ESESLEKVVELVKKLGD  336 (1187)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHCCCCCCCCHHHHHEEEEEC-CCCCHHHHHHHHHHHCC
T ss_conf             99999988888877504773699960557877743889999839856764031300044203-68637889999998489


Q ss_pred             C-EEEEEC
Q ss_conf             8-899975
Q gi|254780709|r  285 P-VYFLGV  291 (321)
Q Consensus       285 P-i~fig~  291 (321)
                      - +.|+..
T Consensus       337 GgLIfV~~  344 (1187)
T COG1110         337 GGLIFVPI  344 (1187)
T ss_pred             CEEEEEEC
T ss_conf             74999971


No 123
>TIGR01054 rgy reverse gyrase; InterPro: IPR005736   DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis , . DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA .   Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.    Reverse gyrase is a type IA topoisomerase that is unique among these enzymes in its requirement for ATP. Reverse gyrase is a hyperthermophile-specific enzyme that acts as a renaturase by positively supercoiling DNA, and by annealing complementary single-strand circles . Hyperthermophilic organisms must protect themselves against heat-induced degradation, and reverse gyrase acts to reduce the rate of double-strand DNA breakage, a function that does not require ATP hydrolysis and which is independent of its positive supercoiling abilities. Reverse gyrase achieves this by recognising nicked DNA and recruiting a protein coat to the site of damage .   More information about this protein can be found at Protein of the Month: DNA Topoisomerase .; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0006268 DNA unwinding during replication, 0005694 chromosome.
Probab=97.67  E-value=0.00011  Score=53.16  Aligned_cols=90  Identities=18%  Similarity=0.198  Sum_probs=70.2

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHC-CCCE-EEEECCCCCHHHHHHHHHHHHHHCCCCC---CCCCCCCCHHHHHHHHH
Q ss_conf             23113544444247899999998522-6742-6774345124568899999753035321---22358661245422899
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDA-GLKV-MLAAGDTFRSAAIDQLKIWADRTSADFV---CSEIGSDAAALAYEAFK  187 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~-g~kV-~lva~DtfR~aA~eQL~~~a~~~~v~~~---~~~~~~dp~~v~~~a~~  187 (321)
                      -+.++-||||||||--.=.|.|++.+ |++| .+..+-+-=.-|.|.|+.+++..|+-+.   ...++.=|.+==.+.++
T Consensus       101 SFai~APTGVGKttFG~~mslflA~kKGkR~y~ilPT~lLv~Qv~~kl~~~~~k~g~~~~~l~~~yhS~L~~~~kke~~E  180 (1843)
T TIGR01054       101 SFAIVAPTGVGKTTFGLVMSLFLAKKKGKRSYIILPTTLLVKQVAEKLSSLAEKEGVGIVRLLGAYHSKLSTKEKKEVKE  180 (1843)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCHHHHHHHHH
T ss_conf             64898058876779999999998654298789994707889999999875200257500002221011265456788999


Q ss_pred             HHHHHCCCEEEEECCC
Q ss_conf             9965148759986543
Q gi|254780709|r  188 QAQAKKVDVLIIDTAG  203 (321)
Q Consensus       188 ~a~~~~~DvvliDTAG  203 (321)
                      ...+.+||+ ||=|++
T Consensus       181 ri~~GDfdi-litT~~  195 (1843)
T TIGR01054       181 RIENGDFDI-LITTSM  195 (1843)
T ss_pred             HHHCCCEEE-EHHHHH
T ss_conf             873189178-612246


No 124
>PRK10875 recD exonuclease V subunit alpha; Provisional
Probab=97.67  E-value=0.00077  Score=47.25  Aligned_cols=114  Identities=22%  Similarity=0.254  Sum_probs=63.4

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHH-H-HCCCC-EEEEECCCCCHHHH--HHHHHHHHHHCCCC----------CCC--CC
Q ss_conf             123113544444247899999998-5-22674-26774345124568--89999975303532----------122--35
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKM-S-DAGLK-VMLAAGDTFRSAAI--DQLKIWADRTSADF----------VCS--EI  174 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~-~-~~g~k-V~lva~DtfR~aA~--eQL~~~a~~~~v~~----------~~~--~~  174 (321)
                      ...++.|-.|.|||||++||=+-+ . ..+.+ -...++-|=||||-  |-+.....++.+.-          .+.  --
T Consensus       163 ~~~vIsGGPGTGKTttV~~lLa~l~~~~~~~~l~I~LaAPTGKAAaRL~Esi~~~~~~l~~~~~~~~~~p~~a~TiHRLL  242 (607)
T PRK10875        163 RISVISGGPGTGKTTTVAKLLAALIQLADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLL  242 (607)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCHHHHHCCCCCCEEHHHHC
T ss_conf             77899679998778899999999999645899708998822899999999998787534766566633765566589752


Q ss_pred             CCCCHHHHHHHHHHHHH--HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCC-EEEEECCC
Q ss_conf             86612454228999965--1487599865433321157789999899876302223430-11231023
Q gi|254780709|r  175 GSDAAALAYEAFKQAQA--KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPH-SVLQVLDA  239 (321)
Q Consensus       175 ~~dp~~v~~~a~~~a~~--~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~-~~~lVlda  239 (321)
                      |..|.+--|   .+-..  =.+|+|+||-|-  ..|..||.-|-   +.+.      |+ ..+||-|.
T Consensus       243 g~~p~~~~f---~~~~~nPL~~DvlIVDEAS--MVDl~Lm~~LL---~Alp------~~aRLILvGD~  296 (607)
T PRK10875        243 GAQPGSQRL---RYHAGNPLHLDVLVVDEAS--MIDLPMMSRLI---DALP------DHARVIFLGDR  296 (607)
T ss_pred             CCCCCCCCC---CCCCCCCCCCCEEEEECCH--HHHHHHHHHHH---HHCC------CCCEEEEECCH
T ss_conf             967898765---6577999988989990733--66599999999---8289------99889996562


No 125
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=97.67  E-value=4.8e-05  Score=55.69  Aligned_cols=40  Identities=30%  Similarity=0.447  Sum_probs=37.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             2311354444424789999999852267426774345124
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS  152 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~  152 (321)
                      +|.+.|+.||||||.+.+|+..+..+|.+|.++++|.|--
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~~~vis~D~yy~   40 (179)
T cd02028           1 VVGIAGPSGSGKTTFAKKLSNQLRVNGIGPVVISLDDYYV   40 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             9899898977899999999999846488539995466645


No 126
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=97.66  E-value=5.6e-05  Score=55.22  Aligned_cols=102  Identities=25%  Similarity=0.333  Sum_probs=59.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH---------H-----HHHHHHH-HHHCCCCCCCCCC
Q ss_conf             41231135444442478999999985226742677434512456---------8-----8999997-5303532122358
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA---------I-----DQLKIWA-DRTSADFVCSEIG  175 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA---------~-----eQL~~~a-~~~~v~~~~~~~~  175 (321)
                      +--|.+.|+.||||||-+.|+|..++.+|.+|.=+-|---|-+.         .     .||..-+ .+.-|.=|...- 
T Consensus         5 ~mki~ITG~PGvGKtTl~~ki~e~L~~~g~kvgGf~t~EVR~gGkR~GF~Ivdl~tg~~~~la~~~~~~~rvGkY~V~v-   83 (179)
T COG1618           5 AMKIFITGRPGVGKTTLVLKIAEKLREKGYKVGGFITPEVREGGKRIGFKIVDLATGEEGILARVGFSRPRVGKYGVNV-   83 (179)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCCCCCCCCEEEEEH-
T ss_conf             4599986799845899999999999855966513983114208827515999814795579888478876210478627-


Q ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHH
Q ss_conf             661245422899996514875998654333211577899
Q gi|254780709|r  176 SDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAG  214 (321)
Q Consensus       176 ~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~E  214 (321)
                      .+--.++-.|++.|... .|+|+||--|-|-...+-+.+
T Consensus        84 ~~le~i~~~al~rA~~~-aDvIIIDEIGpMElks~~f~~  121 (179)
T COG1618          84 EGLEEIAIPALRRALEE-ADVIIIDEIGPMELKSKKFRE  121 (179)
T ss_pred             HHHHHHHHHHHHHHHHC-CCEEEEECCCCHHHCCHHHHH
T ss_conf             88899868999988634-998999433633020088999


No 127
>COG4240 Predicted kinase [General function prediction only]
Probab=97.66  E-value=0.00078  Score=47.23  Aligned_cols=57  Identities=19%  Similarity=0.305  Sum_probs=48.9

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             366741231135444442478999999985226-742677434512456889999975
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAG-LKVMLAAGDTFRSAAIDQLKIWAD  163 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g-~kV~lva~DtfR~aA~eQL~~~a~  163 (321)
                      ..++|.++-++||+||||||+.+-|-..+..+| .+++-.+.|-|----.+||+..-+
T Consensus        46 e~grPli~gisGpQGSGKStls~~i~~~L~~kg~ert~~lSLDDlYlthadrl~La~q  103 (300)
T COG4240          46 ERGRPLIVGISGPQGSGKSTLSALIVRLLAAKGLERTATLSLDDLYLTHADRLRLARQ  103 (300)
T ss_pred             HCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEHHHHHCCHHHHHHHHHH
T ss_conf             1279639985268887653599999999997365306886645531043899999873


No 128
>PRK00784 cobyric acid synthase; Provisional
Probab=97.66  E-value=0.0024  Score=43.83  Aligned_cols=179  Identities=21%  Similarity=0.238  Sum_probs=111.9

Q ss_pred             EEECCCCC-CCCHHHHHHHHHHHHHHCCCCEE-----------EEECCCCCHHHHHHHHHHHHHHCCCCCCCC----CCC
Q ss_conf             23113544-44424789999999852267426-----------774345124568899999753035321223----586
Q gi|254780709|r  113 VILVVGVN-GVGKTTVIGKLSKKMSDAGLKVM-----------LAAGDTFRSAAIDQLKIWADRTSADFVCSE----IGS  176 (321)
Q Consensus       113 vil~vG~n-G~GKTTT~aKLA~~~~~~g~kV~-----------lva~DtfR~aA~eQL~~~a~~~~v~~~~~~----~~~  176 (321)
                      .+|+.|.. +|||||-+|=|+..|++.|.+|+           .|++|-.-+|=.+=++.+|-.+.-.+.-+|    +.+
T Consensus         5 ~lMv~GT~S~vGKS~l~aaLCRi~~~~G~~VaPFKaQNMslNs~vt~dG~EigrAQ~~QA~Aag~~p~v~MNPILLKP~g   84 (492)
T PRK00784          5 ALMVQGTTSDAGKSTLVAGLCRILARRGLRVAPFKAQNMSLNSAVTADGGEIGRAQALQAEAAGVEPSVDMNPVLLKPQS   84 (492)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCEECCCCCEEHHHHHHHHHHCCCCCCCCCCCEEECCCC
T ss_conf             05888678887799999999999995898557857022466517889998336999999998699997676887763189


Q ss_pred             --------------------------CCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             --------------------------612454228999965148759986543332115778999989987630222343
Q gi|254780709|r  177 --------------------------DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP  230 (321)
Q Consensus       177 --------------------------dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p  230 (321)
                                                ....++.++++.. .+.||+|++.-|| ++-.-||++.  .|.+.--...-  .
T Consensus        85 d~~SQVIv~Gk~~g~~~a~~Y~~~~~~~~~~v~~a~~~L-~~~~d~iV~EGAG-SpaEiNL~~~--Di~Nm~~A~~~--~  158 (492)
T PRK00784         85 DTGSQVIVQGKVVGNMDARDYHDYKPRLLEAVLESLDRL-AAEYDLVVVEGAG-SPAEINLRDR--DIANMGFAEAA--D  158 (492)
T ss_pred             CCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHHHHHHH-HHHCCEEEEECCC-CCCCCCCCHH--HHHHHHHHHHC--C
T ss_conf             988679999978753139999986999999999999998-8658899993589-8200265220--02428999865--9


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHH-----HHCCCCEEEEECCCCCCCH--HHHHHHHHHHCCCEEEEECCCCCCCCC
Q ss_conf             01123102335225778999876-----4358976999654578706--999999999769889997589813255
Q gi|254780709|r  231 HSVLQVLDATTGQNALRQVEMFH-----AVAGTTGLIMTKMDGTARG--GGLIPIVVTHKIPVYFLGVGEGINDLE  299 (321)
Q Consensus       231 ~~~~lVlda~~gq~~~~~a~~F~-----~~~~~~g~I~TKlD~ta~~--G~~ls~~~~~~~Pi~fig~Ge~i~Dl~  299 (321)
                      --++||.|---|---...+-++.     +.--+-|+|+.|+-|+.+.  -++=-+-..+++|  .+|+=-.++++.
T Consensus       159 apviLV~DIdRGGvfAsl~GT~~lL~~~eR~li~G~IiNKFRGD~~ll~pG~~~le~~tg~P--vlGviP~~~~l~  232 (492)
T PRK00784        159 APVILVADIDRGGVFASLVGTLALLSPEERARVKGFVINKFRGDISLLEPGLDWLEELTGIP--VLGVLPYLDDLR  232 (492)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHCCHHHHHHEEEEEEEEECCCHHHHCCHHHHHHHHHCCC--CEEEECCCCCCC
T ss_conf             98899997567642687763887599988711589999764587466355999999986898--068614656799


No 129
>PRK04328 hypothetical protein; Provisional
Probab=97.66  E-value=0.0015  Score=45.25  Aligned_cols=56  Identities=18%  Similarity=0.127  Sum_probs=44.9

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             741231135444442478999999985226742677434512456889999975303532
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF  169 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~  169 (321)
                      +.+++++.|+.|+||||-+...++.-.++|.+|+.++.+--    .+|+...+..+|.++
T Consensus        23 ~gs~~Lv~G~pGtGKT~la~qFl~~g~~~GE~~lyis~eE~----~~~l~~~~~~~G~d~   78 (250)
T PRK04328         23 ERNVVLLSGGPGTGKSIFSQQFLWNGLQMGEPGIYVALEEH----PVQVRRNMAQFGWDV   78 (250)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECC----HHHHHHHHHHCCCCH
T ss_conf             99699998289999899999999999876997799997279----999999999809986


No 130
>PRK05541 adenylylsulfate kinase; Provisional
Probab=97.64  E-value=5.3e-05  Score=55.41  Aligned_cols=46  Identities=28%  Similarity=0.421  Sum_probs=42.3

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             3667412311354444424789999999852267426774345124
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS  152 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~  152 (321)
                      .++++.||.|.|+.||||||-+-+|..+++.+|.++.+.-+|.+|-
T Consensus         3 ~~~kg~viW~TGLsGSGKTTiA~~l~~~L~~~g~~~~~LDGD~lR~   48 (176)
T PRK05541          3 MKPNGYVIWITGLAGSGKTTIAKALYERLKLKYSNVIYLDGDELRE   48 (176)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHH
T ss_conf             7888679997899999899999999999997599779988689998


No 131
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=97.63  E-value=8e-05  Score=54.14  Aligned_cols=77  Identities=19%  Similarity=0.359  Sum_probs=57.1

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434-51245688999997530353212235866124542289999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD-TFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D-tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      ...+++.||+|||||||.-.+-.++....++++-|.=- -|+...+-|+++.. +.|.+|             -.++..+
T Consensus       258 ~GliLvTGPTGSGKTTTLY~~L~~ln~~~~nI~TiEDPVE~~~~gI~Q~qVN~-k~gltf-------------a~~LRa~  323 (500)
T COG2804         258 QGLILVTGPTGSGKTTTLYAALSELNTPERNIITIEDPVEYQLPGINQVQVNP-KIGLTF-------------ARALRAI  323 (500)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCEEEECCCCCEEECCC-CCCCCH-------------HHHHHHH
T ss_conf             70899968999988999999999862788508984078045159851563140-359978-------------9999998


Q ss_pred             HHHCCCEEEEEC
Q ss_conf             651487599865
Q gi|254780709|r  190 QAKKVDVLIIDT  201 (321)
Q Consensus       190 ~~~~~DvvliDT  201 (321)
                      ..++=|+|+|.-
T Consensus       324 LRqDPDvImVGE  335 (500)
T COG2804         324 LRQDPDVIMVGE  335 (500)
T ss_pred             HCCCCCEEEEEC
T ss_conf             665998599835


No 132
>pfam01591 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a bifunctional enzyme with fructose-2,6-bisphosphatase. The bifunctional enzyme catalyses both the synthesis and degradation of fructose-2,6-bisphosphate, a potent regulator of glycolysis. This enzyme contains a P-loop motif.
Probab=97.62  E-value=0.0088  Score=39.85  Aligned_cols=180  Identities=14%  Similarity=0.213  Sum_probs=93.3

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCH-------
Q ss_conf             3667412311354444424789999999852267426774345124568899999753035321223586612-------
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA-------  179 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~-------  179 (321)
                      +...+-+|+|||+.+.|||+.+-||+.||.-.|.++-+-.+..||=...      +.-.+.++| .+.+.+..       
T Consensus         9 ~~~~klvIvmVGLPARGKS~ia~kl~RYL~W~g~~~kvFn~G~yRR~~~------~~~~~~~ff-dp~n~~~~~~R~~~a   81 (223)
T pfam01591         9 FTNSKTMIVMVGLPARGKTYISKKLTRYLNWLGVPTKVFNVGEYRRSAV------KAYSNYEFF-RPDNTEAMKIREQCA   81 (223)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHC------CCCCCCCCC-CCCCHHHHHHHHHHH
T ss_conf             5689889999899999889999999999865699805842637887631------899994113-899989999999999


Q ss_pred             -HHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC----------------
Q ss_conf             -454228999965148759986543332115778999989987630222343011231023352----------------
Q gi|254780709|r  180 -ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG----------------  242 (321)
Q Consensus       180 -~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g----------------  242 (321)
                       ..+.+.+.+..+.+-+|-|.|-.--.......+.+.      +.    ..+..+++|=.-.+-                
T Consensus        82 ~~~l~dl~~~l~~~~G~VaI~DATN~T~~RR~~i~~~------~~----~~~~~vlFiEsic~D~~ii~~NI~~~~~~sp  151 (223)
T pfam01591        82 LAALKDVLAYLNEESGQVAIFDATNTTRERRKNILDF------AE----ENGLKVFFLESICDDPEIIARNIKLVKFSSP  151 (223)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHH------HH----HCCCEEEEEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             9999999999985898299996887689999999999------98----6697499999973888999999999984599


Q ss_pred             ----HHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCC-CEEEEECCCCC--CCCCCCCHHHHHHHHCCC
Q ss_conf             ----257789998764358976999654578706999999999769-88999758981--325557789999987286
Q gi|254780709|r  243 ----QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKI-PVYFLGVGEGI--NDLEPFVAKDFSAVITGC  313 (321)
Q Consensus       243 ----q~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~-Pi~fig~Ge~i--~Dl~~f~~~~~~~~llG~  313 (321)
                          .+.-.-.+.|.+.+..---+..-+|+.-          .-++ =|+.+-.|+++  .-+.=+-+-+++--|+-+
T Consensus       152 DY~~~~~e~A~~DF~~Ri~~ye~~Yepl~~~~----------d~~lsyIK~in~g~~~~vn~i~GyL~srIv~~LmNl  219 (223)
T pfam01591       152 DYKGKPPEEAIDDFMKRLECYEKQYEPLDDEH----------DEDLSYIKVINVGQSIVVNNVQGYLQSRIVYYLMNI  219 (223)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCEECCCCCC----------CCCCCEEEEEECCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             74688999999999999997534242388343----------368756999978988999785476188899981406


No 133
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=97.62  E-value=0.00084  Score=47.00  Aligned_cols=120  Identities=17%  Similarity=0.192  Sum_probs=59.3

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHHH
Q ss_conf             67412311354444424789999999852-2674267743451245688999997530353212235866-124542289
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD-AAALAYEAF  186 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~d-p~~v~~~a~  186 (321)
                      .-|+.++|.||.|+||||++--+|+.+-- .+..  .-+|..-     +.-+........+++.....++ ...-+++-+
T Consensus        36 rl~HAyLFsGprG~GKTt~ArilAk~LnC~~~~~--~~PCg~C-----~sC~~i~~g~~~DviEidaasn~~VddIR~l~  108 (560)
T PRK06647         36 KIANAYIFSGPRGVGKTSSARAFARCLNCVNGPT--IMPCGEC-----FSCKSIDNDSSLDVIEIDGASNTSVQDVRQIK  108 (560)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCC--CCCCCCC-----HHHHHHHCCCCCCEEEECCCCCCCHHHHHHHH
T ss_conf             9774366328998789999999999965999999--8888788-----78888745999875764364548889999999


Q ss_pred             HHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH
Q ss_conf             9996----514875998654333211577899998998763022234301123102335225
Q gi|254780709|r  187 KQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN  244 (321)
Q Consensus       187 ~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~  244 (321)
                      +.+.    ..+|-|+|||-|-+|....-  +-|-|       ..+..|..+++++=.+--+.
T Consensus       109 e~v~~~P~~~~yKV~IIDEahmLt~~A~--NALLK-------tLEEPP~~~~FILaTte~~K  161 (560)
T PRK06647        109 EEIMFPPASSRYRVYIIDEVHMLSNSAF--NALLK-------TIEEPPPYIVFIFATTEVHK  161 (560)
T ss_pred             HHHCCCCCCCCEEEEEECCHHHCCHHHH--HHHHH-------HHHCCCCCEEEEEECCCHHH
T ss_conf             9863287668706999646565599999--99999-------86348875599997799476


No 134
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.61  E-value=0.00063  Score=47.85  Aligned_cols=143  Identities=24%  Similarity=0.305  Sum_probs=84.1

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH-
Q ss_conf             7412311354444424789999999852267426774345124568899999753035321223586612454228999-
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ-  188 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~-  188 (321)
                      +..+++++|..|+||||.+-+|...+......+..+.. + +....|=|+..+..+|++.- ..   +.... +..++. 
T Consensus        42 ~~g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~-~-~l~~~~ll~~i~~~lg~~~~-~~---~~~~~-~~~l~~~  114 (269)
T TIGR03015        42 REGFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVN-T-RVDAEDLLRMVAADFGLETE-GR---DKAAL-LRELEDF  114 (269)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECC-C-CCCHHHHHHHHHHHCCCCCC-CC---CHHHH-HHHHHHH
T ss_conf             89659997299898899999999845934548999769-9-99999999999998598988-98---99999-9999999


Q ss_pred             ---HH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHH------HHHHHHHHCCC
Q ss_conf             ---96-514875998654333211577899998998763022234301123102335225778------99987643589
Q gi|254780709|r  189 ---AQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR------QVEMFHAVAGT  258 (321)
Q Consensus       189 ---a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~------~a~~F~~~~~~  258 (321)
                         .. ....=|+|||-|-.++  .+.+++|..+.+.-.  .....-.++     ..||.-++      +...|.+.+.+
T Consensus       115 L~~~~~~g~~~vliIDEAq~L~--~~~Le~Lr~L~n~e~--~~~~ll~ii-----L~GqpeL~~~L~~~~~~~l~qRI~~  185 (269)
T TIGR03015       115 LIEQFAAGKRALLVVDEAQNLT--PELLEELRMLSNFQT--DNAKLLQIF-----LVGQPEFRETLQSPQLQQLRQRIIA  185 (269)
T ss_pred             HHHHHHCCCCEEEEEECHHHCC--HHHHHHHHHHHCCCC--CCCCCEEEE-----EECCHHHHHHHCCCCHHHHHHCEEE
T ss_conf             9999966994699972422199--999999999970135--888704899-----9578679998727402545550767


Q ss_pred             CEEEEECCCCC
Q ss_conf             76999654578
Q gi|254780709|r  259 TGLIMTKMDGT  269 (321)
Q Consensus       259 ~g~I~TKlD~t  269 (321)
                       .+-+..|+..
T Consensus       186 -~~~L~pl~~e  195 (269)
T TIGR03015       186 -SCHLGPLDRE  195 (269)
T ss_pred             -EEEECCCCHH
T ss_conf             -9984799989


No 135
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=97.60  E-value=0.0019  Score=44.43  Aligned_cols=171  Identities=23%  Similarity=0.302  Sum_probs=85.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             99999878520100121000136674123113544444247899999998522674267743451245688999997530
Q gi|254780709|r   86 YDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRT  165 (321)
Q Consensus        86 ~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~  165 (321)
                      ..|.+.+...+.+..     ...+.+--|.++|-+-|||.|-+-+|    ..+.+.  ++                ++.-
T Consensus       152 ~~L~~~i~~~l~~~~-----~~~~~~iriaiiGrpNvGKStl~N~l----l~~~r~--iv----------------s~~~  204 (438)
T PRK00093        152 GDLLDAILELLPEEE-----EEEEDPIKIAIIGRPNVGKSTLINAL----LGEERV--IV----------------SDIA  204 (438)
T ss_pred             HHHHHHHHHHCCCCC-----CCCCCCEEEEEECCCCCCHHHHHHHH----HHHHHH--HC----------------CCCC
T ss_conf             999999985488554-----34455605999558886556788876----543332--04----------------7999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC---CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             353212235866124542289999651487599865433---32115778999989987630222343011231023352
Q gi|254780709|r  166 SADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGR---LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       166 ~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR---~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      |.       -.|+..+.+      .-++..+.+|||||=   ...+.. + |--.+.+.++...  ..|-++||+||+.|
T Consensus       205 Gt-------TrD~i~~~~------~~~~~~~~~iDTaGirkk~k~~~~-i-E~~s~~~t~~~i~--~~dvvilviDa~~~  267 (438)
T PRK00093        205 GT-------TRDSIDTPF------ERDGQKYTLIDTAGIRRRGKVTEG-I-EKYSVIRTLKAIE--RADVVLLVIDATEG  267 (438)
T ss_pred             CC-------CCCCEEEEE------EECCCEEEEEECCCCCCCCCCCHH-H-HHHHHHHHHHHHH--HCCEEEEEEECCCC
T ss_conf             85-------112326799------989967999989898765642137-8-8999999999986--44669999976658


Q ss_pred             HH--HHHHHHHHHHHCCCCEEEEECCCCCCCHHHH---------HHHHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             25--7789998764358976999654578706999---------9999997698899975--898132555
Q gi|254780709|r  243 QN--ALRQVEMFHAVAGTTGLIMTKMDGTARGGGL---------IPIVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       243 q~--~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~---------ls~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      -.  -...|....+.----=+++.|.|--.+....         -.......+||.|++.  |++++.|-+
T Consensus       268 ~~~qD~~i~~~i~~~gk~~ii~vNKwDLv~~~~~~~~~~~~~i~~~l~~~~~~pIvfiSA~~g~gi~kl~~  338 (438)
T PRK00093        268 ITEQDLRIAGLALEAGRALVIVVNKWDLVEKDSKTMEEVKEELRRRLPFLDFAPIVFISALTGQGVDKLFE  338 (438)
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEEECHHCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH
T ss_conf             84888999999998199669999702225663899999999999756125898779985147779999999


No 136
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=97.60  E-value=0.0012  Score=45.95  Aligned_cols=121  Identities=18%  Similarity=0.203  Sum_probs=63.2

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC-C-EEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHH
Q ss_conf             667412311354444424789999999852267-4-267743451245688999997530353212235866-1245422
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL-K-VMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD-AAALAYE  184 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~-k-V~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~d-p~~v~~~  184 (321)
                      ..-|+.++|.||.|+||||++--+|+.+.-... . -.-..|+..        +........+++.....++ -..-+++
T Consensus        35 ~RiaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~dpCg~C~sC--------~~I~~g~h~DviEIdaasn~gIDeIRe  106 (613)
T PRK05896         35 NKLTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDGDCCNSCSVC--------ESINTNQSVDIVELDAASNNGVDEIRN  106 (613)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--------HHHHCCCCCCEEEEECCCCCCHHHHHH
T ss_conf             997622775589984889999999999669999999988888789--------998569999868840655578899999


Q ss_pred             HHHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             899996----5148759986543332115778999989987630222343011231023352257
Q gi|254780709|r  185 AFKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA  245 (321)
Q Consensus       185 a~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~  245 (321)
                      -++.+.    ..+|-|+|||.|-+|.....  +-|       =|..+..|..+++++=.+--+..
T Consensus       107 Lie~~~~~P~~gkyKV~IIDEah~Ln~~Aa--NAL-------LKtLEEPP~~viFIL~Ttep~KL  162 (613)
T PRK05896        107 IIDNINYLPTTFKYKVYIIDEAHMLSTSAW--NAL-------LKTLEEPPKHVVFIFATTEFQKI  162 (613)
T ss_pred             HHHHHCCCCCCCCCEEEEECCHHHCCHHHH--HHH-------HHHCCCCCCCCEEEEEECCHHHC
T ss_conf             999708587579945999816221799999--999-------98534898783799982881549


No 137
>PRK07270 DNA polymerase III subunits gamma and tau; Validated
Probab=97.59  E-value=0.0081  Score=40.08  Aligned_cols=106  Identities=21%  Similarity=0.263  Sum_probs=56.5

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHC----CCCE---------------EEEECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             674123113544444247899999998522----6742---------------677434512456889999975303532
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDA----GLKV---------------MLAAGDTFRSAAIDQLKIWADRTSADF  169 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~----g~kV---------------~lva~DtfR~aA~eQL~~~a~~~~v~~  169 (321)
                      .-|+.++|.||.|+||||++--+|+.+.-.    |..+               =++-.|.----.++|.+.+-+.+.   
T Consensus        35 ri~HAyLF~GP~GtGKts~ArifAkaLnC~~~~~~~pC~~C~~C~~i~~g~~~DviEidaas~~gVd~IRei~~~~~---  111 (557)
T PRK07270         35 KISHAYLFSGPRGTGKTSAAKIFAKAMNCPNQVDGEPCNNCDICRDITNGSLEDVIEIDAASNNGVDEIRDIRDKST---  111 (557)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHC---
T ss_conf             95404421089986899999999999579998999988877799998758999748734777678899999999842---


Q ss_pred             CCCCCCCCCHHHHHHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH
Q ss_conf             122358661245422899996-514875998654333211577899998998763022234301123102335225
Q gi|254780709|r  170 VCSEIGSDAAALAYEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN  244 (321)
Q Consensus       170 ~~~~~~~dp~~v~~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~  244 (321)
                                        ++- ..+|-|+|||-|-+|....-  +-|-       |..+..|..++|++=++--+.
T Consensus       112 ------------------~~P~~~~yKV~IIDEah~Ls~~A~--NALL-------KtLEEPP~~~vFIL~Ttep~k  160 (557)
T PRK07270        112 ------------------YAPSRATYKVYIIDEVHMLSTGAF--NALL-------KTLEEPTENVVFILATTELHK  160 (557)
T ss_pred             ------------------CCCCCCCEEEEEECCHHHCCHHHH--HHHH-------HHHHCCCCCEEEEEEECCHHH
T ss_conf             ------------------387778838999714453499999--9899-------985289987699998499475


No 138
>PRK08181 transposase; Validated
Probab=97.57  E-value=0.00079  Score=47.17  Aligned_cols=152  Identities=11%  Similarity=0.192  Sum_probs=86.2

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHH----HH-HHHHHHHCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             99999999973889899999999999875127899899999----99-99878520100121000136674123113544
Q gi|254780709|r   46 REELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLY----DV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVN  120 (321)
Q Consensus        46 leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~----~l-~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~n  120 (321)
                      .+++-..|++.-+...-.+.+..+++........+-+++..    .+ +..+..+.. ...  .+   .+..-++|+||+
T Consensus        42 ~~e~L~~Lle~E~~~R~~rr~~rrlk~A~fp~~ktLe~fDf~~~p~i~~~~i~~L~~-~~~--fi---~~~~Nvil~Gp~  115 (269)
T PRK08181         42 AARFLAAIAEHEIAERARRRIERHLAEAHLPPGKTLDSFDFEAVPMISKAQVMALAA-GDS--WL---AKGANLLLFGPP  115 (269)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCCCCHHHHHHHHC-CCH--HH---HCCCEEEEECCC
T ss_conf             999999999999999999999999986897998886547855689989999999965-675--88---648708998999


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             44424789999999852267426774345124568899999753035321223586612454228999965148759986
Q gi|254780709|r  121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIID  200 (321)
Q Consensus       121 G~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliD  200 (321)
                      |+|||--+.=||+..-++|++|..++++..    +++|+.-          ...++     ..+.+.  +..++|++|||
T Consensus       116 GtGKThLA~Alg~~A~~~G~~V~f~~~~~L----~~~L~~a----------~~~~~-----~~~~~~--~l~~~dLLIiD  174 (269)
T PRK08181        116 GGGKSHLAAAIGLALIENGWRVLFTRTTDL----VQKLQVA----------RRELQ-----LESAIA--KLDKFDLLILD  174 (269)
T ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEEEHHHH----HHHHHHH----------HHCCC-----HHHHHH--HHHCCCEEEEH
T ss_conf             987889999999999987993999789999----9999997----------75583-----999999--97444601220


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             543332115778999989987630222
Q gi|254780709|r  201 TAGRLHNNSILMAGIGKMIRVLKRLDP  227 (321)
Q Consensus       201 TAGR~~~~~~lm~EL~ki~~v~~~~~~  227 (321)
                      --|-.+.+..-.+   .+.++|....+
T Consensus       175 e~G~~~~~~~~~~---~lf~lI~~Rye  198 (269)
T PRK08181        175 DLAYVTKDQAETS---VLFELISARYE  198 (269)
T ss_pred             HCCCCCCCHHHHH---HHHHHHHHHHC
T ss_conf             1056679989999---99999999857


No 139
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=97.56  E-value=0.0016  Score=45.07  Aligned_cols=91  Identities=15%  Similarity=0.219  Sum_probs=52.6

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             41231135444442478999999985-22674267743451245688999997530353212235866124542289999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      -..+++.|.+|+||||.+--+|..+. ++|++|++++..--+-  ----+..+...++|......+.....- ++.+..+
T Consensus        13 G~L~vi~a~~g~GKS~~~~~la~~~a~~~g~~V~~~SlEm~~~--~~~~R~~s~~~~i~~~~i~~~~~~~~~-~~~~~~~   89 (242)
T cd00984          13 GDLIIIAARPSMGKTAFALNIAENIAKKQGKPVLFFSLEMSKE--QLLQRLLASESGISLSKLRTGSLSDED-WERLAEA   89 (242)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHH--HHHHHHHHHHHCCCHHHHHCCCCCHHH-HHHHHHH
T ss_conf             8189999689999999999999999997799599993335388--999999999829774553026522799-9999999


Q ss_pred             H--HHCCCEEEEECCCC
Q ss_conf             6--51487599865433
Q gi|254780709|r  190 Q--AKKVDVLIIDTAGR  204 (321)
Q Consensus       190 ~--~~~~DvvliDTAGR  204 (321)
                      .  ..+..+.+.|+.+.
T Consensus        90 ~~~~~~~~l~i~d~~~~  106 (242)
T cd00984          90 IGELKELPIYIDDSSSL  106 (242)
T ss_pred             HHHHCCCCEEEECCCCC
T ss_conf             99861698899669999


No 140
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=97.55  E-value=0.00048  Score=48.68  Aligned_cols=52  Identities=21%  Similarity=0.121  Sum_probs=43.6

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             31135444442478999999985226742677434512456889999975303532
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF  169 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~  169 (321)
                      .|+.|++|+||||-+..+++...++|.+|+.++++--    .+|+...+..+|.++
T Consensus         2 tLi~G~pGsGKT~~a~qfl~~~a~~ge~~lyis~eE~----~~~l~~~~~~~g~d~   53 (187)
T cd01124           2 TLLSGGPGTGKTTFALQFLYAGLARGEPGLYVTLEES----PEELIENAESLGWDL   53 (187)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCC----HHHHHHHHHHCCCCH
T ss_conf             1587689999999999999999876997899995079----999999999839985


No 141
>PRK11537 putative GTP-binding protein YjiA; Provisional
Probab=97.53  E-value=0.0089  Score=39.81  Aligned_cols=174  Identities=18%  Similarity=0.289  Sum_probs=92.6

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-------HHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999-------75303532122358661245422
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIW-------ADRTSADFVCSEIGSDAAALAYE  184 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~-------a~~~~v~~~~~~~~~dp~~v~~~  184 (321)
                      -|.++.|==|+||||-+-.|-+  ...+++++++-=|-=. ..+|.--.-       .-..|+  ++..-..|-..-..+
T Consensus         5 PVtiltGFLGaGKTTlL~~lL~--~~~~~riaVivNEfGe-v~iD~~li~~~~~~v~eL~nGC--iCCs~~~dl~~~l~~   79 (317)
T PRK11537          5 AVTLLTGFLGAGKTTLLRHILN--EQHGYKIAVIENEFGE-VSVDDQLIGDRATQIKTLTNGC--ICCSRSNELEDALLD   79 (317)
T ss_pred             CEEEEEECCCCCHHHHHHHHHH--CCCCCCEEEEEECCCC-CCCHHHHHHCCCCCEEEECCCC--EEEEECCHHHHHHHH
T ss_conf             8899830888899999999972--7789978999837614-5332988735653268844773--687305228999999


Q ss_pred             HHHHHHHH--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHH-HHCCCCEE
Q ss_conf             89999651--4875998654333211577899998998763022234301123102335225778999876-43589769
Q gi|254780709|r  185 AFKQAQAK--KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH-AVAGTTGL  261 (321)
Q Consensus       185 a~~~a~~~--~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~-~~~~~~g~  261 (321)
                      -++.....  .+|.|||-|.|- ..-..+++-+..- ..+..  ...-+-++=|+||..++.-.+.-..+. +..--|-+
T Consensus        80 l~~~~~~~~~~~D~IiIEtsGl-AdP~~I~~~~~~~-~~l~~--~~~Ld~vVtvVDa~~~~~~l~~~~~~~~Qi~~AD~i  155 (317)
T PRK11537         80 LLDNLDRGNIQFDRLVIECTGM-ADPGPIIQTFFSH-EVLCQ--RYLLDGVIALVDAVHADEQMNQFTIAQSQVGYADRI  155 (317)
T ss_pred             HHHHHHCCCCCCCEEEEECCCC-CCHHHHHHHHHHH-HHHHH--HEECCCEEEEEEHHHHHHHHHCCHHHHHHHHHCCEE
T ss_conf             9986643577754799962577-8839999998612-56565--320365599986655576653034667666318689


Q ss_pred             EEECCCCCCCHHHHHHHHHH--HCCCEEEEECCCC
Q ss_conf             99654578706999999999--7698899975898
Q gi|254780709|r  262 IMTKMDGTARGGGLIPIVVT--HKIPVYFLGVGEG  294 (321)
Q Consensus       262 I~TKlD~ta~~G~~ls~~~~--~~~Pi~fig~Ge~  294 (321)
                      +++|.|-.+.--.+......  ...||.....|+-
T Consensus       156 llnK~Dlv~~~~~l~~~l~~lNp~A~i~~~~~~~v  190 (317)
T PRK11537        156 LLTKTDVAGEAEKLRERLARINARAPVYTVTHGDI  190 (317)
T ss_pred             EEECCCCCCHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             97420023659999999998689984899646878


No 142
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and    vesicular transport]
Probab=97.53  E-value=0.00061  Score=47.99  Aligned_cols=123  Identities=28%  Similarity=0.345  Sum_probs=66.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      .|++|+.|+||||-+=       ..|.+        |+.+  +|....+.....     ....|+-   |      .   
T Consensus       128 y~viG~pgsGKTtal~-------~sgl~--------Fpl~--~~~~~~~~~~~g-----T~~cdww---f------~---  173 (1188)
T COG3523         128 YMVIGPPGSGKTTALL-------NSGLQ--------FPLA--EQMGALGLAGPG-----TRNCDWW---F------T---  173 (1188)
T ss_pred             EEEECCCCCCCCHHHH-------CCCCC--------CCCH--HHHCCCCCCCCC-----CCCCCCC---C------C---
T ss_conf             5885488898400875-------15536--------6615--553312226888-----7335754---2------5---


Q ss_pred             CCEEEEECCCCCCCHH----HHHHHHHHHHHHHHCCCCCCCCE-EEEECCC---CCCHHHHH--------H-----HHHH
Q ss_conf             8759986543332115----77899998998763022234301-1231023---35225778--------9-----9987
Q gi|254780709|r  194 VDVLIIDTAGRLHNNS----ILMAGIGKMIRVLKRLDPHAPHS-VLQVLDA---TTGQNALR--------Q-----VEMF  252 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~----~lm~EL~ki~~v~~~~~~~~p~~-~~lVlda---~~gq~~~~--------~-----a~~F  252 (321)
                      -+-|+||||||.....    .--.|=...-..+++.-...|.. +++.+|.   +++..+..        +     .+++
T Consensus       174 deaVlIDtaGry~~q~s~~~~~~~~W~~fL~lLkk~R~~~piNGiiltlsv~~L~~~~~~~~~~~~~~LR~RL~El~~tL  253 (1188)
T COG3523         174 DEAVLIDTAGRYITQDSADEVDRAEWLGFLGLLKKYRRRRPLNGIILTLSVSDLLTADPAEREALARTLRARLQELRETL  253 (1188)
T ss_pred             CCEEEECCCCCEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             53489858752443667502348889998889997355788863799978999738999999999999999999999841


Q ss_pred             HHHCCCCEEEEECCCCCCC
Q ss_conf             6435897699965457870
Q gi|254780709|r  253 HAVAGTTGLIMTKMDGTAR  271 (321)
Q Consensus       253 ~~~~~~~g~I~TKlD~ta~  271 (321)
                      +-.+|+ -+.+||+|--..
T Consensus       254 ~~~~PV-Yl~lTk~Dll~G  271 (1188)
T COG3523         254 HARLPV-YLVLTKADLLPG  271 (1188)
T ss_pred             CCCCCE-EEEEECCCCCCC
T ss_conf             567763-899862100215


No 143
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=97.52  E-value=0.00095  Score=46.61  Aligned_cols=142  Identities=23%  Similarity=0.278  Sum_probs=73.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      +|.++|-.-+||||-+-+|    .  +.++....     ++.+.|        .+..+..+     ..         ...
T Consensus         2 ~VaivG~~n~GKSTL~n~L----~--~~~~~~~~-----~~g~T~--------~i~~~~~~-----~~---------~~~   48 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKI----R--KTNVAAGE-----AGGITQ--------HIGAFEVP-----AE---------VLK   48 (168)
T ss_pred             EEEEEECCCCCHHHHHHHH----H--CCCCCEEE-----CCCCEE--------EECEEEEE-----EE---------ECC
T ss_conf             8999948998598999998----5--86750451-----698168--------71539999-----88---------258


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCC-CEEEEECCCC-
Q ss_conf             4875998654333211577899998998763022234301123102335225--77899987643589-7699965457-
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGT-TGLIMTKMDG-  268 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~-~g~I~TKlD~-  268 (321)
                      +..+.+|||+|  |.+.   .++..  +...     .-+-.+||+||..|-.  -.+.++.... .+. -=++++|+|- 
T Consensus        49 ~~~i~~iDTPG--h~~f---~~~~~--~~~~-----~aD~~ilvvda~~g~~~~~~~~~~~l~~-~~~p~ivviNKiD~~  115 (168)
T cd01887          49 IPGITFIDTPG--HEAF---TNMRA--RGAS-----LTDIAILVVAADDGVMPQTIEAIKLAKA-ANVPFIVALNKIDKP  115 (168)
T ss_pred             CCEEEEEECCC--CHHH---HHHHH--HHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHH-CCCCEEEEEECCCCC
T ss_conf             87189998998--1677---99999--9986-----2688999986466754589999999987-699789999893089


Q ss_pred             CCCHHHHHHHHHHH----------CCCEEEEEC--CCCCCCCCC
Q ss_conf             87069999999997----------698899975--898132555
Q gi|254780709|r  269 TARGGGLIPIVVTH----------KIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       269 ta~~G~~ls~~~~~----------~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      .+..--+.......          ..|+.+++.  |+++++|..
T Consensus       116 ~~~~~~v~~~l~~~~~~~~~~~~~~~~iIpvSA~tG~gi~~L~~  159 (168)
T cd01887         116 NANPERVKNELSELGLQGEDEWGGDVQIVPTSAKTGEGIDDLLE  159 (168)
T ss_pred             CCCHHHHHHHHHHHHCCCHHHCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             87989999999997545245528987599998999989999999


No 144
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=97.51  E-value=0.012  Score=38.86  Aligned_cols=168  Identities=18%  Similarity=0.243  Sum_probs=89.3

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCC-C----------------C----------CHHH---H-------HH
Q ss_conf             9999999999973889899999999999875127-8----------------9----------9899---9-------99
Q gi|254780709|r   44 GVREELEDLLIRSDIGVAVAQKIVEELLTKRYAK-D----------------V----------SVQR---V-------LY   86 (321)
Q Consensus        44 ~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~-~----------------i----------~~~~---i-------~~   86 (321)
                      +-.+++++.+-.+.+..++-+.+...+.+-..-. .                +          +...   +       +.
T Consensus       249 ~e~~~~~~ki~~~~~p~~~~~~~~~El~rl~~~~~~s~E~~v~r~YLd~l~~LPW~~~t~d~~dl~~A~~iLd~dHyGL~  328 (784)
T PRK10787        249 DENEALKRKIDAAKMPKEAKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLE  328 (784)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             48999999998779998999999999999971899894188999999999759988887875699999998765430657


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE----------CCCC---CHH
Q ss_conf             999987852010012100013667412311354444424789999999852267426774----------3451---245
Q gi|254780709|r   87 DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAA----------GDTF---RSA  153 (321)
Q Consensus        87 ~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva----------~Dtf---R~a  153 (321)
                      .+++-|.+.|.-.    ....+.+..+++||||.|||||+-.--+|.-+.++=.++-|..          --||   -||
T Consensus       329 ~vKeRile~lAv~----~~~~~~kg~IlclvGpPGvGKTSl~~sIA~al~r~f~rislGGv~DeaeirGHrrTYvgampG  404 (784)
T PRK10787        329 RVKDRILEYLAVQ----SRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYIGSMPG  404 (784)
T ss_pred             HHHHHHHHHHHHH----HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCH
T ss_conf             7999999999999----862467787799646998772469999999858986998068878888825643343443683


Q ss_pred             H-HHHHHHHHHHHCC------CCCCCCCCCCCHHHHHHHHHHHHHHC------------CCEEEEECCCCCCCHHHHHHH
Q ss_conf             6-8899999753035------32122358661245422899996514------------875998654333211577899
Q gi|254780709|r  154 A-IDQLKIWADRTSA------DFVCSEIGSDAAALAYEAFKQAQAKK------------VDVLIIDTAGRLHNNSILMAG  214 (321)
Q Consensus       154 A-~eQL~~~a~~~~v------~~~~~~~~~dp~~v~~~a~~~a~~~~------------~DvvliDTAGR~~~~~~lm~E  214 (321)
                      - ++.|+.-+...-|      +=.+.....||++..-+-++--++..            .+|++|-||--+..-..|.+-
T Consensus       405 rii~~l~~a~~~nPv~llDEiDK~~~~~~Gdp~salLEvLDpeQN~~F~Dhyl~~~~DlS~v~Fi~TaN~~~ip~pLlDR  484 (784)
T PRK10787        405 KLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDR  484 (784)
T ss_pred             HHHHHHHHHCCCCCEEEEHHHHHHCCCCCCCHHHHHHHHCCHHHCCCCCCCEEECCCCHHHEEEEEECCCCCCCHHHHHH
T ss_conf             89999997489885665003555224558998899998459765564000322046452225899732767787677631


Q ss_pred             H
Q ss_conf             9
Q gi|254780709|r  215 I  215 (321)
Q Consensus       215 L  215 (321)
                      |
T Consensus       485 m  485 (784)
T PRK10787        485 M  485 (784)
T ss_pred             E
T ss_conf             2


No 145
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223   This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. In Escherichia coli, the cell division site is determined by the cooperative activity of min operon products MinC, MinD, and MinE . MinD is a membrane-associated ATPase and is a septum site-determining factor through the activation and regulation of MinC and MinE. MinD is also known to undergo a rapid pole-to-pole oscillation movement in vivo as observed by fluorescent microscopy. In plants, chloroplast division requires the dimerisation of stromal MinD . The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model.; GO: 0016887 ATPase activity, 0000918 selection of site for barrier septum formation.
Probab=97.50  E-value=8.8e-05  Score=53.86  Aligned_cols=45  Identities=31%  Similarity=0.392  Sum_probs=39.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             3544444247899999998522674267743451245688999997530353
Q gi|254780709|r  117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       117 vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~  168 (321)
                      .|==|||||||.|=|+.=|.+.|+||.+|-+|.       =||.+==.||.+
T Consensus         8 SGKGGVGKTTtTANlG~aLA~lG~kVvliD~Di-------GLRNLD~~lGLE   52 (272)
T TIGR01968         8 SGKGGVGKTTTTANLGTALARLGKKVVLIDADI-------GLRNLDLLLGLE   52 (272)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC-------CCHHHHHHHCCC
T ss_conf             178897735898999999996198289995475-------703457774231


No 146
>pfam01583 APS_kinase Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Probab=97.50  E-value=0.00011  Score=53.32  Aligned_cols=43  Identities=30%  Similarity=0.577  Sum_probs=39.9

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             7412311354444424789999999852267426774345124
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS  152 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~  152 (321)
                      ++.||.|.|+.||||||-+.+|..+++.+|.+|.++-.|.+|.
T Consensus         1 kG~viW~TGLsGsGKTTlA~~l~~~L~~~~~~~~~LDGD~~R~   43 (157)
T pfam01583         1 RGCTVWFTGLSGSGKSTIANALERKLFAQGISVYVLDGDNVRH   43 (157)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHC
T ss_conf             9889998898999999999999999997599779976887750


No 147
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=97.49  E-value=0.0047  Score=41.73  Aligned_cols=148  Identities=21%  Similarity=0.181  Sum_probs=79.5

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             3113544444247899999998522--67426774345124568899999753035321223586612454228999965
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDA--GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~--g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      |.++|--++||||-+..|-......  +..+--...|..   ..||-+      |+.+       ++...-      +.-
T Consensus         2 v~iiGh~d~GKTTL~~~Ll~~~~~~~~~~~~~~~~~d~~---~~E~~r------giTi-------~~~~~~------~~~   59 (189)
T cd00881           2 VGIAGHVDHGKTTLTERLLYVTGDIERDGTVEETFLDVL---KEERER------GITI-------KSGVAT------FEW   59 (189)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCC---HHHHHC------CCEE-------EEEEEE------EEE
T ss_conf             899917998999999999976472356862588850577---788863------8413-------222799------998


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             1487599865433321157789999899876302223430112310233522-----57789998764358976999654
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEMFHAVAGTTGLIMTKM  266 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~F~~~~~~~g~I~TKl  266 (321)
                      +++-+.+|||+|  |  .+.+.+..   +.+.     ..+-.+||+||+.|-     ..+..++.++  +| -=++++|+
T Consensus        60 ~~~~i~~iDTPG--h--~~f~~~~~---~~l~-----~aD~ailvVda~~G~~~qt~~~~~~~~~~~--~p-~iv~iNKi  124 (189)
T cd00881          60 PDRRVNFIDTPG--H--EDFSSEVI---RGLS-----VSDGAILVVDANEGVQPQTREHLRIAREGG--LP-IIVAINKI  124 (189)
T ss_pred             CCEEEEEEECCC--C--HHHHHHHH---HHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHCC--CC-EEEEEECC
T ss_conf             998999996998--1--88999999---9986-----468569999879899878999999999769--98-79999897


Q ss_pred             CCCC--CHH-HHHHHHHH-----------------HCCCEEEEEC--CCCCCCC
Q ss_conf             5787--069-99999999-----------------7698899975--8981325
Q gi|254780709|r  267 DGTA--RGG-GLIPIVVT-----------------HKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       267 D~ta--~~G-~~ls~~~~-----------------~~~Pi~fig~--Ge~i~Dl  298 (321)
                      |-..  +.- ..-.+...                 ...||.+++-  |+++++|
T Consensus       125 D~~~~~~~~~~~~ei~~~l~~~~~~~~~~~~~~~~~~~piv~iSA~~G~gv~~L  178 (189)
T cd00881         125 DRVGEEDLEEVLREIKELLGLIGFISTKEEGTRNGLLVPIVPGSALTGIGVEEL  178 (189)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCEEEEEECCCCCCHHHH
T ss_conf             187756299999999999875321023211012588775999888678697999


No 148
>PRK06674 DNA polymerase III subunits gamma and tau; Validated
Probab=97.49  E-value=0.0039  Score=42.35  Aligned_cols=28  Identities=29%  Similarity=0.488  Sum_probs=21.9

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      .-|+.++|.||.|+||||++--+|..+.
T Consensus        36 ri~HAyLF~GprGtGKts~Ari~AkaLn   63 (563)
T PRK06674         36 KVSHAYLFSGPRGTGKTSIAKVFAKAVN   63 (563)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             9650343128998689999999999857


No 149
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional
Probab=97.49  E-value=0.0041  Score=42.18  Aligned_cols=171  Identities=18%  Similarity=0.224  Sum_probs=94.5

Q ss_pred             EECCCCC-CCCHHHHHHHHHHHHHHCCCCEEE--EECCCCCHHHHHHHHHHHHHHCCCCCCCCCC-CCCHHHHHHHHHHH
Q ss_conf             3113544-444247899999998522674267--7434512456889999975303532122358-66124542289999
Q gi|254780709|r  114 ILVVGVN-GVGKTTVIGKLSKKMSDAGLKVML--AAGDTFRSAAIDQLKIWADRTSADFVCSEIG-SDAAALAYEAFKQA  189 (321)
Q Consensus       114 il~vG~n-G~GKTTT~aKLA~~~~~~g~kV~l--va~DtfR~aA~eQL~~~a~~~~v~~~~~~~~-~dp~~v~~~a~~~a  189 (321)
                      +++.|+. |+||||-+.=|.+.++++|.+|.-  +--|---|      ..+....|.|.+.-..- ..+..| ....   
T Consensus         4 ilIAa~~SgsGKTtvt~gL~~aL~~rG~~Vq~FK~GPDYIDP------~~h~~a~G~~~~NLD~~m~~~~~v-~~~~---   73 (432)
T PRK13896          4 VVLAGTSSGVGKTVATLAVLQALADAGYDVQPAKAGPDFIDP------SHHEAVVDTPSRSLDPWLSGEDGM-RRTY---   73 (432)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCH------HHHHHHHCCCCCCCCHHHCCHHHH-HHHH---
T ss_conf             899778999989999999999999784963766668475198------999999689844689101898999-9999---


Q ss_pred             HHHCCCEEEEECCCCCCC-HHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC-CCHHHHHHHHHHHHH-------CCCCE
Q ss_conf             651487599865433321-157789999899876302223430112310233-522577899987643-------58976
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHN-NSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT-TGQNALRQVEMFHAV-------AGTTG  260 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~-~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~-~gq~~~~~a~~F~~~-------~~~~g  260 (321)
                      .....|+.+|.-.==+.- +..=-.|+.++-   +       --++||+|+. ..+.+.-+++-|.++       +++-|
T Consensus        74 ~~~~aDiaviEGvMGLyDG~~~Sta~lA~~l---~-------~PVvLVvd~~~~~~s~aA~v~G~~~f~~~~~~d~~iaG  143 (432)
T PRK13896         74 WRGTGDVCVVEGMMGLYDGTVASTAAVAEEL---D-------LPVVLVVDAKAGMESVAATALGFQAYADRAGVDIDVAG  143 (432)
T ss_pred             HHCCCCEEEEEECCCCCCCCCCCHHHHHHHH---C-------CCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             7279986999612324578877589999984---9-------99899993320188899999999972412476524766


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             99965457870699999999976988999758981325557789999987286
Q gi|254780709|r  261 LIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC  313 (321)
Q Consensus       261 ~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~  313 (321)
                      ||+.++-+......+-..+.. ++|+  +|.=.+.+++.      +-+|=||+
T Consensus       144 VIlN~v~s~rh~~~l~~al~~-~i~v--lG~lPr~~~l~------lp~RHLGL  187 (432)
T PRK13896        144 VLAQRAHGGRHADGIRDALPD-ELTY--FGRVPPRSDLE------IPDRHLGL  187 (432)
T ss_pred             EEECCCCCHHHHHHHHHHHHC-CCCE--EEEECCCCCCC------CCCCCCCC
T ss_conf             884267758899999999870-8948--98842477789------84102598


No 150
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=97.48  E-value=0.0047  Score=41.74  Aligned_cols=127  Identities=17%  Similarity=0.205  Sum_probs=61.7

Q ss_pred             CCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCC-CCCCCHHHHHH
Q ss_conf             6674-1231135444442478999999985226742677434512456889999975303532-1223-58661245422
Q gi|254780709|r  108 SHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSE-IGSDAAALAYE  184 (321)
Q Consensus       108 ~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~-~~~dp~~v~~~  184 (321)
                      +++| ..+||+||+|||||-++-.||.++-.....  ||..|-   .=+-.=-..+.-+|.|= |.+. .|.    ...+
T Consensus       592 ~~rPigsFLFlGPTGVGKTElAK~LA~~LFg~e~~--liR~DM---SEy~E~hsvsrLiGaPPGYVGy~eGG----~LTe  662 (852)
T TIGR03345       592 PRKPLGVFLLVGPSGVGKTETALALAELLYGGEQN--LITINM---SEFQEAHTVSRLKGSPPGYVGYGEGG----VLTE  662 (852)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCC--EEEECC---HHHCCHHHHHHHCCCCCCCCCCCCCC----HHHH
T ss_conf             99985689987899877899999999997198611--478422---43210436878638999766748777----2109


Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCCHHHH
Q ss_conf             8999965148759986543332115-77899998998763022-23430112310233522577
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGRLHNNS-ILMAGIGKMIRVLKRLD-PHAPHSVLQVLDATTGQNAL  246 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR~~~~~-~lm~EL~ki~~v~~~~~-~~~p~~~~lVlda~~gq~~~  246 (321)
                      ++   +.+-|-|||.|---.-|-|. |++-++-.--+.-.... ...--.++.++-++.|.+.+
T Consensus       663 ~V---rr~PysVvLfDEIEKAHpdV~nilLQvlD~G~LtD~~Gr~vdF~NtIIImTSN~Gs~~i  723 (852)
T TIGR03345       663 AV---RRKPYSVVLLDEVEKAHPDVLELFYQVFDKGVMEDGEGREIDFKNTVILLTSNAGSDLI  723 (852)
T ss_pred             HH---HHCCCEEEEECHHHHCCHHHHHHHHHHHCCCEEECCCCCEEECEEEEEEECCCHHHHHH
T ss_conf             88---80998688861130028899999998724677757999988452129997572447999


No 151
>pfam08433 KTI12 Chromatin associated protein KTI12. This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II. The Elongator complex has histone acetyltransferase activity.
Probab=97.46  E-value=0.00022  Score=51.11  Aligned_cols=74  Identities=20%  Similarity=0.290  Sum_probs=50.8

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC-CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             3113544444247899999998522674267743451245688999997530353212-235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC-SEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~-~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      |+|+|..+|||||.+..|+.++..+|++|.+|.-|+.+..--             .|. ...+...-+..+.+++.+..+
T Consensus         2 ivl~G~P~SGKSt~A~~L~~~l~~~~~~v~vi~d~~~~~~~~-------------~y~~s~~Ek~~R~~l~s~v~r~Ls~   68 (266)
T pfam08433         2 IILTGLPSSGKSTRAKELAKYLEEKGYDVIVISDESLGIESD-------------DYKDSKKEKFLRGSLRSAVKRDLSK   68 (266)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC-------------CCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             798579999688999999999997599389978001267531-------------0001047899999999999875166


Q ss_pred             CCCEEEEEC
Q ss_conf             487599865
Q gi|254780709|r  193 KVDVLIIDT  201 (321)
Q Consensus       193 ~~DvvliDT  201 (321)
                      + ++||+|.
T Consensus        69 ~-~iVIlD~   76 (266)
T pfam08433        69 N-TIVIVDS   76 (266)
T ss_pred             C-CEEEECC
T ss_conf             8-8899548


No 152
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=97.46  E-value=0.00091  Score=46.76  Aligned_cols=118  Identities=19%  Similarity=0.245  Sum_probs=59.9

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHH
Q ss_conf             667412311354444424789999999852-2674267743451245688999997530353212235866-12454228
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD-AAALAYEA  185 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~d-p~~v~~~a  185 (321)
                      ..-|+.++|.||.|+||||++--+|+.+.- .+..  --+|+.-+.     -+...+....+++.....+. -..-+++-
T Consensus        33 ~Rl~HAYLFsGPrGvGKTt~ArifAkaLnC~~~~~--~~PCg~C~s-----C~~i~~g~hpDViEiDaasn~gID~IReL  105 (523)
T PRK08451         33 NRLAHAYLFSGLRGSGKTSSARIFSRALVCEQGPS--STPCGTCAQ-----CQAALEGRHIDIIEMDAASNRGIDDIRNL  105 (523)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCC--CCCCCCCHH-----HHHHHCCCCCCEEEECCCCCCCHHHHHHH
T ss_conf             99671587578998688999999999975999999--898887888-----99986489998551055333689999999


Q ss_pred             HHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             99996----5148759986543332115778999989987630222343011231023352
Q gi|254780709|r  186 FKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       186 ~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      ++.+.    ..+|-|+|||-|-+|+...-  +-|       =|..+..|..+++++ +||-
T Consensus       106 ie~~~~~P~~gryKV~IIDEah~Lt~~A~--NAL-------LKTLEEPP~~vvFIL-aTTe  156 (523)
T PRK08451        106 IEQTKYKPSMARFKIFIIDEVHMLTKEAF--NAL-------LKTLEEPPSYVKFIL-ATTD  156 (523)
T ss_pred             HHHHCCCCCCCCEEEEEEECCCCCCHHHH--HHH-------HHHCCCCCCCCEEEE-ECCC
T ss_conf             99723588679727999826030489999--999-------997038987837999-7599


No 153
>PRK06696 uridine kinase; Validated
Probab=97.43  E-value=0.00016  Score=52.03  Aligned_cols=47  Identities=28%  Similarity=0.449  Sum_probs=41.4

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             66741231135444442478999999985226742677434512456
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
                      .++|.+|.+-|+.||||||-+.+||..+...|..|+.+..|-|=-..
T Consensus        23 p~rpl~VgIdG~~gSGKTTlA~~La~~L~~~G~~V~~v~~Ddf~~~~   69 (227)
T PRK06696         23 LTRPLRVAIDGITASGKTTFANELAEEIKKRGRPVIRASIDDFHNPK   69 (227)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             99868999778998787999999999997469948997154434737


No 154
>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=97.43  E-value=0.00036  Score=49.59  Aligned_cols=116  Identities=25%  Similarity=0.309  Sum_probs=63.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCE-EEEEC----CCCCHH------HHHHHHHHHHHHCCC-C-CCCCCCCCCHH
Q ss_conf             31135444442478999999985226742-67743----451245------688999997530353-2-12235866124
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKV-MLAAG----DTFRSA------AIDQLKIWADRTSAD-F-VCSEIGSDAAA  180 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV-~lva~----DtfR~a------A~eQL~~~a~~~~v~-~-~~~~~~~dp~~  180 (321)
                      |++.|+.|+||||-+-|++..++..|.+| ++.+-    +-.|.|      +-.+ +.|-.+.+.+ . -.+.+.-++.+
T Consensus         2 i~ITG~pGvGKTTli~kv~~~l~~~~~~v~GF~T~evre~g~R~GF~iv~l~~g~-~~~la~~~~~~~~~vGky~v~~~~   80 (168)
T pfam03266         2 IFITGPPGVGKTTLVKKVIELLKSEGVKVGGFYTPEVREGGRRIGFDIVDLASGE-RGPLARVGGVSGPRVGKYVVNLEE   80 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCEECCCCEEEEEEEECCCCC-EEEEEEECCCCCCCCCCCEECHHH
T ss_conf             8997899988999999999999867970748993021258937899999904782-677444068877545771666899


Q ss_pred             ---HHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             ---5422899996514875998654333211577899998998763022234301123102
Q gi|254780709|r  181 ---LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD  238 (321)
Q Consensus       181 ---v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVld  238 (321)
                         ++-.++..+ ....|+++||--|+|........+  .+.++++   +  +.-++.|+.
T Consensus        81 fe~~~~~~L~~a-~~~~dlivIDEIG~mEl~s~~F~~--~v~~~l~---~--~~~vl~ti~  133 (168)
T pfam03266        81 FEEIALPALRRA-LEEADLIIIDEIGPMELKSPKFRE--AIEEVLS---S--NKPVLAVVH  133 (168)
T ss_pred             HHHHHHHHHHHC-CCCCCEEEEECCCHHHHHHHHHHH--HHHHHHC---C--CCCEEEEEE
T ss_conf             999999999840-668989999763145331499999--9999966---9--997999997


No 155
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=97.43  E-value=0.003  Score=43.08  Aligned_cols=132  Identities=17%  Similarity=0.209  Sum_probs=65.9

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCC--CCEEEEECCCCCHHHHHHHHHHHHHHC-----CC--CCCCCCC-------
Q ss_conf             1231135444442478999999985226--742677434512456889999975303-----53--2122358-------
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAG--LKVMLAAGDTFRSAAIDQLKIWADRTS-----AD--FVCSEIG-------  175 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g--~kV~lva~DtfR~aA~eQL~~~a~~~~-----v~--~~~~~~~-------  175 (321)
                      ..+++.+++|+|||++...++.++..++  .+|+++ +.  |...++|....-+...     ..  ++.....       
T Consensus        25 ~~~~i~~~tGsGKT~~~~~~~~~~~~~~~~~~~li~-~P--~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  101 (201)
T smart00487       25 RDVILAAPTGSGKTLAALLPALEALKRGKGKRVLVL-VP--TRELAEQWAEELKKLGPSLGLKVVGLYGGDSKREQLRKL  101 (201)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEE-EC--CHHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHHHHHHH
T ss_conf             988998999960999999999998633899759999-08--599999999886010210204455652477379999999


Q ss_pred             -CCCHHHHHHH---HHHH------HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             -6612454228---9999------65148759986543332115778999989987630222343011231023352257
Q gi|254780709|r  176 -SDAAALAYEA---FKQA------QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA  245 (321)
Q Consensus       176 -~dp~~v~~~a---~~~a------~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~  245 (321)
                       .....|..-+   +...      ...++++|+||=|=+.... .....+..+...+      .+.-.++.++||-..+.
T Consensus       102 ~~~~~~i~i~t~~~l~~~~~~~~~~~~~~~~vIiDE~H~~~~~-~~~~~~~~~~~~~------~~~~~~i~lSAT~~~~~  174 (201)
T smart00487      102 ESGKTDILVTTPGRLLDLLENDLLELSNVDLVILDEAHRLLDG-GFGDQLEKLLKLL------PKNVQLLLLSATPPEEI  174 (201)
T ss_pred             HCCCCCEEEECHHHHHHHHHHCCCCCCCCEEEEEECHHHHHCC-CCHHHHHHHHHHC------CCCCCEEEECCCCCHHH
T ss_conf             7599989995589999999727545254319999896775125-7099999999967------99997899924898689


Q ss_pred             HHHHHHHH
Q ss_conf             78999876
Q gi|254780709|r  246 LRQVEMFH  253 (321)
Q Consensus       246 ~~~a~~F~  253 (321)
                      .+....|.
T Consensus       175 ~~~~~~~~  182 (201)
T smart00487      175 ENLLELFL  182 (201)
T ss_pred             HHHHHHHC
T ss_conf             99999978


No 156
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=97.43  E-value=0.0013  Score=45.59  Aligned_cols=134  Identities=22%  Similarity=0.192  Sum_probs=66.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH------HHCC--CCC--CCC----CCCCCH
Q ss_conf             31135444442478999999985226742677434512456889999975------3035--321--223----586612
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD------RTSA--DFV--CSE----IGSDAA  179 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~------~~~v--~~~--~~~----~~~dp~  179 (321)
                      |.++|.-.+||||.++-|-.-           ..|.-|-.|...+-.|-.      -..+  .++  ...    ...++.
T Consensus         2 v~v~GhVD~GKSTL~G~Lt~g-----------~lDdGrg~ar~~~~rh~hE~~~G~Tssi~~~~lgf~~~g~~~~~~~~~   70 (224)
T cd04165           2 VAVVGNVDAGKSTLLGVLTQG-----------ELDNGRGKARLNLFRHKHEVESGRTSSVSNEILGFDSDGEVVNYPDNH   70 (224)
T ss_pred             EEEEECCCCCHHHHHHHHHCC-----------CCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCEECCCCCC
T ss_conf             899948588488999998567-----------742221067778776189997265441156554010145320213476


Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHHH
Q ss_conf             45422899996514875998654333211577899998998763022234301123102335225-----7789998764
Q gi|254780709|r  180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFHA  254 (321)
Q Consensus       180 ~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~~  254 (321)
                      .. ..+.+.+...+.-+.+||++|--..-.+.+.-+          ....||..+||++|..|-.     -+..+...  
T Consensus        71 ~~-~~~~~~~~~~~k~it~iD~pGH~~y~kt~i~G~----------~~~~~d~~~LvV~A~~G~~~~T~ehl~l~~~l--  137 (224)
T cd04165          71 LS-ESDIEICEKSSKLVTFIDLAGHERYLKTTLFGL----------TGYAPDYAMLVVAANAGIIGMTKEHLGLALAL--  137 (224)
T ss_pred             CC-CCCEEEECCCCCEEEEEECCCHHHHHHHHHHHH----------HCCCCCEEEEEEECCCCCHHHHHHHHHHHHHH--
T ss_conf             54-422012136786799997887399999999876----------35568989999317889779999999999983--


Q ss_pred             HCCCCEEEEECCCCCCCH
Q ss_conf             358976999654578706
Q gi|254780709|r  255 VAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       255 ~~~~~g~I~TKlD~ta~~  272 (321)
                      .+|+ -+++||+|-..+.
T Consensus       138 ~ip~-~vvitKiDl~~~~  154 (224)
T cd04165         138 NIPV-FVVVTKIDLAPAN  154 (224)
T ss_pred             CCCE-EEEEECCCCCCHH
T ss_conf             9998-9999897768989


No 157
>cd03112 CobW_like The function of this protein family is unkown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.
Probab=97.43  E-value=0.0013  Score=45.76  Aligned_cols=146  Identities=19%  Similarity=0.257  Sum_probs=78.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCC-------CCCHHHHHHH
Q ss_conf             231135444442478999999985226742677434512456889999975303532122358-------6612454228
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIG-------SDAAALAYEA  185 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~-------~dp~~v~~~a  185 (321)
                      |.++.|-=|+||||.+-++...  ..|++++++--|.=..+ +|.--.  ...+.+++.-..|       .|-..-..+.
T Consensus         2 v~iitGFLGaGKTTll~~lL~~--~~~~~~avIvNEfG~~~-ID~~ll--~~~~~~v~el~~GCiCCs~~~dl~~~l~~l   76 (158)
T cd03112           2 VTVLTGFLGAGKTTLLNHILTE--QHGRKIAVIENEFGEVG-IDNQLV--VDTDEEIIEMNNGCICCTVRGDLIRALLDL   76 (158)
T ss_pred             EEEEEECCCCCHHHHHHHHHHC--CCCCCEEEEEECCCCCC-CCHHHH--HCCCCEEEEECCCEEEEECCCHHHHHHHHH
T ss_conf             0899848889999999999847--88997799970765546-316676--378824999338714652251589999999


Q ss_pred             HHHHH--HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHCCCCEEE
Q ss_conf             99996--51487599865433321157789999899876302223430112310233522577899-9876435897699
Q gi|254780709|r  186 FKQAQ--AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVAGTTGLI  262 (321)
Q Consensus       186 ~~~a~--~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~~~~g~I  262 (321)
                      ++...  ...+|.|+|-|.|=-+ -.++++-+.. ...+.  ..-..+-++-|+||.......+.. ....+...-+-++
T Consensus        77 ~~~~~~~~~~~d~iiIE~SGla~-P~~i~~~~~~-~~~l~--~~~~l~~vi~vVDa~~~~~~~~~~~~~~~Qi~~AD~iv  152 (158)
T cd03112          77 LERLDAGKIAFDRIVIETTGLAD-PGPVAQTFFM-DEELA--ERYLLDGVITLVDAKHANQHLDQQTEAQSQIAFADRIL  152 (158)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCC-CHHHHHHHHC-CHHHH--CEEECCCEEEEECHHHHHHHHHCCHHHHHHHHHCCEEE
T ss_conf             99765157887889996368788-2899998860-71432--10743876999818987764324469999999689999


Q ss_pred             EECCC
Q ss_conf             96545
Q gi|254780709|r  263 MTKMD  267 (321)
Q Consensus       263 ~TKlD  267 (321)
                      ++|.|
T Consensus       153 lnK~D  157 (158)
T cd03112         153 LNKTD  157 (158)
T ss_pred             EECCC
T ss_conf             96677


No 158
>pfam00154 RecA recA bacterial DNA recombination protein. RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyses an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination.
Probab=97.43  E-value=0.0025  Score=43.65  Aligned_cols=95  Identities=19%  Similarity=0.259  Sum_probs=64.9

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---CCCCCCCCHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321---223586612454228999
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---CSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---~~~~~~dp~~v~~~a~~~  188 (321)
                      .++.+.|+.++||||.+..+.+..++.|..|+.+-+-  .+--    ..|++.+||++=   ..++  |.+.-+++.++.
T Consensus        53 Ri~ei~G~essGKTtlal~~ia~aQk~gg~~~~iD~E--~a~d----~~~a~~lGVD~~~l~~~qp--d~~Eqal~i~~~  124 (322)
T pfam00154        53 RIIEIYGPESSGKTTLALHAIAEAQKAGGTAAFIDAE--HALD----PVYAKKLGVDIDNLLVSQP--DTGEQALEIADM  124 (322)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH--HHCC----HHHHHHCCCCHHHEEEECC--CHHHHHHHHHHH
T ss_conf             0899988987778999999999997349938998536--6059----8899980988025389778--839999999999


Q ss_pred             HHH-HCCCEEEEECCCCCCCHHHHHHH
Q ss_conf             965-14875998654333211577899
Q gi|254780709|r  189 AQA-KKVDVLIIDTAGRLHNNSILMAG  214 (321)
Q Consensus       189 a~~-~~~DvvliDTAGR~~~~~~lm~E  214 (321)
                      ... ...|+|++|.-|-+....++-.+
T Consensus       125 li~~~~~~liViDSvaal~p~~E~e~~  151 (322)
T pfam00154       125 LVRSGAVDLIVVDSVAALVPKAEIEGE  151 (322)
T ss_pred             HHCCCCCCEEEEECCCCCCCHHHHHHH
T ss_conf             853799765998253456768887524


No 159
>KOG1532 consensus
Probab=97.43  E-value=0.00049  Score=48.64  Aligned_cols=43  Identities=33%  Similarity=0.478  Sum_probs=37.5

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             3667412311354444424789999999852267426774345
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      ...+|.+|+++|--||||||-+-+|-.++..++..+-+|..|.
T Consensus        15 ~~~~p~~ilVvGMAGSGKTTF~QrL~~hl~~~~~ppYviNLDP   57 (366)
T KOG1532          15 AIQRPVIILVVGMAGSGKTTFMQRLNSHLHAKKTPPYVINLDP   57 (366)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECCH
T ss_conf             5568707999944778841399999999862369980886788


No 160
>CHL00095 clpC Clp protease ATP binding subunit
Probab=97.42  E-value=0.0035  Score=42.67  Aligned_cols=128  Identities=17%  Similarity=0.166  Sum_probs=65.0

Q ss_pred             CCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCC-CCCCCHHHHH
Q ss_conf             36674-1231135444442478999999985226742677434512456889999975303532-1223-5866124542
Q gi|254780709|r  107 FSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSE-IGSDAAALAY  183 (321)
Q Consensus       107 ~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~-~~~dp~~v~~  183 (321)
                      .+++| ..+||+||+|||||-++-.||.++-.....  |+..|--   -+-.=-..+.-+|.|= |.+. .|..    ..
T Consensus       534 ~~~rPigsFlf~GPTGvGKTElAK~LA~~LFg~e~~--liR~DMS---Ey~E~hsvsrLIGaPPGYVGy~eGG~----LT  604 (823)
T CHL00095        534 NPNRPIASFIFCGPTGVGKTELTKALASYFFGSEEA--MIRLDMS---EYMEKHTVSKLIGSPPGYVGYNEGGQ----LT  604 (823)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCC--EEEECCC---CCCCCCCHHHHCCCCCCCCCCCCCCC----HH
T ss_conf             899974689987899887799999999997478202--5885351---01554207674589987667787882----01


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHCCCC-CCCCEEEEECCCCCCHHHH
Q ss_conf             2899996514875998654333211-5778999989987630222-3430112310233522577
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNN-SILMAGIGKMIRVLKRLDP-HAPHSVLQVLDATTGQNAL  246 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~-~~lm~EL~ki~~v~~~~~~-~~p~~~~lVlda~~gq~~~  246 (321)
                      +++   +.+-|-|||.|-----|-| -|++-++-.=-+.-..... ..---+++++-++.|...+
T Consensus       605 eaV---rr~PysVvLfDEIEKAHpdV~nilLQvlDdG~LtD~~Gr~vdF~NtIIImTSNlGs~~i  666 (823)
T CHL00095        605 EAV---RKKPYTVVLFDEIEKAHPDIFNLLLQILDDGRLTDSKGRTIDFKNTLIIMTSNLGSKVI  666 (823)
T ss_pred             HHH---HCCCCEEEEECHHHHCCHHHHHHHHHHCCCCCCCCCCCCEEECEEEEEEECCCCCHHHH
T ss_conf             988---71998699862131138899998876516884348999988431039997165055888


No 161
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=97.42  E-value=0.012  Score=38.93  Aligned_cols=144  Identities=23%  Similarity=0.237  Sum_probs=71.6

Q ss_pred             HCCCCHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC---CCCCEEECCCCCCCCHHHHHHH
Q ss_conf             73889899999999999875127-8998999999999878520100121000136---6741231135444442478999
Q gi|254780709|r   55 RSDIGVAVAQKIVEELLTKRYAK-DVSVQRVLYDVSELIHKMLMPLSKPFNWDFS---HRPHVILVVGVNGVGKTTVIGK  130 (321)
Q Consensus        55 ~ADVg~~va~~Iie~ik~~~~~~-~i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~---~~p~vil~vG~nG~GKTTT~aK  130 (321)
                      ...++...+++|++..++..... -.+..++...-+ .+..+ .-....++.-..   ..-.|.=+.|+.|+|||.-|--
T Consensus        45 ~~gis~~~a~ki~~~a~~~~~~~~f~Ta~el~~~r~-~~~~i-sTg~~~lD~lLgGGi~~g~ITEi~Ge~gsGKTQlc~q  122 (318)
T PRK04301         45 IAGISESTAAKIIEAAREALDIGGFETALEVLERRK-SIGKI-TTGSKELDELLGGGIETQSITEFYGEFGSGKTQICHQ  122 (318)
T ss_pred             HHCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH-CCCCC-CCCCHHHHHHCCCCCCCCEEEEEECCCCCCCHHHHHH
T ss_conf             509999999999999998536579826999999863-47824-7888788805479833670788866887870356677


Q ss_pred             HHHHHH---HC---CCCEEEEEC-CCCCHHHHHHHHHHHHHHCCC--------CCCCCCCCC-CHHHHHHHHHHHHH-HC
Q ss_conf             999985---22---674267743-451245688999997530353--------212235866-12454228999965-14
Q gi|254780709|r  131 LSKKMS---DA---GLKVMLAAG-DTFRSAAIDQLKIWADRTSAD--------FVCSEIGSD-AAALAYEAFKQAQA-KK  193 (321)
Q Consensus       131 LA~~~~---~~---g~kV~lva~-DtfR~aA~eQL~~~a~~~~v~--------~~~~~~~~d-p~~v~~~a~~~a~~-~~  193 (321)
                      ||-..+   ..   +.+|+.|.+ .||||-=+.|+   |++.+.+        +|....+.+ -..++..+...... +.
T Consensus       123 Lav~~qlp~~~GGl~g~vvYIDTEgtF~peRi~qi---a~~~g~d~~~~L~nI~v~r~~~~~~q~~~~~~~~~~~~~~~~  199 (318)
T PRK04301        123 LAVNVQLPEEEGGLEGKAVYIDTENTFRPERIEQM---AEGLGLDPDEVLDNIHVARAYNSDHQMLLAEKAEELIKEGNN  199 (318)
T ss_pred             HHHHEECCHHHCCCCCCEEEEECCCCCCHHHHHHH---HHHHCCCHHHHHHCEEEEECCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             67653376777898863799956898697999999---998499978986402686139989999999999999962788


Q ss_pred             CCEEEEECCC
Q ss_conf             8759986543
Q gi|254780709|r  194 VDVLIIDTAG  203 (321)
Q Consensus       194 ~DvvliDTAG  203 (321)
                      +.+|+||++-
T Consensus       200 v~LvVvDSi~  209 (318)
T PRK04301        200 IKLVIVDSLT  209 (318)
T ss_pred             CEEEEEECCH
T ss_conf             0499994342


No 162
>PRK03846 adenylylsulfate kinase; Provisional
Probab=97.41  E-value=0.00015  Score=52.19  Aligned_cols=46  Identities=33%  Similarity=0.623  Sum_probs=42.6

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH
Q ss_conf             6674123113544444247899999998522674267743451245
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA  153 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~a  153 (321)
                      .++|.||-|.|+.||||||-+-+|...+.+.|.++.++-+|.+|.+
T Consensus        21 ~~kg~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LDGD~lR~~   66 (198)
T PRK03846         21 GHKGVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLLDGDNVRHG   66 (198)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECHHHHHHH
T ss_conf             8998699987999998899999999999975997599777999874


No 163
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=97.41  E-value=0.004  Score=42.23  Aligned_cols=162  Identities=14%  Similarity=0.125  Sum_probs=81.6

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             98999999999878520100121000136674123113544444247899999998522674267743451245688999
Q gi|254780709|r   80 SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLK  159 (321)
Q Consensus        80 ~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~  159 (321)
                      ..+.++..|+..+..-=.....+ ....+.-.+-++|+||.|+||||++--+|..+.-.+...  .+|..-+.-   +.-
T Consensus         9 GQe~v~~~L~~A~~~~R~~~~~~-~~~~~~~~HAyLF~Gp~G~Gk~~~A~~~A~~l~C~~~~~--~~cg~C~~C---~~i   82 (395)
T PRK07940          9 GQDAVVAELRAAARAARADSAHS-AAAGSGMTHAWLFTGPPGSGRSNAARAFAAALQCTDPGV--PGCGECRAC---RTV   82 (395)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCC-CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCC--CCCCCCHHH---HHH
T ss_conf             92999999999998363434433-334687660376368998788999999999966999999--999878789---998


Q ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             9975303532122358661245422899996----514875998654333211577899998998763022234301123
Q gi|254780709|r  160 IWADRTSADFVCSEIGSDAAALAYEAFKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       160 ~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
                      .-+..-++-++..+..+-...=+++-++.+.    ..+|-|+|||-|-||.....         +.+=|..+..|..+++
T Consensus        83 ~~g~hpDv~~i~p~~~~i~id~iR~l~~~~~~~p~~~~~kv~ii~~a~~m~~~a~---------NalLKtLEEPp~~~~f  153 (395)
T PRK07940         83 LAGTHPDVRVVVPEGLSIGVDEVREIVQIAARRPTTGRWRIVVIEDADRLTERAA---------NALLKAVEEPPPRTVW  153 (395)
T ss_pred             HCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHCHHHH---------HHHHHHHCCCCCCEEE
T ss_conf             7689987189826877688999999999985273037955999807787489999---------9999852178888699


Q ss_pred             ECCCCCCHHHHHHHHHHHHHC
Q ss_conf             102335225778999876435
Q gi|254780709|r  236 VLDATTGQNALRQVEMFHAVA  256 (321)
Q Consensus       236 Vlda~~gq~~~~~a~~F~~~~  256 (321)
                      ++=++..+..+..+..=.+.+
T Consensus       154 iL~t~~~~~llpTI~SRcq~~  174 (395)
T PRK07940        154 LLCAPSVEDVLPTIRSRCRHV  174 (395)
T ss_pred             EEEECCHHHHHHHHHHHHEEC
T ss_conf             987399787446887440002


No 164
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=97.41  E-value=0.004  Score=42.21  Aligned_cols=145  Identities=23%  Similarity=0.339  Sum_probs=73.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             13544444247899999998522674267743451245688999997530353212235866124542289999651487
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVD  195 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~D  195 (321)
                      ++|..++||+|-+-.|.      |.++..++-                .-+.   +    .||.....+     ......
T Consensus         1 ivG~~N~GKStL~N~L~------~~~~~~vs~----------------~~gt---T----~~~~~~~~~-----~~~~~~   46 (163)
T cd00880           1 LFGRTNAGKSSLLNALL------GQEVAIVSP----------------VPGT---T----TDPVEYVWE-----LGPLGP   46 (163)
T ss_pred             CCCCCCCCHHHHHHHHH------CCCCCEECC----------------CCCE---E----CCCEEEEEE-----ECCCCE
T ss_conf             91979989999999995------899610169----------------8998---6----564589999-----547865


Q ss_pred             EEEEECCCCCCCHHHHHHHH-HHHHHHHHCCCCCCCCEEEEECCCCCCHHHHH--HHHHHHHHCCCCEEEEECCCCCCCH
Q ss_conf             59986543332115778999-98998763022234301123102335225778--9998764358976999654578706
Q gi|254780709|r  196 VLIIDTAGRLHNNSILMAGI-GKMIRVLKRLDPHAPHSVLQVLDATTGQNALR--QVEMFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       196 vvliDTAGR~~~~~~lm~EL-~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~--~a~~F~~~~~~~g~I~TKlD~ta~~  272 (321)
                      +.++||+|=..... ...+. ++..+.+.     ..+-+++|+||+.+....+  ..+...+.-.-.=+|++|.|--..-
T Consensus        47 i~lvDtpG~~~~~~-~~~~~~~~~~~~~~-----~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p~i~v~NK~D~~~~~  120 (163)
T cd00880          47 VVLIDTPGIDEAGG-LGREREELARRVLE-----RADLILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDLLPEE  120 (163)
T ss_pred             EEEEECCCCCCCCC-HHHHHHHHHHHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECEECCCHH
T ss_conf             99972798522231-01689999999998-----6898999987899975566999999997197427885342067878


Q ss_pred             --HHHHH-----HHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             --99999-----99997698899975--898132555
Q gi|254780709|r  273 --GGLIP-----IVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       273 --G~~ls-----~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                        -..+.     .......|+.+++.  |+.++.|..
T Consensus       121 ~~~~~~~~~~~~~~~~~~~~i~~iSA~~g~gi~~L~~  157 (163)
T cd00880         121 EEEELLELRLLILLLLLGLPVIAVSALTGEGIDELRE  157 (163)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHH
T ss_conf             9999999999998767998599997898979999999


No 165
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=97.41  E-value=0.0037  Score=42.45  Aligned_cols=145  Identities=19%  Similarity=0.246  Sum_probs=75.6

Q ss_pred             ECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             11354444424789999999852267426774345124568899999753035321223586612454228999965148
Q gi|254780709|r  115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV  194 (321)
Q Consensus       115 l~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~  194 (321)
                      .++|.+-|||+|-+=+|.      |.++.+++--                .|..       .|+..-.      ....++
T Consensus         1 aivG~pN~GKSsL~N~l~------~~~~~ivs~~----------------~gtT-------r~~~~~~------~~~~~~   45 (157)
T cd01894           1 AIVGRPNVGKSTLFNRLT------GRRDAIVEDT----------------PGVT-------RDRIYGE------AEWGGR   45 (157)
T ss_pred             CCCCCCCCCHHHHHHHHH------CCCCEEEECC----------------CCCE-------EEEEEEE------EEECCE
T ss_conf             904899988999999995------8875354079----------------9935-------6678999------999998


Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHH--HHHHHHHHCCCCEEEEECCCCCCCH
Q ss_conf             75998654333211577899998998763022234301123102335225778--9998764358976999654578706
Q gi|254780709|r  195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR--QVEMFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       195 DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~--~a~~F~~~~~~~g~I~TKlD~ta~~  272 (321)
                      .++++||+|=......+-.++.+  +......  ..+-+++|+||..|-...+  .++...+.-----+++.|.|.-.+-
T Consensus        46 ~~~lvDTpG~~~~~~~~~~~~~~--~~~~~i~--~ad~il~viDa~~~~~~~d~~i~~~l~~~~kp~i~v~NK~D~~~~~  121 (157)
T cd01894          46 EFILIDTGGIEPDDEGISKEIRE--QAELAIE--EADVILFVVDGREGLTPADEEIAKYLRKSKKPVILVVNKVDNIKEE  121 (157)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHH--HHHHHHH--HCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCH
T ss_conf             89998578755566067899999--9999998--6590799998999999899999999998479809999787165864


Q ss_pred             HHHHHHHHHHC-CCEEEEEC--CCCCCCCC
Q ss_conf             99999999976-98899975--89813255
Q gi|254780709|r  273 GGLIPIVVTHK-IPVYFLGV--GEGINDLE  299 (321)
Q Consensus       273 G~~ls~~~~~~-~Pi~fig~--Ge~i~Dl~  299 (321)
                      ...... +..+ .++.+|+.  |+.++.|.
T Consensus       122 ~~~~~~-~~l~~~~~i~iSA~~g~Gid~L~  150 (157)
T cd01894         122 DEAAEF-YSLGFGEPIPISAEHGRGIGDLL  150 (157)
T ss_pred             HHHHHH-HHCCCCCEEEEEEECCCCHHHHH
T ss_conf             569999-96599975999965894999999


No 166
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=97.40  E-value=0.0012  Score=45.90  Aligned_cols=69  Identities=22%  Similarity=0.397  Sum_probs=38.1

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      ++-|||+||+|||||--+--||..+   +---.++-|-+|--                  ++.-|.|.-++..+=++.|.
T Consensus       109 KsNILliGPTG~GKTlla~tLAk~l---~vPF~iaDAT~lTE------------------aGYVGeDVE~ii~~Llq~Ad  167 (411)
T PRK05342        109 KSNILLIGPTGSGKTLLAQTLARIL---NVPFAIADATTLTE------------------AGYVGEDVENILLKLLQAAD  167 (411)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH---CCCEEEEEECEECC------------------CCCCCCCHHHHHHHHHHHCC
T ss_conf             4538998999977889999999986---99989986120012------------------67456079999999999828


Q ss_pred             H----HCCCEEEEE
Q ss_conf             5----148759986
Q gi|254780709|r  191 A----KKVDVLIID  200 (321)
Q Consensus       191 ~----~~~DvvliD  200 (321)
                      .    -..-+|.||
T Consensus       168 ~dve~Ae~GIV~ID  181 (411)
T PRK05342        168 YDVEKAQRGIVYID  181 (411)
T ss_pred             CCHHHHHCCEEEEE
T ss_conf             88998836828885


No 167
>KOG0923 consensus
Probab=97.40  E-value=0.00076  Score=47.30  Aligned_cols=187  Identities=19%  Similarity=0.236  Sum_probs=105.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHH--HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-----CCCCCC-----CCC
Q ss_conf             412311354444424789999999--85226742677434512456889999975303532-----122358-----661
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKK--MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-----VCSEIG-----SDA  178 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~--~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-----~~~~~~-----~dp  178 (321)
                      ..|+.++|-+||||||-+--.-+-  |.+.|++  +.++-.-|.||.-=-.-.|+-+||.+     |....+     .-.
T Consensus       280 ~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~--IgcTQPRRVAAmSVAaRVA~EMgvkLG~eVGYsIRFEdcTSekTv  357 (902)
T KOG0923         280 HQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKK--IGCTQPRRVAAMSVAARVAEEMGVKLGHEVGYSIRFEDCTSEKTV  357 (902)
T ss_pred             CCEEEEECCCCCCCCCCCCHHHHHCCCCCCCCE--EEECCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCEE
T ss_conf             708999757889864456289885421358946--740685068877799999998574014314448885035674122


Q ss_pred             HHHHHHH------HHHHHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             2454228------999965148759986543-332115778999989987630222343011231023352257789998
Q gi|254780709|r  179 AALAYEA------FKQAQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM  251 (321)
Q Consensus       179 ~~v~~~a------~~~a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~  251 (321)
                      ....-|+      +.......|.|||||-|- |.-+-.-|+.=++.|.++       .|+..+|+.+||.  |    |+.
T Consensus       358 lKYMTDGmLlREfL~epdLasYSViiiDEAHERTL~TDILfgLvKDIar~-------RpdLKllIsSAT~--D----Aek  424 (902)
T KOG0923         358 LKYMTDGMLLREFLSEPDLASYSVIIVDEAHERTLHTDILFGLVKDIARF-------RPDLKLLISSATM--D----AEK  424 (902)
T ss_pred             EEEECCHHHHHHHHCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHHHHH-------CCCCEEEEECCCC--C----HHH
T ss_conf             43224306799871463422335999602432003456799987888750-------8760477322226--7----899


Q ss_pred             HHHHC---CCC---------EEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC---------HHHHHHHH
Q ss_conf             76435---897---------6999654578706999999999769889997589813255577---------89999987
Q gi|254780709|r  252 FHAVA---GTT---------GLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV---------AKDFSAVI  310 (321)
Q Consensus       252 F~~~~---~~~---------g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~---------~~~~~~~l  310 (321)
                      |+.++   |+-         .+..|+--+....-+++    .+=+   =|-+-|..-||-+|-         .+.+-.+.
T Consensus       425 FS~fFDdapIF~iPGRRyPVdi~Yt~~PEAdYldAai----~tVl---qIH~tqp~GDILVFltGQeEIEt~~e~l~~~~  497 (902)
T KOG0923         425 FSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYLDAAI----VTVL---QIHLTQPLGDILVFLTGQEEIETVKENLKERC  497 (902)
T ss_pred             HHHHCCCCCEEECCCCCCCEEEECCCCCCHHHHHHHH----HHHE---EEEECCCCCCEEEEECCHHHHHHHHHHHHHHH
T ss_conf             9876168857723686565134304588530799988----6540---46751577657999446789999999999999


Q ss_pred             CCCCCCCCC
Q ss_conf             286564633
Q gi|254780709|r  311 TGCLDYGEE  319 (321)
Q Consensus       311 lG~gd~~~~  319 (321)
                      -++|+.+-|
T Consensus       498 ~~LGski~e  506 (902)
T KOG0923         498 RRLGSKIRE  506 (902)
T ss_pred             HHHCCCCCE
T ss_conf             985336550


No 168
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=97.40  E-value=0.0098  Score=39.50  Aligned_cols=27  Identities=37%  Similarity=0.549  Sum_probs=21.6

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             741231135444442478999999985
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      -.+.++|.|+.||||||+.-=||+-+.
T Consensus        37 l~haylf~G~rGvGKTt~aRi~Ak~ln   63 (816)
T PRK07003         37 LHHAYLFTGTRGVGKTTLSRIFAKALN   63 (816)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             631475117898888899999999867


No 169
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=97.39  E-value=0.00044  Score=48.97  Aligned_cols=98  Identities=18%  Similarity=0.237  Sum_probs=51.4

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC--C-EEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC--HHHHH
Q ss_conf             67412311354444424789999999852267--4-2677434512456889999975303532122358661--24542
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL--K-VMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA--AALAY  183 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~--k-V~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp--~~v~~  183 (321)
                      ..|+ ++|.||.|+||||++--+|+.+--...  . .-+-++|.+.-+.. ++...  .-.+.++..+...+.  ..+..
T Consensus        35 ~~ph-lLf~GPpG~GKTt~A~~lA~~l~~~~~~~~~~~~nasd~~~~~~~-~i~~~--~~~~~~~~~~~~~~~~~~d~i~  110 (337)
T PRK12402         35 NLPH-LVVYGPSGSGKTAAVRALARELYGDPWENNFTYFNVSDFFDQGKK-YLVED--PRFAHFYDDPKRKYKSVIDNFK  110 (337)
T ss_pred             CCCE-EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCC-EEECC--CCHHHHHCCHHHCCCCHHHHHH
T ss_conf             9876-988892984899999999999679975678333116531135640-01016--6423442015332773789999


Q ss_pred             HHHHHH-H----HHCCCEEEEECCCCCCCHHH
Q ss_conf             289999-6----51487599865433321157
Q gi|254780709|r  184 EAFKQA-Q----AKKVDVLIIDTAGRLHNNSI  210 (321)
Q Consensus       184 ~a~~~a-~----~~~~DvvliDTAGR~~~~~~  210 (321)
                      +.+... .    ...|-++|+|-|.++..+..
T Consensus       111 ~ii~~~a~~~p~~~~~KiiIlDEad~lt~~Aq  142 (337)
T PRK12402        111 HILKEYASMRPLSADYKLILFDNAEALREDAQ  142 (337)
T ss_pred             HHHHHHHCCCCCCCCEEEEEEECCCCCCHHHH
T ss_conf             99999861488778804999707131799999


No 170
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=97.39  E-value=0.0039  Score=42.30  Aligned_cols=112  Identities=19%  Similarity=0.285  Sum_probs=64.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHC----CCC-EEEEECCCCCHH-HH
Q ss_conf             999999999878520100121000136674123113544444247899999998522----674-267743451245-68
Q gi|254780709|r   82 QRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDA----GLK-VMLAAGDTFRSA-AI  155 (321)
Q Consensus        82 ~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~----g~k-V~lva~DtfR~a-A~  155 (321)
                      ++=++.+...|..+|.|        . .+|.=|++-|++|+|||.++-++...+...    +.. |..+.-++-..- ..
T Consensus        23 deqI~~l~~~L~~~l~P--------G-~~P~Ni~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~NC~~~~T~y   93 (383)
T TIGR02928        23 DEQIEELAKALRPILRP--------G-SRPSNIFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYINCQILDTSY   93 (383)
T ss_pred             HHHHHHHHHHHHHHHCC--------C-CCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHH
T ss_conf             78999999998875067--------4-89872588788898788999999999999862269971589997785468469


Q ss_pred             HHHHHHHHHH-----CCCCCCCCCCCCCHHHHHHHHHHHHH-HCCCEEE--EECCCCC
Q ss_conf             8999997530-----35321223586612454228999965-1487599--8654333
Q gi|254780709|r  156 DQLKIWADRT-----SADFVCSEIGSDAAALAYEAFKQAQA-KKVDVLI--IDTAGRL  205 (321)
Q Consensus       156 eQL~~~a~~~-----~v~~~~~~~~~dp~~v~~~a~~~a~~-~~~Dvvl--iDTAGR~  205 (321)
                      .=+..+++++     +..+   |.-+-|.+=+|+.+-.... +.++.+|  .|=-=++
T Consensus        94 ~~~~~L~~~ln~~~~~~~v---P~tG~s~~~~~~~l~~~l~~~~~~~~~ivLDEiD~L  148 (383)
T TIGR02928        94 QVLVELANQLNRRGSGEEV---PTTGLSTSEVFRELYKELNRERGDSLIIVLDEIDKL  148 (383)
T ss_pred             HHHHHHHHHHCCCCCCCCC---CCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHH
T ss_conf             9999999985157788889---887787899999999998320188799986231022


No 171
>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase. A similar protein, ureG, is an accessory protein for urease, which also uses nickel.; GO: 0016151 nickel ion binding, 0006461 protein complex assembly.
Probab=97.39  E-value=0.00045  Score=48.87  Aligned_cols=144  Identities=23%  Similarity=0.351  Sum_probs=97.9

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC---CHHHHH-
Q ss_conf             6674123113544444247899999998522674267743451245688999997530353212235866---124542-
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD---AAALAY-  183 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~d---p~~v~~-  183 (321)
                      .....++=|+|-.||||||=+=|+...++++ .|+++|.+|..=-.=.+-||.+    |+|++....|..   =|..+. 
T Consensus        31 ~~g~~~lNfmsspGSGKT~LiEk~~~~~~~~-~K~Avi~GD~~t~~DA~RlR~~----G~~a~~~nTGk~CHLdA~mv~G  105 (225)
T TIGR00073        31 KEGLLVLNFMSSPGSGKTTLIEKLIERLDDE-VKIAVIEGDVQTKNDADRLRKY----GVPAIQINTGKECHLDAHMVAG  105 (225)
T ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHC----CCEEEEECCCCCCCCHHHHHHH
T ss_conf             6597899802588611589999999984578-9789997553225569999864----9868863688644401667865


Q ss_pred             --HHHHHHHHHCC-CEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH-HHHHHHHHHCCCC
Q ss_conf             --28999965148-7599865433321157789999899876302223430112310233522577-8999876435897
Q gi|254780709|r  184 --EAFKQAQAKKV-DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL-RQVEMFHAVAGTT  259 (321)
Q Consensus       184 --~a~~~a~~~~~-DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~-~~a~~F~~~~~~~  259 (321)
                        ++++.....+. |++||-=-|=      |.         +..-..---+..+-|++.|=|-|-. .-=.+|..+   +
T Consensus       106 ~~~~L~~~~ld~~~DlL~IENVGN------Lv---------CP~~FdLGe~~rVvllSVTEGdDk~lKyP~~F~~A---d  167 (225)
T TIGR00073       106 AIHALKDLPLDDISDLLLIENVGN------LV---------CPADFDLGEHMRVVLLSVTEGDDKVLKYPAMFKEA---D  167 (225)
T ss_pred             HHHHHHCCCCCCCCCEEEEEECCC------CE---------ECCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHH---H
T ss_conf             875542168887146268864476------10---------06731123563079998658999654661588744---4


Q ss_pred             EEEEECCCCCCCHHH
Q ss_conf             699965457870699
Q gi|254780709|r  260 GLIMTKMDGTARGGG  274 (321)
Q Consensus       260 g~I~TKlD~ta~~G~  274 (321)
                      -+++||.|=-...|+
T Consensus       168 ~~~inK~DL~~~v~~  182 (225)
T TIGR00073       168 LILINKVDLAEAVGF  182 (225)
T ss_pred             HHHHCHHHHHHHHCC
T ss_conf             562147889977073


No 172
>PRK10436 hypothetical protein; Provisional
Probab=97.38  E-value=0.00021  Score=51.20  Aligned_cols=79  Identities=20%  Similarity=0.336  Sum_probs=50.3

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             741231135444442478999999985226742677434-5124568899999753035321223586612454228999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD-TFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D-tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~  188 (321)
                      +..+|++.||+|||||||+.-+-..+...++++.-+.=- -|+...+.|.+++. +.|..|             -.++..
T Consensus       214 p~GliLvtGPTGSGKTTTLya~L~~l~~~~~~I~TiEDPVE~~l~gi~Q~~vn~-~~g~tf-------------a~~lrs  279 (461)
T PRK10436        214 PQGLVLVTGPTGSGKTVTLYSALQTLNTAQINICSVEDPVEIPLAGINQTQIHP-RAGLTF-------------QRVLRA  279 (461)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCEECC-CCCHHH-------------HHHHHH
T ss_conf             997799978999956999999997434677169996077435546754523132-213139-------------999999


Q ss_pred             HHHHCCCEEEEECC
Q ss_conf             96514875998654
Q gi|254780709|r  189 AQAKKVDVLIIDTA  202 (321)
Q Consensus       189 a~~~~~DvvliDTA  202 (321)
                      +-.++-|+|+|.-.
T Consensus       280 ~LRqDPDVImvGEI  293 (461)
T PRK10436        280 LLRQDPDVIMVGEI  293 (461)
T ss_pred             HHCCCCCEEEECCC
T ss_conf             87469999986577


No 173
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=97.38  E-value=0.00011  Score=53.10  Aligned_cols=37  Identities=24%  Similarity=0.403  Sum_probs=33.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             2311354444424789999999852267426774345
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      |+-++|.-||||||-+-||-.+|+++|.+|+.|=-|.
T Consensus         4 ii~ivG~s~SGKTTLi~kli~~l~~~G~rV~~IKH~~   40 (170)
T PRK10751          4 LLAIAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTH   40 (170)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             7999946999999999999999998798499994577


No 174
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369    GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=97.37  E-value=0.00015  Score=52.32  Aligned_cols=74  Identities=19%  Similarity=0.329  Sum_probs=51.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434---512456889999975303532122358661245422899
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D---tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      .-|||+.||||||||||+  .|+.-+-+...+=++|+-   =|++-.+-|.++. .++|..|            | .|+.
T Consensus       245 HGIiLVTGPTGSGKtTTL--YaaL~~LN~~~~NIlTvEDPVEY~i~GIgQ~Qvn-~kIglTF------------A-~GLR  308 (495)
T TIGR02533       245 HGIILVTGPTGSGKTTTL--YAALSRLNTPERNILTVEDPVEYQIEGIGQIQVN-PKIGLTF------------A-AGLR  308 (495)
T ss_pred             CCEEEECCCCCCCHHHHH--HHHHHHHCCCCCCEEEEECCEEEEECCCCEEEEC-CCCCHHH------------H-HHHH
T ss_conf             961884177898525889--9999863589971568657824762487636514-6543038------------8-8878


Q ss_pred             HHHHHCCCEEEEE
Q ss_conf             9965148759986
Q gi|254780709|r  188 QAQAKKVDVLIID  200 (321)
Q Consensus       188 ~a~~~~~DvvliD  200 (321)
                      ..-.++=|||.|=
T Consensus       309 aILRQDPDiiMvG  321 (495)
T TIGR02533       309 AILRQDPDIIMVG  321 (495)
T ss_pred             HHHCCCCCEEEEE
T ss_conf             8642799889982


No 175
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=97.36  E-value=0.0099  Score=39.47  Aligned_cols=146  Identities=21%  Similarity=0.290  Sum_probs=80.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      +|+++|-.-|||.|-.=+|.      |++.++++                +.-|+.-       |...-      .+.-.
T Consensus         3 ~VaIvGrpNvGKStLfN~l~------~~~~aIv~----------------~~~G~TR-------D~~~~------~~~~~   47 (438)
T PRK00093          3 VVAIVGRPNVGKSTLFNRLT------GKRDAIVA----------------DTPGVTR-------DRIYG------EAEWL   47 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHH------CCCEEEEC----------------CCCCCCC-------CCEEE------EEEEC
T ss_conf             89998999987899999986------88618715----------------9899984-------71589------99999


Q ss_pred             CCCEEEEECCCCCCCHHHHHH-HHH-HHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             487599865433321157789-999-8998763022234301123102335225--778999876435897699965457
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMA-GIG-KMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGTTGLIMTKMDG  268 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~-EL~-ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~~g~I~TKlD~  268 (321)
                      ++.+.||||||=...+.+.++ .+. +....++     ..|-+++|+||.+|-.  -.+.++...+.-.--=+++-|+|+
T Consensus        48 ~~~~~lvDT~G~~~~~~~~~~~~i~~q~~~ai~-----~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~  122 (438)
T PRK00093         48 GREFIVIDTGGIDPGDEDGFEKQMREQALLAIE-----EADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKVDG  122 (438)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             928999989798988820799999999999998-----589999998377689878999999999739978999975566


Q ss_pred             CCCHHHHHHHHHHHCCC-EEEEEC--CCCCCCCC
Q ss_conf             87069999999997698-899975--89813255
Q gi|254780709|r  269 TARGGGLIPIVVTHKIP-VYFLGV--GEGINDLE  299 (321)
Q Consensus       269 ta~~G~~ls~~~~~~~P-i~fig~--Ge~i~Dl~  299 (321)
                      ... -....-.|.+|.. +.+|+.  |..++||.
T Consensus       123 ~~~-~~~~~ef~~LGf~~~i~iSA~h~~Gi~~L~  155 (438)
T PRK00093        123 KKM-EADAYEFYSLGLGEPYPISAEHGRGIGDLL  155 (438)
T ss_pred             CCH-HHHHHHHHHHCCCCEEEEEECCCCCHHHHH
T ss_conf             320-345999998368981888530566989999


No 176
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=97.36  E-value=0.0071  Score=40.51  Aligned_cols=143  Identities=18%  Similarity=0.266  Sum_probs=71.8

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH
Q ss_conf             98999999999878520100121000136674-12311354444424789999999852267426774345124568899
Q gi|254780709|r   80 SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL  158 (321)
Q Consensus        80 ~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL  158 (321)
                      ..++.+..+.+.+...-.+      +..+++| .+++|+||+|||||-++-.||.++-..  .-.++..|-     -|=-
T Consensus       495 GQd~AV~~v~~aIrraRaG------L~dp~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~--e~aliR~DM-----SEy~  561 (786)
T COG0542         495 GQDEAVEAVSDAIRRARAG------LGDPNRPIGSFLFLGPTGVGKTELAKALAEALFGD--EQALIRIDM-----SEYM  561 (786)
T ss_pred             CHHHHHHHHHHHHHHHHCC------CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCC--CCCCEEECH-----HHHH
T ss_conf             7399999999999998569------99999873578866788656999999999996599--744455456-----8777


Q ss_pred             H--HHHHHHCCCC-CCCC-CCCCCHHHHHHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCCC---
Q ss_conf             9--9975303532-1223-58661245422899996-5148759986543332115778999989987630--2223---
Q gi|254780709|r  159 K--IWADRTSADF-VCSE-IGSDAAALAYEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKR--LDPH---  228 (321)
Q Consensus       159 ~--~~a~~~~v~~-~~~~-~~~dp~~v~~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~--~~~~---  228 (321)
                      .  +.++-+|.|= |.+. .|.-        +..+. .+-|-|||.|---.-|-|.-     --+.+|+..  ...+   
T Consensus       562 EkHsVSrLIGaPPGYVGyeeGG~--------LTEaVRr~PySViLlDEIEKAHpdV~-----nilLQVlDdGrLTD~~Gr  628 (786)
T COG0542         562 EKHSVSRLIGAPPGYVGYEEGGQ--------LTEAVRRKPYSVILLDEIEKAHPDVF-----NLLLQVLDDGRLTDGQGR  628 (786)
T ss_pred             HHHHHHHHHCCCCCCCEECCCCC--------HHHHHHCCCCEEEEECHHHHCCHHHH-----HHHHHHHCCCCEECCCCC
T ss_conf             78779987279998720065540--------03766069986888412644088999-----999998467805548998


Q ss_pred             --CCCEEEEECCCCCCHHHHHH
Q ss_conf             --43011231023352257789
Q gi|254780709|r  229 --APHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       229 --~p~~~~lVlda~~gq~~~~~  248 (321)
                        .--.+++++-++.|.+.+..
T Consensus       629 ~VdFrNtiIImTSN~Gs~~i~~  650 (786)
T COG0542         629 TVDFRNTIIIMTSNAGSEEILR  650 (786)
T ss_pred             EEECCEEEEEEECCCCHHHHHH
T ss_conf             8843002899845026598975


No 177
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=97.35  E-value=0.0076  Score=40.28  Aligned_cols=78  Identities=19%  Similarity=0.343  Sum_probs=50.3

Q ss_pred             CCCCC-EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             66741-23113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  108 SHRPH-VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       108 ~~~p~-vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      +.+-. |++||||.|||||.=..-+|.=+-++=.|..|.           =++--||+=|=.  .-+-|+=|-.++ ++|
T Consensus       446 ~~~GpqIlClvGPPGVGKTSlg~SIA~ALnRkFvR~SlG-----------G~~DeAEIrGHR--RTYvGAMPGrii-Q~l  511 (941)
T TIGR00763       446 KMKGPQILCLVGPPGVGKTSLGKSIAKALNRKFVRFSLG-----------GVRDEAEIRGHR--RTYVGAMPGRII-QGL  511 (941)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEEEEEC-----------CCEEHHHCCCCC--CCCCCCCHHHHH-HHH
T ss_conf             888876787207269542227899999968804999526-----------722031127864--320346725789-998


Q ss_pred             HHHHHHCCCEEEEE
Q ss_conf             99965148759986
Q gi|254780709|r  187 KQAQAKKVDVLIID  200 (321)
Q Consensus       187 ~~a~~~~~DvvliD  200 (321)
                      ..++-+| =|+|||
T Consensus       512 k~~~t~N-Pl~LlD  524 (941)
T TIGR00763       512 KKAKTKN-PLILLD  524 (941)
T ss_pred             HHCCCCC-CEEEEE
T ss_conf             7604158-806862


No 178
>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=97.35  E-value=6.9e-05  Score=54.61  Aligned_cols=34  Identities=29%  Similarity=0.401  Sum_probs=28.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             1231135444442478999999985226742677
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA  145 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lv  145 (321)
                      ..|+++|++|||||||+.-|..++...+.++..+
T Consensus       140 ~~ilIsG~TGSGKTT~l~all~~i~~~~~riiti  173 (283)
T pfam00437       140 GNILVSGGTGSGKTTLLYALLNEINTDDERIVTI  173 (283)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             7599988999988999999998408777627873


No 179
>PRK05480 uridine kinase; Provisional
Probab=97.35  E-value=0.00024  Score=50.82  Aligned_cols=41  Identities=27%  Similarity=0.513  Sum_probs=36.1

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             6674123113544444247899999998522674267743451
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF  150 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf  150 (321)
                      ..+|.+|.+.|+.||||||.+-+|+..|..  .+|.++++|-|
T Consensus         3 ~k~P~iIgIaG~SgSGKTT~a~~L~~~l~~--~~v~vi~~D~Y   43 (209)
T PRK05480          3 MKQPIIIGIAGGSGSGKTTVASTIYEELGD--ESIAVISQDSY   43 (209)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHCCC--CCEEEEECCCC
T ss_conf             889889999899977899999999998086--87599955441


No 180
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=97.34  E-value=0.0002  Score=51.38  Aligned_cols=71  Identities=27%  Similarity=0.428  Sum_probs=48.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      +.++-+||-.||||||-+.||...|+++|.+|+.+=-|.++             ..+    ..+|+|.       .. ++
T Consensus         1 mkii~ivG~snSGKTTLi~kli~~l~~~G~~V~~iKH~~H~-------------f~~----D~~GkDS-------~r-~~   55 (159)
T cd03116           1 MKVIGFVGYSGSGKTTLLEKLIPALSARGLRVAVIKHDHHD-------------FDI----DTPGKDS-------YR-HR   55 (159)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCC-------------CCC----CCCCCHH-------HH-HH
T ss_conf             92999996799999999999999999779859899734767-------------777----7898441-------77-67


Q ss_pred             HHCCCEEEEECCCCCC
Q ss_conf             5148759986543332
Q gi|254780709|r  191 AKKVDVLIIDTAGRLH  206 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~  206 (321)
                      ..|.+.+++=+.+|..
T Consensus        56 ~AGA~~v~v~s~~~~~   71 (159)
T cd03116          56 EAGAEEVLVSSPRRWA   71 (159)
T ss_pred             HCCCCEEEEECCCEEE
T ss_conf             5297379997567188


No 181
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.33  E-value=0.0029  Score=43.23  Aligned_cols=96  Identities=23%  Similarity=0.323  Sum_probs=65.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      ..-++|.|++|+|||--+.=+|+.+-++|++|..+++..+    +++|+.- ..         .++     ..+.++  +
T Consensus        47 ~~Nlll~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~~~L----~~~l~~~-~~---------~~~-----~~~~l~--~  105 (178)
T pfam01695        47 AENLLLLGPPGVGKTHLACALGHQACRAGYSVLFTRTPDL----VEQLKRA-RG---------DGR-----LARTLQ--R  105 (178)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHH----HHHHHHH-HH---------CCC-----HHHHHH--H
T ss_conf             8768998999987899999999999986985999961679----9999987-52---------674-----999999--9


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             5148759986543332115778999989987630222343
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP  230 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p  230 (321)
                      ...+|+++||--|..+.+..-.+.   +.+++....+..|
T Consensus       106 ~~~~dlLIiDDlG~~~~s~~~~~~---lf~li~~Rye~~s  142 (178)
T pfam01695       106 LAKADLLILDDIGYLPLSQEAAHL---LFELISDRYERRS  142 (178)
T ss_pred             HHCCCEEEEEHHCCCCCCHHHHHH---HHHHHHHHHCCCC
T ss_conf             625897887200165689899999---9999999975688


No 182
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=97.30  E-value=0.017  Score=37.79  Aligned_cols=152  Identities=20%  Similarity=0.275  Sum_probs=82.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522--6742677434512456889999975303532122358661245422899996
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDA--GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~--g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -|.++|--++||||.+..|.+....-  ..++---..|..   ..||=|      |+.+...     ..++        .
T Consensus         4 Nv~iiGHvd~GKTTL~~~Ll~~tg~~~~~~~~~~~~~D~~---~~E~er------giTI~~~-----~~~~--------~   61 (194)
T cd01891           4 NIAIIAHVDHGKTTLVDALLKQSGTFRENEEVEERVMDSN---DLERER------GITILAK-----NTAV--------T   61 (194)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEECCC---HHHHHC------CCCEEEE-----EEEE--------E
T ss_conf             8999906898799999999997487630465216861475---888872------8763345-----8999--------9


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             51487599865433321157789999899876302223430112310233522-----5778999876435897699965
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEMFHAVAGTTGLIMTK  265 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~F~~~~~~~g~I~TK  265 (321)
                      -+++-+-+|||.|-    .+.+.|+..-.++        -+-.+||+||..|-     ..+..|..++  +++ =+++.|
T Consensus        62 ~~~~~~n~IDtPGH----~dF~~~~~~~~~~--------~D~ailVVdA~~Gv~~QT~~~l~~a~~~~--~~~-iv~iNK  126 (194)
T cd01891          62 YKDTKINIVDTPGH----ADFGGEVERVLSM--------VDGVLLLVDASEGPMPQTRFVLKKALELG--LKP-IVVINK  126 (194)
T ss_pred             ECCEEEEEEECCCC----HHHHHHHHHHHHH--------CCEEEEEEECCCCCCHHHHHHHHHHHHCC--CCE-EEEEEC
T ss_conf             89988999989984----7777789877643--------44678986537897589999999998729--974-998856


Q ss_pred             CCC-CCCHHHHHHHHHH-----------HCCCEEEEE--CCCCCCCCCCC
Q ss_conf             457-8706999999999-----------769889997--58981325557
Q gi|254780709|r  266 MDG-TARGGGLIPIVVT-----------HKIPVYFLG--VGEGINDLEPF  301 (321)
Q Consensus       266 lD~-ta~~G~~ls~~~~-----------~~~Pi~fig--~Ge~i~Dl~~f  301 (321)
                      +|- .++.=-+++-...           ...||..++  .|...+++...
T Consensus       127 ~D~~~a~~~~v~~ei~~~~~~~~~~~~~~~~pii~~SA~~G~~~d~~~~~  176 (194)
T cd01891         127 IDRPDARPEEVVDEVFDLFIELGATEEQLDFPVLYASAKNGWASLNLEDP  176 (194)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC
T ss_conf             45898889999999999998639993335885787256553357788656


No 183
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=97.30  E-value=0.0012  Score=45.98  Aligned_cols=119  Identities=18%  Similarity=0.238  Sum_probs=61.1

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHC---CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCC----CCCCCCHHH
Q ss_conf             674123113544444247899999998522---6742677434512456889999975303532122----358661245
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDA---GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCS----EIGSDAAAL  181 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~---g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~----~~~~dp~~v  181 (321)
                      .-|+.+||.||.|+|||||+-=+|+-+--.   +..+-.-+|..     -+.-+...+-..++++.-    ..|-|-..-
T Consensus        41 ~~~~aylf~G~rG~GKTt~Ari~ak~lnc~~~~~~~~~~~~c~~-----c~~c~~i~~~~~~dv~EiDaas~~gv~~ir~  115 (507)
T PRK06645         41 RLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEK-----CTNCISFNNHNHPDIIEIDAASKTSVDDIRR  115 (507)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCC-----CHHHHHHHCCCCCCEEEEECCCCCCHHHHHH
T ss_conf             96634774587997889999999999679998888998888888-----7678998658999859963788888899999


Q ss_pred             HHHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             422899996-5148759986543332115778999989987630222343011231023352
Q gi|254780709|r  182 AYEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       182 ~~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      ..+.+.|+- ..+|-|.|||-+-.+.+..  .+-|       -+..+..|..+.+++ |||-
T Consensus       116 l~~~~~~~p~~~~~kv~iidE~hmls~~a--~nal-------lktlEepp~~~~Fi~-atte  167 (507)
T PRK06645        116 IIESAEYKPLQGKHKIFIIDEVHMLSKGA--FNAL-------LKTLEEPPPHIIFIF-ATTE  167 (507)
T ss_pred             HHHHCCCCCCCCCEEEEEECCHHHCCHHH--HHHH-------HHHHHCCCCCEEEEE-ECCC
T ss_conf             98635517876743589952142248999--9999-------997427864438999-7485


No 184
>PRK04195 replication factor C large subunit; Provisional
Probab=97.29  E-value=0.0061  Score=40.95  Aligned_cols=84  Identities=25%  Similarity=0.414  Sum_probs=48.0

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEE-EEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426-77434512456889999975303532122358661245422899996
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVM-LAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~-lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      ..++|.||.|+||||++-=||+.+   |..|. +=|.|.-....+++.-..+...+. +             +       
T Consensus        41 k~lLL~GPpGvGKTT~a~~lAk~~---g~~viElNASD~R~~~~I~~~i~~~~~~~s-l-------------~-------   96 (403)
T PRK04195         41 KALLLYGPPGVGKTSLAHALANDY---GWEVIELNASDQRTKDVIERVAGEASTSGS-L-------------F-------   96 (403)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCEEEECCCCCCCHHHHHHHHHHHHHCCC-C-------------C-------
T ss_conf             469988939987999999999984---998599771011478999999998760688-7-------------7-------


Q ss_pred             HHCCCEEEEECCCCCCCH--HHHHHHHHHHH
Q ss_conf             514875998654333211--57789999899
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNN--SILMAGIGKMI  219 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~--~~lm~EL~ki~  219 (321)
                      ....-+||+|-+--+|.+  ...+.+|.++.
T Consensus        97 ~~~~KlIIlDEvD~l~~~~d~gg~~al~~~i  127 (403)
T PRK04195         97 GAKRKLILLDEVDGIHGNADRGGVRAILEII  127 (403)
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             8873499963434457244479999999998


No 185
>PRK13869 plasmid-partitioning protein RepA; Provisional
Probab=97.29  E-value=0.00022  Score=51.04  Aligned_cols=43  Identities=28%  Similarity=0.355  Sum_probs=35.1

Q ss_pred             CCCCEEECCCC-CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             67412311354-44442478999999985226742677434512
Q gi|254780709|r  109 HRPHVILVVGV-NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       109 ~~p~vil~vG~-nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      .++.||.++-- =|||||||+.-||+++..+|++|++|-+|..-
T Consensus       119 ~~~kVIaVaN~KGGVGKTTtav~LA~~LA~~G~RVLlIDLDPQg  162 (405)
T PRK13869        119 EHLQVIAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDPQA  162 (405)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             99828999788877659999999999999779988999645617


No 186
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional
Probab=97.29  E-value=0.012  Score=38.96  Aligned_cols=28  Identities=32%  Similarity=0.532  Sum_probs=21.2

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      .-.+.++|.|+.||||||+.-=||+-+.
T Consensus        36 r~~haylf~g~rg~gktt~ari~ak~ln   63 (696)
T PRK06872         36 RLHHAYLFSGTRGVGKTSIARLFAKGLN   63 (696)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             8630475117898888899999999867


No 187
>PRK00313 lpxK tetraacyldisaccharide 4'-kinase; Provisional
Probab=97.29  E-value=0.0021  Score=44.26  Aligned_cols=78  Identities=23%  Similarity=0.293  Sum_probs=51.1

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC----------------CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             35444442478999999985226742677434----------------51245688999997530353212235866124
Q gi|254780709|r  117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD----------------TFRSAAIDQLKIWADRTSADFVCSEIGSDAAA  180 (321)
Q Consensus       117 vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D----------------tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~  180 (321)
                      +-+-|+|||-++.-||.+++++|++|++++=-                +..-..=|.| .++++.++||+.++.-     
T Consensus        59 itvGGTGKTP~v~~La~~L~~~G~~~~IiSRGYg~~~~~~~~~v~~~~~~~~vGDEpl-lla~~~~~pV~V~~~R-----  132 (332)
T PRK00313         59 ITVGGTGKTPLILWLIEHCRRRGLRVGVVSRGYGARPPQLPWRVTADQDAAEAGDEPL-LIVQRTGVPLMIDPDR-----  132 (332)
T ss_pred             EEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCEEECCCCCHHHCCCHHH-HHHHCCCCCEEECCCH-----
T ss_conf             7358877779999999999977996589864656766677355457768455585889-9985069629980769-----


Q ss_pred             HHHHHHHHHHH-HCCCEEEEECC
Q ss_conf             54228999965-14875998654
Q gi|254780709|r  181 LAYEAFKQAQA-KKVDVLIIDTA  202 (321)
Q Consensus       181 v~~~a~~~a~~-~~~DvvliDTA  202 (321)
                        .+|++++.. ...|+||.|-+
T Consensus       133 --~~a~~~l~~~~~~dviIlDDG  153 (332)
T PRK00313        133 --PRAVQALLAAEPLDLILSDDG  153 (332)
T ss_pred             --HHHHHHHHHCCCCCEEEECCC
T ss_conf             --999999996499988995585


No 188
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=97.28  E-value=0.00027  Score=50.46  Aligned_cols=135  Identities=24%  Similarity=0.274  Sum_probs=72.9

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCC--CCEEEE---------ECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             1231135444442478999999985226--742677---------43451245688999997530353212235866124
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAG--LKVMLA---------AGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA  180 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g--~kV~lv---------a~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~  180 (321)
                      .-.|++=.||+|||-|+.-|.++|.+.|  ++|++.         |.+.|..--.++.+.+.+..++.-.......+-+.
T Consensus       437 rraLl~MATGTGKTrtaial~~rLlk~~~~kRILFLvDR~~L~~QA~~~F~~~~~~~~~~~~~~~~v~~l~~~~~~~~~r  516 (1126)
T PRK11448        437 REILLAMATGTGKTRTAIALMYRLLKAKRFKRILFLVDRRALGEQALDAFKDTKIEGNQTFASIYDIKGLTDKFPEDETK  516 (1126)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCCCCE
T ss_conf             54688724888589899999999996587672579856589999999987543454566640022001025678787771


Q ss_pred             HHHHHHHHHH-------------HHCCCEEEEECCCCCCCHHHHHH-----------HHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             5422899996-------------51487599865433321157789-----------99989987630222343011231
Q gi|254780709|r  181 LAYEAFKQAQ-------------AKKVDVLIIDTAGRLHNNSILMA-----------GIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       181 v~~~a~~~a~-------------~~~~DvvliDTAGR~~~~~~lm~-----------EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
                      |.+-+++..-             -..||+||||-|-|+.+-..-|.           -..++++|+..++.     .++=
T Consensus       517 v~isT~q~m~~~i~~~~~~~~~~~~~FDlIIiDEaHRgy~ld~em~e~e~~~rd~~s~~skyr~IldYFDA-----~~iG  591 (1126)
T PRK11448        517 VHVATVQSMVKRILQSDDSEPPPVGQYDCIVVDEAHRGYTLDKEMTEGELQFRDQLDYVSKYRRVLDYFDA-----VKIG  591 (1126)
T ss_pred             EEEECHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHCCCCHHHHHHHHHHHHHHHHH-----HHHC
T ss_conf             99973078998752357677999985137989778788743323110001023202477789999876215-----5404


Q ss_pred             CCCCCCHHHHHHHHHHHH
Q ss_conf             023352257789998764
Q gi|254780709|r  237 LDATTGQNALRQVEMFHA  254 (321)
Q Consensus       237 lda~~gq~~~~~a~~F~~  254 (321)
                      |-||-   +.+....|..
T Consensus       592 LTATP---~~~T~~~Fg~  606 (1126)
T PRK11448        592 LTATP---ALHTTEIFGE  606 (1126)
T ss_pred             CCCCC---CCCHHHHHCC
T ss_conf             76799---9555677099


No 189
>PRK12337 2-phosphoglycerate kinase; Provisional
Probab=97.27  E-value=0.0021  Score=44.14  Aligned_cols=100  Identities=20%  Similarity=0.298  Sum_probs=71.9

Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC---CHHHHHHHHHHHHHHHCCC-CCCCC----CCCCCCCCCEEECCCCC
Q ss_conf             9999997388989999999999987512789---9899999999987852010-01210----00136674123113544
Q gi|254780709|r   49 LEDLLIRSDIGVAVAQKIVEELLTKRYAKDV---SVQRVLYDVSELIHKMLMP-LSKPF----NWDFSHRPHVILVVGVN  120 (321)
Q Consensus        49 Lee~LL~ADVg~~va~~Iie~ik~~~~~~~i---~~~~i~~~l~~~L~~~L~~-~~~~~----~~~~~~~p~vil~vG~n  120 (321)
                      |-..|..+.+.++.+-.|...+.+....++.   +.+++...+...|.+.-.+ .....    .+....+|.+|++=|..
T Consensus       192 LarSltaaG~~P~~Ay~iA~eie~~L~~~~~~~i~~~elr~~v~~~L~~~~~~~~A~rY~lwR~ir~~~~PiiILIGGaS  271 (492)
T PRK12337        192 LVQSLLAAGVAPDVARKVARVTQRDLRGSGDRVVRRDEIREKVEALLRDEVGPDVSARYRLLRVLRKPPRPLHVLLGGVS  271 (492)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             99999980588889999999999999865887970999999999999873038899999999997356887699960788


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             44424789999999852267426774345124
Q gi|254780709|r  121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS  152 (321)
Q Consensus       121 G~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~  152 (321)
                      |+||+|-.+-||+++-=.    -++++|+-|-
T Consensus       272 GvGKSTlAseLA~RLGI~----~VIsTDsIRE  299 (492)
T PRK12337        272 GTGKSVLAAELAYRLGIT----RVVPTDAIRE  299 (492)
T ss_pred             CCCHHHHHHHHHHHHCCC----CCCCCHHHHH
T ss_conf             866888999999960988----1025447999


No 190
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=97.27  E-value=0.0097  Score=39.53  Aligned_cols=175  Identities=22%  Similarity=0.285  Sum_probs=85.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             99999987852010012100013667412311354444424789999999852267426774345124568899999753
Q gi|254780709|r   85 LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR  164 (321)
Q Consensus        85 ~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~  164 (321)
                      +..|.+.+.+.|......  ......+--|.++|=+-|||.|-+-.|    ..+.+.  +                -++.
T Consensus       148 i~~L~~~i~~~l~~~~~~--~~~~~~~iriaivGrPNvGKSTl~N~l----l~~~r~--i----------------vs~~  203 (429)
T TIGR03594       148 IGDLLDAILELLPEEEEE--EEEEDGPIKIAIIGRPNVGKSTLVNAL----LGEERV--I----------------VSDI  203 (429)
T ss_pred             HHHHHHHHHHHCCCCCCC--CCCCCCCEEEEEECCCCCCHHHHHHHH----HHHHHH--H----------------CCCC
T ss_conf             999999999658866555--434556526999748876546777776----543332--1----------------4799


Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC---CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             0353212235866124542289999651487599865433---3211577899998998763022234301123102335
Q gi|254780709|r  165 TSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGR---LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT  241 (321)
Q Consensus       165 ~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR---~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~  241 (321)
                      -|.       -.|+..+.+      ..++..+.+|||||=   .+.+ +-++.+ .+.+.++...  ..+-++||+||+-
T Consensus       204 ~Gt-------TrD~i~~~~------~~~~~~~~~iDTaGirkk~k~~-~~~e~~-s~~~t~~~i~--~~dvvil~iD~~~  266 (429)
T TIGR03594       204 AGT-------TRDSIDIPF------ERNGKKYLLIDTAGIRRKGKVT-EGIEKY-SVLRTLKAIE--RADVVLLVLDATE  266 (429)
T ss_pred             CCC-------CCCCEEEEE------EECCEEEEEEECCCCCCCCCCC-HHHHHH-HHHHHHHHHH--HCCEEEEEEECCC
T ss_conf             986-------310268799------9999089999898876366423-047799-9999999987--4477999997665


Q ss_pred             CHHHH--HHHHHHHHHCCCCEEEEECCCCCCCHHHHHH--------HHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             22577--8999876435897699965457870699999--------99997698899975--898132555
Q gi|254780709|r  242 GQNAL--RQVEMFHAVAGTTGLIMTKMDGTARGGGLIP--------IVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       242 gq~~~--~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls--------~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      |-..-  ..+..-.+.----=+++-|.|--...-..-.        .......||.|++.  |+++++|-.
T Consensus       267 ~~~~qD~~i~~~i~~~~k~~ii~~NK~Dli~~~~~~~~~~~~i~~~l~~~~~~pI~fiSA~~g~gi~kl~~  337 (429)
T TIGR03594       267 GITEQDLRIAGLALEAGKALIIVVNKWDLVKDEKTREEFKKELRRKLPFLDFAPIVFISALTGQGVDKLLD  337 (429)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEEEHHHCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH
T ss_conf             88488899999898739976999972230379999999999999856236898689973457789999999


No 191
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=97.27  E-value=0.0021  Score=44.18  Aligned_cols=80  Identities=30%  Similarity=0.395  Sum_probs=46.0

Q ss_pred             CCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH------HCCCC-CCCC-CCCCC
Q ss_conf             6674-12311354444424789999999852267426774345124568899999753------03532-1223-58661
Q gi|254780709|r  108 SHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR------TSADF-VCSE-IGSDA  178 (321)
Q Consensus       108 ~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~------~~v~~-~~~~-~~~dp  178 (321)
                      +++| ..+||+||+|||||-++-.||..+..   .  ++..|         .-.|.+.      +|.|= |.+. .|.  
T Consensus       484 ~~rPigsFlf~GPTGVGKTElak~LA~~L~~---~--lir~D---------MSEy~e~hsvsrLiGaPPGYVGy~eGG--  547 (758)
T PRK11034        484 EHKPVGSFLFAGPTGVGKTEVTVQLSKALGI---E--LLRFD---------MSEYMERHTVSRLIGAPPGYVGFDQGG--  547 (758)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHH---H--HHCCC---------HHHHCCHHHHHHHCCCCCCCCCCCCCC--
T ss_conf             9997058999789987779999999999866---7--72142---------665312014777448998666767777--


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCCH
Q ss_conf             245422899996514875998654333211
Q gi|254780709|r  179 AALAYEAFKQAQAKKVDVLIIDTAGRLHNN  208 (321)
Q Consensus       179 ~~v~~~a~~~a~~~~~DvvliDTAGR~~~~  208 (321)
                        ...+++   +.+-|-|||.|---.-|-+
T Consensus       548 --~Lte~V---r~~PysVvL~DEIEKAhpd  572 (758)
T PRK11034        548 --LLTDAV---IKHPHAVLLLDEIEKAHPD  572 (758)
T ss_pred             --CCCHHH---HHCCCEEEEEHHHHHHCHH
T ss_conf             --012878---7398779973367563989


No 192
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=97.27  E-value=0.0017  Score=44.76  Aligned_cols=132  Identities=18%  Similarity=0.169  Sum_probs=64.9

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC----CEEEEECCCCCHHHHHHHHHHHHHHCCCCCC---CCCCCC---
Q ss_conf             667412311354444424789999999852267----4267743451245688999997530353212---235866---
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL----KVMLAAGDTFRSAAIDQLKIWADRTSADFVC---SEIGSD---  177 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~----kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~---~~~~~d---  177 (321)
                      ..-|+.+||.||.|+||||++-.+|.++-.++.    ...+...|..-+- ..|+..- ..-++-.+.   .....+   
T Consensus        42 gRl~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~pd~~~~~-~r~i~~g-~hpdl~~i~r~~d~k~~~~~~  119 (352)
T PRK09112         42 GRLHHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLADPDPASPL-WRQIAQG-AHPNLLHLTRPFDEKTGKFKT  119 (352)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHH-HHHHHCC-CCCCEEEEECCCCHHHHHHHC
T ss_conf             99652465358998089999999999986699866686556788878778-9999748-999956553432202145433


Q ss_pred             --CHHHHHHHHHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             --1245422899996----514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  178 --AAALAYEAFKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       178 --p~~v~~~a~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                        ++.-+++-.+++.    ..+|-|+|||-|-+|..+..  +-|-|+       .+..|..+++++=++.-+.....++
T Consensus       120 ~I~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m~~~aa--NALLK~-------LEEPp~~~~fiLit~~~~~ll~TI~  189 (352)
T PRK09112        120 AITVDEIRRVTHFLSQTSGDGNWRIVIIDPADDMNRNAA--NAILKT-------LEEPPARALFILISHSSGRLLPTIR  189 (352)
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHH--HHHHHH-------HHCCCCCEEEEEEECCHHHCHHHHH
T ss_conf             577799999999845488668806999818787469999--999998-------5348987489988699777768999


No 193
>PRK00889 adenylylsulfate kinase; Provisional
Probab=97.26  E-value=0.00031  Score=49.99  Aligned_cols=45  Identities=31%  Similarity=0.525  Sum_probs=41.2

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH
Q ss_conf             674123113544444247899999998522674267743451245
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA  153 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~a  153 (321)
                      +++.||-|.|+.||||||-+-+|..++...|.++.++-+|.+|.+
T Consensus         2 ~kg~viWltGlsgSGKTTia~~l~~~L~~~~~~~~~LDGD~lR~~   46 (175)
T PRK00889          2 QRGVTVWFTGLSGAGKTTISHALAEKLRARGYPVEVLDGDIVRTN   46 (175)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHHH
T ss_conf             988899988989999999999999999986996799776888875


No 194
>TIGR03453 partition_RepA plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error.
Probab=97.26  E-value=0.00025  Score=50.74  Aligned_cols=43  Identities=28%  Similarity=0.353  Sum_probs=35.5

Q ss_pred             CCCCCEEECCCC-CCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             667412311354-4444247899999998522674267743451
Q gi|254780709|r  108 SHRPHVILVVGV-NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF  150 (321)
Q Consensus       108 ~~~p~vil~vG~-nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf  150 (321)
                      ..++.||.+.-- =|||||||+.-||+++..+|+||++|-+|..
T Consensus       101 g~~~~VIav~N~KGGVGKTTtav~LA~~LA~~G~RVLvIDLDPQ  144 (387)
T TIGR03453       101 GEHLQVIAVTNFKGGSGKTTTSAHLAQYLALRGYRVLAIDLDPQ  144 (387)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             99880899978887656999999999999977998899953701


No 195
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=97.25  E-value=0.02  Score=37.31  Aligned_cols=27  Identities=41%  Similarity=0.629  Sum_probs=22.4

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             741231135444442478999999985
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      -.+.++|.|+.|+||||+.-=||+.+.
T Consensus        37 l~haylf~G~rGvGKTt~Ari~Ak~lN   63 (704)
T PRK08691         37 LHHAYLLTGTRGVGKTTIARILAKSLN   63 (704)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             752375027898788899999999967


No 196
>KOG2878 consensus
Probab=97.24  E-value=0.0014  Score=45.44  Aligned_cols=85  Identities=20%  Similarity=0.218  Sum_probs=62.8

Q ss_pred             CCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHC--C-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCCHH
Q ss_conf             136674123113544444247899999998522--6-74267743451245688999997530353212--235866124
Q gi|254780709|r  106 DFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDA--G-LKVMLAAGDTFRSAAIDQLKIWADRTSADFVC--SEIGSDAAA  180 (321)
Q Consensus       106 ~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~--g-~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~--~~~~~dp~~  180 (321)
                      ...+-|.+|-|.||+|+||||+..-|-+.+.++  + ++++-++.|-|---+-+|++.--.--+-++..  +-.|+.-..
T Consensus        26 ~G~~~Pl~igfSgPQGsGKstl~~ald~~lt~Ky~~E~s~~~~SvDDFYLThe~Q~eL~k~npnN~Llq~RGlaGtHD~k  105 (282)
T KOG2878          26 DGDDVPLVIGFSGPQGSGKSTLVFALDYKLTKKYIQEYSSATISVDDFYLTHEGQAELRKKNPNNALLQYRGLAGTHDLK  105 (282)
T ss_pred             CCCCCCEEEEECCCCCCCCEEEHHHHHHHHHHHHCCCCCEEEEEECCEEEECHHHHHHHHHCCCCHHHCCCCCCCCCCHH
T ss_conf             78867679993378888830431456789999853644148997210366025578887509998021147888852089


Q ss_pred             HHHHHHHHHH
Q ss_conf             5422899996
Q gi|254780709|r  181 LAYEAFKQAQ  190 (321)
Q Consensus       181 v~~~a~~~a~  190 (321)
                      ...+.+...-
T Consensus       106 ll~evLna~~  115 (282)
T KOG2878         106 LLVEVLNALS  115 (282)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999997


No 197
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]
Probab=97.24  E-value=0.0021  Score=44.23  Aligned_cols=99  Identities=22%  Similarity=0.341  Sum_probs=64.1

Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC---CHHHHHHHHHHHHHHHCCCCCCCCC----CCCCCCCCEEECCCCCC
Q ss_conf             9999997388989999999999987512789---9899999999987852010012100----01366741231135444
Q gi|254780709|r   49 LEDLLIRSDIGVAVAQKIVEELLTKRYAKDV---SVQRVLYDVSELIHKMLMPLSKPFN----WDFSHRPHVILVVGVNG  121 (321)
Q Consensus        49 Lee~LL~ADVg~~va~~Iie~ik~~~~~~~i---~~~~i~~~l~~~L~~~L~~~~~~~~----~~~~~~p~vil~vG~nG  121 (321)
                      |-..|..+.|.++.+-.|.-.+.++...+++   +.+++.+..+..+.+.-....+...    +.....|.+|++=|+.|
T Consensus        20 L~rSlta~g~~p~~Ay~iA~~i~e~L~~~~~~~v~~~eir~~~~~l~~k~~~e~a~rY~lwR~ir~~~~p~IILIGGasG   99 (299)
T COG2074          20 LARSLTAAGVDPDLAYSIAIEIQEELKKEGIRLVTKDEIREVYQKLLEKGDPEVAKRYLLWRRIRKMKRPLIILIGGASG   99 (299)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             98888861468258999999999999757972761999999999998732879999999999986157875999617887


Q ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             442478999999985226742677434512
Q gi|254780709|r  122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       122 ~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      |||||-++-+|+++-=   + -++.+|.-|
T Consensus       100 VGkStIA~ElA~rLgI---~-~visTD~IR  125 (299)
T COG2074         100 VGKSTIAGELARRLGI---R-SVISTDSIR  125 (299)
T ss_pred             CCHHHHHHHHHHHCCC---C-EEECCHHHH
T ss_conf             7725799999997298---6-100424799


No 198
>PRK10865 protein disaggregation chaperone; Provisional
Probab=97.24  E-value=0.0013  Score=45.65  Aligned_cols=130  Identities=17%  Similarity=0.210  Sum_probs=64.0

Q ss_pred             CCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCC-CCCCCHHHHH
Q ss_conf             36674-1231135444442478999999985226742677434512456889999975303532-1223-5866124542
Q gi|254780709|r  107 FSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSE-IGSDAAALAY  183 (321)
Q Consensus       107 ~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~-~~~dp~~v~~  183 (321)
                      .+++| .++||+||+|||||-++--||.++-.....  |+..|-   .-+-.=-..+.-+|.|= |.+. .|.    ...
T Consensus       593 dp~rPiGsFLFlGPTGVGKTElAK~LA~~LF~~e~~--liriDM---SEy~E~hsVSrLiGaPPGYVGy~eGG----~LT  663 (857)
T PRK10865        593 DPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDA--MVRIDM---SEFMEKHSVSRLVGAPPGYVGYEEGG----YLT  663 (857)
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCHHH--EEEECC---HHHCCCHHHHHHCCCCCCCCCCCCCC----CHH
T ss_conf             999973899986898788899999999998389334--256253---32113012767558998766757788----110


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCCHHHHHH
Q ss_conf             28999965148759986543332115-77899998998763022-2343011231023352257789
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNNS-ILMAGIGKMIRVLKRLD-PHAPHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~~-~lm~EL~ki~~v~~~~~-~~~p~~~~lVlda~~gq~~~~~  248 (321)
                      +++   +.+-|-|||.|---.-|-+. |++-++-.=-+.-.... ...---++.++-++.|.+.+..
T Consensus       664 eaV---Rr~PySVvLfDEIEKAHpdV~nilLQvlD~G~LtD~~Gr~vdF~NtIIImTSN~Gs~~i~~  727 (857)
T PRK10865        664 EAV---RRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQE  727 (857)
T ss_pred             HHH---HHCCCEEEEEHHHHHHCHHHHHHHHHHHCCCEEECCCCCEEEEEEEEEEECCCHHHHHHHH
T ss_conf             999---8198778863257663858999999870368320799988851334899646233699986


No 199
>PRK07952 DNA replication protein DnaC; Validated
Probab=97.23  E-value=0.0024  Score=43.85  Aligned_cols=93  Identities=16%  Similarity=0.245  Sum_probs=58.3

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      ...-++|.|+.|+|||.-++=+|+.+..+|++|+.++.--+    ++.|+.        .|.....+ ..    +-+.  
T Consensus        95 ~~~gLlF~G~~GTGKThLA~aIan~Li~~G~sVlf~t~~dL----l~~lr~--------t~~~~~~~-e~----~~l~--  155 (242)
T PRK07952         95 NIASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADI----MSAMKD--------TFRNSETS-EE----QLLN--  155 (242)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH----HHHHHH--------HHHCCCCC-HH----HHHH--
T ss_conf             88717997899997899999999999987994999779999----999999--------98068756-99----9999--


Q ss_pred             HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             65148759986543332115778999989987630
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKR  224 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~  224 (321)
                      ...++|+++||--|--+..+.   +...+..+++.
T Consensus       156 ~l~~~dLLIiDdlG~e~~t~~---~~~~lf~iId~  187 (242)
T PRK07952        156 DLSNVDLLVIDEIGVQTESRY---EKVIINQIVDR  187 (242)
T ss_pred             HHHCCCEEEEECCCCCCCCHH---HHHHHHHHHHH
T ss_conf             863189898730146658888---99999999999


No 200
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed
Probab=97.23  E-value=0.0019  Score=44.57  Aligned_cols=27  Identities=37%  Similarity=0.557  Sum_probs=21.6

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             741231135444442478999999985
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      -.+-+||.|+.||||||+.-=||+-+.
T Consensus        37 ~~~a~l~~g~rg~gkt~~ar~~ak~ln   63 (705)
T PRK05648         37 LHHAYLFTGTRGVGKTTIARIIAKCLN   63 (705)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             630465007898889899999999867


No 201
>PRK06835 DNA replication protein DnaC; Validated
Probab=97.23  E-value=0.0041  Score=42.17  Aligned_cols=85  Identities=24%  Similarity=0.292  Sum_probs=56.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      .-++|.|++|+|||--+.=+|+.+..+|++|+..++.-+    ++.|+.+-       +. ..+..     .+.++.  .
T Consensus       184 ~nLlf~G~~G~GKTfLa~~IA~ell~~g~sViy~ta~~L----~~~l~~~~-------~~-~~~~~-----~~~~~~--l  244 (330)
T PRK06835        184 ENLLFYGNTGTGKTFLSNCIAKELLDRGKTVIYRTSDEL----IENLREIR-------FN-NDNDA-----PELEDL--L  244 (330)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH----HHHHHHHH-------CC-CCCCH-----HHHHHH--H
T ss_conf             866988999998899999999999987994999629999----99999975-------45-76448-----999999--9


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             148759986543332115778999
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGI  215 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL  215 (321)
                      .++|++|||--|--+...--.++|
T Consensus       245 ~~~DLLIIDDLG~E~~t~~~~~~L  268 (330)
T PRK06835        245 INCDLLIIDDLGTESITEFSKTEL  268 (330)
T ss_pred             HHCCEEEEECCCCCCCCHHHHHHH
T ss_conf             618989972103455886899999


No 202
>PRK08233 hypothetical protein; Provisional
Probab=97.22  E-value=0.002  Score=44.39  Aligned_cols=84  Identities=23%  Similarity=0.381  Sum_probs=51.9

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             674123113544444247899999998522674267743451-2456889999975303532122358661245422899
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF-RSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf-R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      ++|.||.+.|.+||||||-+-+|.+.+..   .+ +..-|.| +.-+-+++..|-+.-. .+  ..  -|--. ..+.+.
T Consensus         1 kkp~IIgIaGgSgSGKTtla~~l~~~l~~---~~-~~~~D~y~~~~~~~~~~~~~~~~~-~~--d~--~d~~~-l~~~l~   70 (182)
T PRK08233          1 KKTKIITIAAVSGGGKTTLTERLTHKLKN---SK-ALYFDRYDFDNCPEDICKWIDDGA-NY--SE--WVLTP-LIKDIQ   70 (182)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCC---CE-EEEECCCCCCCCHHHHHHHHCCCC-CC--CH--HHHHH-HHHHHH
T ss_conf             99889999688867899999999997467---75-899666555468788998740677-86--66--66999-999999


Q ss_pred             HHHH-HCCCEEEEECC
Q ss_conf             9965-14875998654
Q gi|254780709|r  188 QAQA-KKVDVLIIDTA  202 (321)
Q Consensus       188 ~a~~-~~~DvvliDTA  202 (321)
                      ..+. +.+|+|++|-.
T Consensus        71 ~l~~~~~~d~iIvEgi   86 (182)
T PRK08233         71 ELIAKSNVDYIIVDYP   86 (182)
T ss_pred             HHHCCCCCCEEEEEEE
T ss_conf             9855998728999644


No 203
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=97.21  E-value=0.0074  Score=40.37  Aligned_cols=28  Identities=29%  Similarity=0.474  Sum_probs=21.7

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      .-|+.+||.||.|+|||||+-=+|+-+-
T Consensus        36 ~i~hayLf~GprG~GKTs~Ari~akaln   63 (541)
T PRK05563         36 RIAHAYLFCGTRGTGKTSTAKIFAKAVN   63 (541)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             9320453038799589999999999957


No 204
>PRK00454 engB GTPase EngB; Reviewed
Probab=97.21  E-value=0.025  Score=36.70  Aligned_cols=152  Identities=16%  Similarity=0.234  Sum_probs=78.5

Q ss_pred             CCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             013667412311354444424789999999852267-4267743451245688999997530353212235866124542
Q gi|254780709|r  105 WDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL-KVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY  183 (321)
Q Consensus       105 ~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~-kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~  183 (321)
                      ++..+.|. |.++|-.-|||+|-+=.|.      |. ++++++ ++  ||-. +        .+.++.            
T Consensus        19 ~p~~~~p~-VaivGrpNvGKSTL~N~L~------g~k~~a~vs-~~--pgtT-r--------~i~~~~------------   67 (196)
T PRK00454         19 LPPDDGPE-IAFAGRSNVGKSSLINALT------NRKNLARTS-KT--PGRT-Q--------LINFFE------------   67 (196)
T ss_pred             CCCCCCCE-EEEECCCCCCHHHHHHHHH------CCCCEEEEE-CC--CCCE-E--------EEEEEE------------
T ss_conf             99988968-9998489888999999986------897369974-78--8860-7--------988876------------


Q ss_pred             HHHHHHHHHCCCEEEEECCC-----CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHH
Q ss_conf             28999965148759986543-----33211577899998998763022234301123102335225-----778999876
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAG-----RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFH  253 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAG-----R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~  253 (321)
                              .+..+++|||+|     +.+.....+.++  +...+...  ..-.-+++++||..|-.     .+++++.+.
T Consensus        68 --------~~~~~~lvDtpGyG~a~~~~~~~~~~~~~--i~~yl~~~--~~l~~villIDa~~g~~~~D~~i~~~l~~~~  135 (196)
T PRK00454         68 --------VNDGLRLVDLPGYGYAKVSKEEKEKWQKL--IEEYLQKR--ENLKGVVLLIDSRHPLKELDLEMIEWLKEAG  135 (196)
T ss_pred             --------CCCCEEEEECCCCCCCCCCHHHHHHHHHH--HHHHHHHH--HCCCEEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             --------18833899379974132778788899999--99999962--3336389999716589888999999998627


Q ss_pred             HHCCCCEEEEECCCCCCCHHH---HHHHHHHH-----CCCEEEEEC--CCCCCCCCCCC
Q ss_conf             435897699965457870699---99999997-----698899975--89813255577
Q gi|254780709|r  254 AVAGTTGLIMTKMDGTARGGG---LIPIVVTH-----KIPVYFLGV--GEGINDLEPFV  302 (321)
Q Consensus       254 ~~~~~~g~I~TKlD~ta~~G~---~ls~~~~~-----~~Pi~fig~--Ge~i~Dl~~f~  302 (321)
                        .| .=++++|.|--.+...   ...+....     ..||.+++.  |+++++|...-
T Consensus       136 --~p-~iivlNKiD~l~~~~~~~~~~~i~~~l~~~~~~~~ii~ISA~~g~GI~eL~~~I  191 (196)
T PRK00454        136 --IP-VLIVLTKADKLKKGERKKLLKKVKKALARFAADPEVLLFSSLKKTGIDELRAAI  191 (196)
T ss_pred             --CC-CEEEEECCHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             --78-599998725169789999999999997612589828999699997989999999


No 205
>KOG0925 consensus
Probab=97.20  E-value=0.0017  Score=44.88  Aligned_cols=177  Identities=25%  Similarity=0.237  Sum_probs=106.6

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC-----C--CCCCCCHHHH--
Q ss_conf             123113544444247899999998522674267743451245688999997530353212-----2--3586612454--
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC-----S--EIGSDAAALA--  182 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~-----~--~~~~dp~~v~--  182 (321)
                      .+|.+||-+|+||||-+--.+..+...-. -+++++-..|.||+.--+-.|+.++|.+=.     .  +.-+-|-.+.  
T Consensus        63 Q~~v~vGetgsGKttQiPq~~~~~~~~~~-~~v~CTQprrvaamsva~RVadEMDv~lG~EVGysIrfEdC~~~~T~Lky  141 (699)
T KOG0925          63 QIIVLVGETGSGKTTQIPQFVLEYELSHL-TGVACTQPRRVAAMSVAQRVADEMDVTLGEEVGYSIRFEDCTSPNTLLKY  141 (699)
T ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHC-CCEEECCCHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCHHHHHHH
T ss_conf             26999934888864547499999987633-66132471578899999988887443102011532121236871589999


Q ss_pred             -------HHHHHHHHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             -------228999965148759986543-332115778999989987630222343011231023352257789998764
Q gi|254780709|r  183 -------YEAFKQAQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA  254 (321)
Q Consensus       183 -------~~a~~~a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~  254 (321)
                             ++|+..--...|.+||.|-|- |+---.-||.=|+.+.+       ..|+..+.|++|+.  ++-.--.-|.+
T Consensus       142 ~tDgmLlrEams~p~l~~y~viiLDeahERtlATDiLmGllk~v~~-------~rpdLk~vvmSatl--~a~Kfq~yf~n  212 (699)
T KOG0925         142 CTDGMLLREAMSDPLLGRYGVIILDEAHERTLATDILMGLLKEVVR-------NRPDLKLVVMSATL--DAEKFQRYFGN  212 (699)
T ss_pred             HCCHHHHHHHHCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHHHH-------HCCCCEEEEEECCC--CHHHHHHHCCC
T ss_conf             5332899987508554530079953166666789999999999986-------19881699940601--25999987079


Q ss_pred             HCCC---C-----EEEEECCCCCCCHHHHHHHHHH------HCCCEEEEECCCCCCCCC
Q ss_conf             3589---7-----6999654578706999999999------769889997589813255
Q gi|254780709|r  255 VAGT---T-----GLIMTKMDGTARGGGLIPIVVT------HKIPVYFLGVGEGINDLE  299 (321)
Q Consensus       255 ~~~~---~-----g~I~TKlD~ta~~G~~ls~~~~------~~~Pi~fig~Ge~i~Dl~  299 (321)
                      . |+   -     -++.|---+-.+.-+|+-.+.+      -|-=+.|++.-|.|+|-.
T Consensus       213 ~-Pll~Vpg~~PvEi~Yt~e~erDylEaairtV~qih~~ee~GDilvFLtgeeeIe~aC  270 (699)
T KOG0925         213 A-PLLAVPGTHPVEIFYTPEPERDYLEAAIRTVLQIHMCEEPGDILVFLTGEEEIEDAC  270 (699)
T ss_pred             C-CEEECCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHH
T ss_conf             9-756458988457883588873689999999999984168887899946778999999


No 206
>PRK09270 frcK putative fructose transport system kinase; Reviewed
Probab=97.20  E-value=0.00049  Score=48.66  Aligned_cols=43  Identities=28%  Similarity=0.424  Sum_probs=36.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC--CEEEEECCCC
Q ss_conf             667412311354444424789999999852267--4267743451
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL--KVMLAAGDTF  150 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~--kV~lva~Dtf  150 (321)
                      ++++.+|.+.|+.||||||.+.+|+..+.+.+.  .|.+++.|-|
T Consensus        31 ~~rR~lIgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~vpmDGF   75 (230)
T PRK09270         31 PQRRTVVGIAGPPGAGKSTLAETLWEALSQQGPELPAIQVPMDGF   75 (230)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             997189999899988999999999999862379985799736533


No 207
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=97.20  E-value=0.0095  Score=39.61  Aligned_cols=152  Identities=22%  Similarity=0.256  Sum_probs=88.2

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             36674123113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      +.++.-+|.+||-.-|||.|-.-+|.      |++.++|.                +.-|+.-       |...      
T Consensus        34 ~~~~lPiVaIvGRPNVGKStLFNrL~------~~~~AIV~----------------d~pGvTR-------Dr~~------   78 (474)
T PRK03003         34 ASGPLPVVAVVGRPNVGKSTLVNRIL------GRREAVVE----------------DIPGVTR-------DRVS------   78 (474)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHH------CCCEEEEC----------------CCCCCCC-------CCEE------
T ss_conf             67999989998999988899999986------88638805----------------9899880-------8636------


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHH-HHHHHCCCCCCCCEEEEECCCCCCHHHH--HHHHHHHHHCCCCEEEE
Q ss_conf             99965148759986543332115778999989-9876302223430112310233522577--89998764358976999
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM-IRVLKRLDPHAPHSVLQVLDATTGQNAL--RQVEMFHAVAGTTGLIM  263 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki-~~v~~~~~~~~p~~~~lVlda~~gq~~~--~~a~~F~~~~~~~g~I~  263 (321)
                      ..+.-.+..+.+|||+|=......+...+..- ..+++     ..+-++||+|+..|-...  +.|+...+.-.--=+++
T Consensus        79 ~~~~~~~~~f~lvDTgG~~~~~~~~~~~i~~q~~~ai~-----eaD~IlfVvD~~~glt~~D~eia~~LRk~~kpviLVv  153 (474)
T PRK03003         79 YDAEWNGRRFVVQDTGGWEPDAKGLQALVAEQAEVAMR-----TADAVLFVVDATVGATATDEAVARLLRRSGKPVFLAA  153 (474)
T ss_pred             EEEEECCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             89999992899997999999747899999999999998-----6999999996898988789999999875399779986


Q ss_pred             ECCCCCCCHHHHHHHHHHHCC-CEEEEEC--CCCCCCCC
Q ss_conf             654578706999999999769-8899975--89813255
Q gi|254780709|r  264 TKMDGTARGGGLIPIVVTHKI-PVYFLGV--GEGINDLE  299 (321)
Q Consensus       264 TKlD~ta~~G~~ls~~~~~~~-Pi~fig~--Ge~i~Dl~  299 (321)
                      .|.|+.. .-...+-.|.+|. .+.+|+.  |..++||.
T Consensus       154 NK~D~~~-~~~~~~efy~LGf~~~i~ISA~Hg~Gi~dLl  191 (474)
T PRK03003        154 NKVDSER-GEADAAALWSLGLGEPHPVSALHGRGVADLL  191 (474)
T ss_pred             ECCCCCC-HHHHHHHHHHHCCCCEEEEEHHCCCCHHHHH
T ss_conf             7556621-0234899997579986996020378979999


No 208
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms. The enzyme catalyzes formation of the ureido ring of dethiobiotin from (7R,8S)-7,8-diaminononanoic acid (DAPA) and carbon dioxide. The enzyme utilizes carbon dioxide instead of hydrogen carbonate as substrate and is dependent on ATP and divalent metal ions as cofactors.
Probab=97.19  E-value=0.016  Score=38.07  Aligned_cols=116  Identities=19%  Similarity=0.225  Sum_probs=72.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             44444247899999998522674267743451245688999997530353212235866124542289999651487599
Q gi|254780709|r  119 VNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLI  198 (321)
Q Consensus       119 ~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~Dvvl  198 (321)
                      =+|+|||...|-|+..++++|++|.-.     .|-                                      +-||+++
T Consensus         7 dT~VGKT~vt~~l~~~l~~~G~~v~~~-----KPv--------------------------------------~t~D~vl   43 (134)
T cd03109           7 GTDIGKTVATAILARALKEKGYRVAPL-----KPV--------------------------------------QTYDFVL   43 (134)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEE-----CHH--------------------------------------HCCCEEE
T ss_conf             888768999999999999779917787-----566--------------------------------------7279899


Q ss_pred             EECCCCC--CCH-HHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--HHHHHHH-HHHHHCCCCEEEEECCCCCCCH
Q ss_conf             8654333--211-57789999899876302223430112310233522--5778999-8764358976999654578706
Q gi|254780709|r  199 IDTAGRL--HNN-SILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--NALRQVE-MFHAVAGTTGLIMTKMDGTARG  272 (321)
Q Consensus       199 iDTAGR~--~~~-~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--~~~~~a~-~F~~~~~~~g~I~TKlD~ta~~  272 (321)
                      |--||=.  +.+ ..+|..|   .+.++       .-++||.++-.|-  .++-.++ .-+.-+++-|+|+...+...-.
T Consensus        44 VEGaGG~~vPl~~~~~~~Dl---~~~l~-------~pvIlV~~~~LG~INhtlLt~eal~~~gi~v~G~i~N~~~~~~~~  113 (134)
T cd03109          44 VEGAGGLCVPLKEDFTNADV---AKELN-------LPAILVTSAGLGSINHAFLTIEAARIKGIILNGVLGNVIVEKEGL  113 (134)
T ss_pred             EECCCCEEECCCCCCCHHHH---HHHHC-------CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHH
T ss_conf             98897746003898629999---99709-------998999778878589999999999987992889999467997106


Q ss_pred             --HHHHHHHHHHCCCEE
Q ss_conf             --999999999769889
Q gi|254780709|r  273 --GGLIPIVVTHKIPVY  287 (321)
Q Consensus       273 --G~~ls~~~~~~~Pi~  287 (321)
                        =.+-.+...++.|+.
T Consensus       114 ~~~N~~~I~~~t~vPvL  130 (134)
T cd03109         114 ATLNVETIERLTGIPVL  130 (134)
T ss_pred             HHHHHHHHHHHHCCCEE
T ss_conf             78759999997499977


No 209
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=97.19  E-value=0.008  Score=40.11  Aligned_cols=148  Identities=16%  Similarity=0.245  Sum_probs=73.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |.++|.+.+||+|-+-.|..     .+++..++ +                  .|..+-    ++.  .|.       -+
T Consensus         2 IaivG~pN~GKSTL~N~L~~-----~~~~~~vs-~------------------~~gtTr----~i~--~~~-------~~   44 (170)
T cd01876           2 IAFAGRSNVGKSSLINALTN-----RKKLARTS-K------------------TPGKTQ----LIN--FFN-------VN   44 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHC-----CCCEEEEE-C------------------CCCEEE----EEE--EEE-------EC
T ss_conf             89998999999999999968-----99627860-7------------------897785----205--885-------38


Q ss_pred             CCEEEEECCCC--CCCHHHHHHHH-HHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHH-CCCCEEEEECCC
Q ss_conf             87599865433--32115778999-98998763022234301123102335225--77899987643-589769996545
Q gi|254780709|r  194 VDVLIIDTAGR--LHNNSILMAGI-GKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAV-AGTTGLIMTKMD  267 (321)
Q Consensus       194 ~DvvliDTAGR--~~~~~~lm~EL-~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~-~~~~g~I~TKlD  267 (321)
                      ..+++|||+|-  ........... ..+.+.+....  .-+.+++|+||+.|-.  -.+.++...+. .| -=++++|.|
T Consensus        45 ~~~~~vDtPG~g~~~~~~~~~~~~~~~~~~~l~~~~--~~~~vi~viD~~~~~~~~d~~i~~~l~~~~kp-~iiVlNKiD  121 (170)
T cd01876          45 DKFRLVDLPGYGYAKVSKEVKEKWGKLIEEYLENRE--NLKGVVLLIDSRHGPTEIDLEMLDWLEELGIP-FLVVLTKAD  121 (170)
T ss_pred             CEEEEEECCCCHHCCCCHHHHHHHHHHHHHHHHHHH--HHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEEEEE
T ss_conf             779999657840101687799999999999998406--33499999963223748689999999876998-799998675


Q ss_pred             CCCCHHH--HH-HHHHH-----HCCCEEEEEC--CCCCCCCCCC
Q ss_conf             7870699--99-99999-----7698899975--8981325557
Q gi|254780709|r  268 GTARGGG--LI-PIVVT-----HKIPVYFLGV--GEGINDLEPF  301 (321)
Q Consensus       268 ~ta~~G~--~l-s~~~~-----~~~Pi~fig~--Ge~i~Dl~~f  301 (321)
                      --.+...  .+ .+...     ...||.+++.  |+.+++|...
T Consensus       122 lv~~~~~~~~~~~~~~~l~~~~~~~~ii~iSA~~g~gi~~L~~~  165 (170)
T cd01876         122 KLKKSELAKALKEIKKELKLFEIDPPIILFSSLKGQGIDELRAL  165 (170)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             37877899999999998742179983999988999779999999


No 210
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=97.19  E-value=0.0037  Score=42.51  Aligned_cols=88  Identities=25%  Similarity=0.415  Sum_probs=65.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC--CCCCCCCCCHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532--1223586612454228999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF--VCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~--~~~~~~~dp~~v~~~a~~~  188 (321)
                      -.++|+-|-.|.||+|-+-.+|..+.++|.+|+-+++-    -..+|++.-|+|+++.-  +.--.+.|-.    +-++.
T Consensus        82 GSvvLlgGePGIGKSTLLLQia~~la~~~~~vLYvSGE----ES~~QIk~RA~RLg~~~~~l~l~set~le----~Il~~  153 (372)
T cd01121          82 GSVILIGGDPGIGKSTLLLQVAARLAKRGGKVLYVSGE----ESPEQIKLRADRLGISTENLYLLAETNLE----DILAS  153 (372)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECH----HHHHHHHHHHHHHCCCCCCCEEEECCCHH----HHHHH
T ss_conf             71799825998868899999999998639938998245----67899998999858788772788435699----99999


Q ss_pred             HHHHCCCEEEEECCCCCC
Q ss_conf             965148759986543332
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLH  206 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~  206 (321)
                      ....+.|+++||.-=-++
T Consensus       154 i~~~kP~~lIIDSIQT~~  171 (372)
T cd01121         154 IEELKPDLVIIDSIQTVY  171 (372)
T ss_pred             HHHHCCCEEEEECHHHCC
T ss_conf             997199889995622020


No 211
>PRK08770 DNA polymerase III subunits gamma and tau; Validated
Probab=97.19  E-value=0.003  Score=43.09  Aligned_cols=28  Identities=36%  Similarity=0.592  Sum_probs=22.2

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      .-++-+||.|+.|+||||+.-=||+-+.
T Consensus        36 ~~~~a~lf~g~rg~gkt~~ar~~a~~ln   63 (663)
T PRK08770         36 RVHHAFLFTGTRGVGKTTIARIFAKSLN   63 (663)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             9740476227998888899999999867


No 212
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=97.18  E-value=0.00034  Score=49.77  Aligned_cols=40  Identities=35%  Similarity=0.590  Sum_probs=37.2

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             2311354444424789999999852267426774345124
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS  152 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~  152 (321)
                      ||-|.|+.||||||-+-+|..++.++|.++.++-+|.+|.
T Consensus         1 ViW~tGLsgsGKTTlA~~l~~~L~~~~~~~~~lDGD~iR~   40 (149)
T cd02027           1 VIWLTGLSGSGKSTIARALEEKLFQRGRPVYVLDGDNVRH   40 (149)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHH
T ss_conf             9898799999999999999999998699759977488997


No 213
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=97.18  E-value=0.0035  Score=42.61  Aligned_cols=114  Identities=23%  Similarity=0.285  Sum_probs=68.8

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCC---------------------CCEEEEECCCCCHH--HHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985226---------------------74267743451245--688999997530
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAG---------------------LKVMLAAGDTFRSA--AIDQLKIWADRT  165 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g---------------------~kV~lva~DtfR~a--A~eQL~~~a~~~  165 (321)
                      ..|+.+||.||.|+||||++-=||+.+.-.+                     ..+..+.+..-|..  -+||.+...+..
T Consensus        22 ~~~halL~~Gp~G~Gktt~a~~lA~~l~~~~~~~~~~~~~~~~~~~~~~~~~~d~lel~~s~~~~~~i~~~~vr~~~~~~  101 (325)
T COG0470          22 RLPHALLFYGPPGVGKTTAALALAKELLCENPTGLLPCGHCRSCKLIPAGNHPDFLELNPSDLRKIDIIVEQVRELAEFL  101 (325)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHC
T ss_conf             88761003799999789999999999658664334552002244432025688659977321333300699999999860


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             35321223586612454228999965148759986543332115778999989987630222343011231023352257
Q gi|254780709|r  166 SADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA  245 (321)
Q Consensus       166 ~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~  245 (321)
                      ...-.                    ..++-+|+||-|-+++.+..  +.|.+       ..+..|..+.+++-+.--...
T Consensus       102 ~~~~~--------------------~~~~kviiidead~mt~~A~--nallk-------~lEep~~~~~~il~~n~~~~i  152 (325)
T COG0470         102 SESPL--------------------EGGYKVVIIDEADKLTEDAA--NALLK-------TLEEPPKNTRFILITNDPSKI  152 (325)
T ss_pred             CCCCC--------------------CCCCEEEEEECCCCCCHHHH--HHHHH-------HCCCCCCCEEEEEEECCHHHC
T ss_conf             44656--------------------67726999732032698888--76754-------332488871699974985556


Q ss_pred             HHHHHH
Q ss_conf             789998
Q gi|254780709|r  246 LRQVEM  251 (321)
Q Consensus       246 ~~~a~~  251 (321)
                      +...+.
T Consensus       153 l~tI~S  158 (325)
T COG0470         153 LPTIRS  158 (325)
T ss_pred             HHHHHH
T ss_conf             478775


No 214
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=97.18  E-value=0.023  Score=36.86  Aligned_cols=28  Identities=39%  Similarity=0.566  Sum_probs=22.4

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      .-.+-+||.|+.|+||||+.-=||+-+.
T Consensus        36 r~~haylf~G~rGvGKTt~ari~Ak~ln   63 (721)
T PRK12323         36 RLHHAYLFTGTRGVGKTTLSRILAKSLN   63 (721)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             9754475027998889899999999976


No 215
>pfam02606 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family consists of tetraacyldisaccharide-1-P 4'-kinase also known as Lipid-A 4'-kinase or Lipid A biosynthesis protein LpxK, EC:2.7.1.130. This enzyme catalyses the reaction: ATP + 2,3-bis(3-hydroxytetradecanoyl)-D -glucosaminyl-(beta-D-1,6)-2,3-bis(3-hydroxytetradecanoyl)-D-glu cosam inyl beta-phosphate <= ADP + 2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-D- glucosaminyl-1,6-beta-D-glucosamine 1,4'-bisphosphate. This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS). The family contains a P-loop motif at the N terminus.
Probab=97.18  E-value=0.0034  Score=42.74  Aligned_cols=78  Identities=24%  Similarity=0.296  Sum_probs=51.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---------------CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             35444442478999999985226742677434---------------512456889999975303532122358661245
Q gi|254780709|r  117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---------------TFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL  181 (321)
Q Consensus       117 vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D---------------tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v  181 (321)
                      +-+-|+|||-.+-.||.+++.+|++|++++=-               +.+-.+=|.+. ++...++|++.++.-      
T Consensus        43 it~GGtGKTP~v~~l~~~l~~~g~~~~ilSRGYg~~~~~~~~v~~~~~~~~~GDEp~l-la~~~~~~v~V~~~R------  115 (318)
T pfam02606        43 ITVGGTGKTPLVIALAELLRARGLRPGVLSRGYGGKSKGPVLVDPGSSAAEVGDEPLL-LARRTPVPVVVGPDR------  115 (318)
T ss_pred             EEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCEEECCCCCHHHCCCHHHH-HHHHCCCCEEECCCH------
T ss_conf             8458878589999999999976994478326767657887897168894673969999-987569859980528------


Q ss_pred             HHHHHHHHH-HHCCCEEEEECC
Q ss_conf             422899996-514875998654
Q gi|254780709|r  182 AYEAFKQAQ-AKKVDVLIIDTA  202 (321)
Q Consensus       182 ~~~a~~~a~-~~~~DvvliDTA  202 (321)
                       .+|++++. ..++|+||.|-+
T Consensus       116 -~~a~~~l~~~~~~dviIlDDG  136 (318)
T pfam02606       116 -AAAARALLEAHGADVIILDDG  136 (318)
T ss_pred             -HHHHHHHHHHCCCCEEEECCC
T ss_conf             -999999998489979991486


No 216
>PRK13695 putative NTPase; Provisional
Probab=97.16  E-value=0.00067  Score=47.67  Aligned_cols=101  Identities=25%  Similarity=0.341  Sum_probs=61.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCE-EEEECCCCCHHHHHHHHHHHHHHCCCCCCC-----------------
Q ss_conf             41231135444442478999999985226742-677434512456889999975303532122-----------------
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKV-MLAAGDTFRSAAIDQLKIWADRTSADFVCS-----------------  172 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV-~lva~DtfR~aA~eQL~~~a~~~~v~~~~~-----------------  172 (321)
                      +--|++.|+.|+||||-+-|+...++..|.+| ++.+-.         .+..++|.|-.++.-                 
T Consensus         3 ~~kI~iTG~PGvGKTTli~Kv~~~L~~~g~~v~GF~T~E---------vre~G~R~GF~vv~l~~g~~~~lA~~~~~~~~   73 (174)
T PRK13695          3 ALRIGITGMPGVGKTTLVLKIAELLAREGYKVGGFITEE---------VREGGKRIGFKIIDLDTGEEGILARVGAVSRP   73 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEE---------EECCCEEEEEEEEECCCCCEEEEEECCCCCCC
T ss_conf             429998789998899999999999863696174699525---------60388285059999058856876753788985


Q ss_pred             ---CCCCCCH---HHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             ---3586612---45422899996514875998654333211577899998998763
Q gi|254780709|r  173 ---EIGSDAA---ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLK  223 (321)
Q Consensus       173 ---~~~~dp~---~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~  223 (321)
                         .++-|..   .++-.++..|. ...|+++||--|+|........+  .+.++++
T Consensus        74 ~VgkY~V~~~~~e~~~~~~l~~a~-~~~dlivIDEIG~MEl~s~~F~~--~V~~~L~  127 (174)
T PRK13695         74 RVGKYVVNLEDLERIAIPAISRAL-READLIIIDEIGPMELKSKKFVS--AVEEVLK  127 (174)
T ss_pred             CCCCEEEEHHHHHHHHHHHHHHCC-CCCCEEEEECCCHHHHHHHHHHH--HHHHHHC
T ss_conf             545668716897899899998353-57879999631033110499999--9999973


No 217
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=97.16  E-value=0.004  Score=42.25  Aligned_cols=143  Identities=17%  Similarity=0.256  Sum_probs=76.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCH-HHHHHHHHHHHHH
Q ss_conf             311354444424789999999852267426774345124568899999753035321223586612-4542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA-ALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~-~v~~~a~~~a~~~  192 (321)
                      |.++|.+-|||+|-+-.|.      |.++.+.  |.  |+                -+    .+|. .+.    .  ...
T Consensus         3 VAiiG~pNvGKSTLlN~l~------~~~~~V~--~~--pg----------------TT----~~~~~g~i----~--~~~   46 (170)
T cd01898           3 VGLVGLPNAGKSTLLSAIS------NAKPKIA--DY--PF----------------TT----LVPNLGVV----R--VDD   46 (170)
T ss_pred             EEEECCCCCCHHHHHHHHH------CCCCEEE--CC--CC----------------CC----CCCEEEEE----E--ECC
T ss_conf             8998999998999999996------7876032--56--66----------------52----37447799----9--369


Q ss_pred             CCCEEEEECCCC---CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC---------CCE
Q ss_conf             487599865433---32115778999989987630222343011231023352257789998764358---------976
Q gi|254780709|r  193 KVDVLIIDTAGR---LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAG---------TTG  260 (321)
Q Consensus       193 ~~DvvliDTAGR---~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~---------~~g  260 (321)
                      +..++++||+|=   .|.+.++..+.   .+.+.     ..+-+++|+|++...+..++.+...+.+.         -.=
T Consensus        47 ~~~i~~~DtpGi~~~~~~~~~l~~~~---l~~i~-----~advil~vvD~~~~~~~~~~~~~i~~~l~~~~~~~~~kp~i  118 (170)
T cd01898          47 GRSFVVADIPGLIEGASEGKGLGHRF---LRHIE-----RTRLLLHVIDLSGDDDPVEDYKTIRNELELYNPELLEKPRI  118 (170)
T ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHH---HHCCC-----CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCHHHHCCCCE
T ss_conf             85699964886444554662248999---86133-----45617999989987898999999999999827444038650


Q ss_pred             EEEECCCCCCCH--HHHHHH--HHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             999654578706--999999--9997698899975--898132555
Q gi|254780709|r  261 LIMTKMDGTARG--GGLIPI--VVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       261 ~I~TKlD~ta~~--G~~ls~--~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      ++++|.|--.+-  -..+.-  ....+.|+.|++.  |++++.|..
T Consensus       119 lv~NK~Dl~~~~~~~~~~~~~~~~~~~~~vi~iSA~~g~gi~~L~~  164 (170)
T cd01898         119 VVLNKIDLLDEEELFELLKELLKELWGKPVFPISALTGEGLDELLR  164 (170)
T ss_pred             EEEEHHHCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
T ss_conf             6776202428356389999999856999589997547979999999


No 218
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=97.16  E-value=0.0034  Score=42.69  Aligned_cols=29  Identities=34%  Similarity=0.574  Sum_probs=23.7

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             674123113544444247899999998522
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDA  138 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~  138 (321)
                      .-|+ ++|.||.|+||||++--||+.+-..
T Consensus        36 ~~ph-lLf~GppG~GKTt~a~~la~~l~~~   64 (318)
T PRK00440         36 NMPH-LLFAGPPGTGKTTAALALARELYGE   64 (318)
T ss_pred             CCCE-EEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             9866-9888959988999999999997698


No 219
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=97.15  E-value=0.00046  Score=48.82  Aligned_cols=36  Identities=31%  Similarity=0.557  Sum_probs=32.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             23113544444247899999998522674267743451
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF  150 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf  150 (321)
                      +|.+.|+.||||||.+-+|+..+.  +.+|.++++|-|
T Consensus         1 iIgI~G~sgsGKTT~a~~L~~~l~--~~~v~~i~~D~y   36 (198)
T cd02023           1 IIGIAGGSGSGKTTVAEEIIEQLG--NPKVVIISQDSY   36 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHC--CCCEEEEECCCC
T ss_conf             989889998859999999999809--998589978888


No 220
>pfam08423 Rad51 Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein.
Probab=97.15  E-value=0.0074  Score=40.38  Aligned_cols=127  Identities=20%  Similarity=0.241  Sum_probs=63.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHH-
Q ss_conf             8898999999999998751278998999999999878520100121000136674123113544444247899999998-
Q gi|254780709|r   57 DIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKM-  135 (321)
Q Consensus        57 DVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~-  135 (321)
                      |+|..++.++.++   +..-..++..      ...|-.+|+..     ++   .-.|.=++|+.|+|||+-|=-||--. 
T Consensus         6 ~~~f~t~~~~~~~---r~~~~~isTg------~~~LD~lLgGG-----i~---~g~ITEi~G~~gsGKTQlc~qlav~~q   68 (261)
T pfam08423         6 PMGFTTATELHQR---RSEVIRITTG------SKELDKLLGGG-----IE---TGSITEVFGEFRTGKTQLCHTLCVTCQ   68 (261)
T ss_pred             CCCCCCHHHHHHH---HCCCCEECCC------CHHHHHHHCCC-----CC---CCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             5787439999997---5487357789------87899873798-----66---772999989988878999999999940


Q ss_pred             -----HHCCCCEEEEECC-CCCHHHHHHHHHHHHHHCCC---------CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             -----5226742677434-51245688999997530353---------21223586612454228999965148759986
Q gi|254780709|r  136 -----SDAGLKVMLAAGD-TFRSAAIDQLKIWADRTSAD---------FVCSEIGSDAAALAYEAFKQAQAKKVDVLIID  200 (321)
Q Consensus       136 -----~~~g~kV~lva~D-tfR~aA~eQL~~~a~~~~v~---------~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliD  200 (321)
                           ...+.+|+.|.+. +|++-=+.|+   +++.+.+         ++......+-..+..........+++.+|+||
T Consensus        69 lp~~~gg~~g~vvyIDTEg~f~~eRl~qi---a~~~~~~~~~~L~~I~v~r~~~~~~~~~~l~~~~~~~~~~~v~LvVvD  145 (261)
T pfam08423        69 LPLEMGGGEGKALYIDTEGTFRPERIVAI---AERFGLDPEEVLDNIAYARAYNTEHQMQLLLQAAAMMSESRFALLIVD  145 (261)
T ss_pred             CHHHHCCCCCEEEEEECCCCCCHHHHHHH---HHHHCCCHHHHHHHCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             70965699972899936888698999999---998299978987533141689989999999999998731783499983


Q ss_pred             CCC
Q ss_conf             543
Q gi|254780709|r  201 TAG  203 (321)
Q Consensus       201 TAG  203 (321)
                      ..-
T Consensus       146 Sia  148 (261)
T pfam08423       146 SAT  148 (261)
T ss_pred             CCC
T ss_conf             240


No 221
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed
Probab=97.14  E-value=0.0036  Score=42.54  Aligned_cols=78  Identities=27%  Similarity=0.306  Sum_probs=53.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC----------------CCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             354444424789999999852267426774345----------------1245688999997530353212235866124
Q gi|254780709|r  117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT----------------FRSAAIDQLKIWADRTSADFVCSEIGSDAAA  180 (321)
Q Consensus       117 vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt----------------fR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~  180 (321)
                      +-+-|+|||-++-=||.+++.+|.+|++++=-=                .+-.+=|-+. ++.+-++|++.+..-     
T Consensus        57 itvGGtGKTP~v~~la~~l~~~g~~~~IlSRGYg~~~~~~~~v~~~~~~~~~vGDEpll-la~~~~~~v~V~~~R-----  130 (334)
T PRK00652         57 LTVGGNGKTPVVIWLAEQLQARGVKVGVVSRGYGGKSKGYPLVLPADTTAAEVGDEPVL-IAQRTGAPVAVSPDR-----  130 (334)
T ss_pred             EEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEECCCCCHHHCCCHHHH-HHHCCCCCEEEECCH-----
T ss_conf             88788777999999999999769936787346676567872761799983551868999-851789839995668-----


Q ss_pred             HHHHHHHHHHHHCCCEEEEECC
Q ss_conf             5422899996514875998654
Q gi|254780709|r  181 LAYEAFKQAQAKKVDVLIIDTA  202 (321)
Q Consensus       181 v~~~a~~~a~~~~~DvvliDTA  202 (321)
                        .+|++++...++|+||.|-+
T Consensus       131 --~~~~~~l~~~~~dviIlDDG  150 (334)
T PRK00652        131 --VKAIKALLALGADIIILDDG  150 (334)
T ss_pred             --HHHHHHHHHCCCCEEEECCC
T ss_conf             --99999999659999997476


No 222
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=97.13  E-value=0.00045  Score=48.91  Aligned_cols=132  Identities=18%  Similarity=0.317  Sum_probs=70.3

Q ss_pred             CCCCCHHHCCHHHHHHHHHHH------HHHHHHHHHH--H-HHCCCCCCH---HHHHHHHHH--HH-----HC-------
Q ss_conf             100593541489999999999------9999999999--8-605677899---999999999--99-----73-------
Q gi|254780709|r    3 NQKVASESLSWIRKLTKGFAS------TSLKLKEGIT--D-IISSRRLDD---GVREELEDL--LI-----RS-------   56 (321)
Q Consensus         3 ~~~~~~e~m~~f~kLk~gL~k------t~~~L~~~l~--~-l~~~~~lde---~~leeLee~--LL-----~A-------   56 (321)
                      +||..+|-..+++-||...++      +...|..+..  . -+..|-|-|   +++||.=-+  |-     .+       
T Consensus       371 ~EPs~eet~~ILkGLk~~YE~fH~V~Y~~eal~~Av~LS~ryI~DRfLPDKAIDviDEaGA~~~l~~~~~~~~~eadekG  450 (774)
T TIGR02639       371 GEPSIEETVKILKGLKEQYEEFHHVKYSDEALEAAVELSARYINDRFLPDKAIDVIDEAGAAFRLRAKAKKKANEADEKG  450 (774)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCC
T ss_conf             95788899999986554201325011386999999999888602578985432288999999997120277643201125


Q ss_pred             -------CCCHHHHHHHHHHHHHHHHCCC--CCH-HHHHHHHHHHHHHHCCCCCCCC------------CCCCCCCCC-E
Q ss_conf             -------8898999999999998751278--998-9999999998785201001210------------001366741-2
Q gi|254780709|r   57 -------DIGVAVAQKIVEELLTKRYAKD--VSV-QRVLYDVSELIHKMLMPLSKPF------------NWDFSHRPH-V  113 (321)
Q Consensus        57 -------DVg~~va~~Iie~ik~~~~~~~--i~~-~~i~~~l~~~L~~~L~~~~~~~------------~~~~~~~p~-v  113 (321)
                             .|++.=+++++.++-. .-.+.  .+. .+-++.|.+.|.+..-+....+            -+..+++|. .
T Consensus       451 leetalPev~~~diE~vvak~a~-iP~~~~s~ddD~~~L~~L~~~L~~kIfGQD~AI~~lv~aiK~SrAGl~~~nkP~GS  529 (774)
T TIGR02639       451 LEETALPEVNVKDIEEVVAKMAK-IPVKTVSSDDDREKLKNLEKELKAKIFGQDEAIEQLVSAIKRSRAGLGEPNKPVGS  529 (774)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHC-CCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             30004787854449999988718-99415426447988720447630131515899999999999987424778881688


Q ss_pred             EECCCCCCCCHHHHHHHHHHHH
Q ss_conf             3113544444247899999998
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKM  135 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~  135 (321)
                      ++|+||||||||=-+=.||..|
T Consensus       530 FLF~GPTGVGKTElak~LA~~L  551 (774)
T TIGR02639       530 FLFVGPTGVGKTELAKQLAEEL  551 (774)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
T ss_conf             8864798962578899999970


No 223
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=97.13  E-value=0.00056  Score=48.22  Aligned_cols=147  Identities=14%  Similarity=0.205  Sum_probs=77.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -..|++.||+|||||||+.-+-.++...+++|.-+.--      +|..--+..++.|.   ...+.+    ...++..+.
T Consensus        80 ~GlilitGptGSGKtTtl~a~l~~~~~~~~~i~tiEdP------vE~~~~~~~Q~~v~---~~~g~~----~~~~lr~~L  146 (264)
T cd01129          80 HGIILVTGPTGSGKTTTLYSALSELNTPEKNIITVEDP------VEYQIPGINQVQVN---EKAGLT----FARGLRAIL  146 (264)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECC------CCCCCCCCCEEEEC---CCCCCC----HHHHHHHHH
T ss_conf             98899978999977999999998643688508998676------31456887357616---666878----999999985


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             51487599865433321157789999899876302223430112310233522577899987643589769996545787
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTA  270 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta  270 (321)
                      .++-|+|+|+-.-    |.+-...      ++....  .-|.++-++.|   +++......+.+ .+++-..++      
T Consensus       147 R~dPDvi~igEiR----D~eta~~------a~~aa~--tGhlV~tTlHa---~~a~~~i~RL~~-lgv~~~~l~------  204 (264)
T cd01129         147 RQDPDIIMVGEIR----DAETAEI------AVQAAL--TGHLVLSTLHT---NDAPGAITRLLD-MGIESYLLS------  204 (264)
T ss_pred             CCCCCEEEECCCC----CHHHHHH------HHHHHH--HCCEEEEEECC---CCHHHHHHHHHH-CCCCHHHHH------
T ss_conf             5699988746889----9999999------999997--09969999703---999999999998-299989999------


Q ss_pred             CHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             069999999997698899975898
Q gi|254780709|r  271 RGGGLIPIVVTHKIPVYFLGVGEG  294 (321)
Q Consensus       271 ~~G~~ls~~~~~~~Pi~fig~Ge~  294 (321)
                        -.+..++++-=+|..+-..-+.
T Consensus       205 --~~l~~vi~QRLvr~LCp~Ck~~  226 (264)
T cd01129         205 --SALIGVIAQRLVRKLCPHCKEK  226 (264)
T ss_pred             --HHHHHHHHHHHHHHCCHHHCCC
T ss_conf             --9999999864232218745897


No 224
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=97.13  E-value=0.0035  Score=42.63  Aligned_cols=119  Identities=22%  Similarity=0.288  Sum_probs=59.2

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHC---CC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCC----CCCCCCCHH
Q ss_conf             674123113544444247899999998522---67-4267743451245688999997530353212----235866124
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDA---GL-KVMLAAGDTFRSAAIDQLKIWADRTSADFVC----SEIGSDAAA  180 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~---g~-kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~----~~~~~dp~~  180 (321)
                      .-++-+||.|+.|||||||+-=||.-+--.   |. .+-.-.|..     -+.-+.-.+-..++|+.    +..|-|-..
T Consensus        43 ~~~~a~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~~~c~~-----c~~c~~i~~~~~~d~~e~daas~~~v~~~r  117 (600)
T PRK09111         43 RIAQAFMLTGVRGVGKTTTARILARALNYKGPDGVGGPTIDPCGV-----GEHCQAIMEGRHVDVIEMDAASHTGVDDIR  117 (600)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC-----CHHHHHHHCCCCCCEEEEECCCCCCHHHHH
T ss_conf             842047645789878999999999996698876668998898998-----865898866899875885155457888999


Q ss_pred             HHHHHHHHHHH-HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             54228999965-148759986543332115778999989987630222343011231023352
Q gi|254780709|r  181 LAYEAFKQAQA-KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       181 v~~~a~~~a~~-~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      -..+.+.|+-. ..|-|.|||-.-.+.+..  .       +.+=|..+..|.++.+.+ |||-
T Consensus       118 ~~~~~~~~~p~~~~~kv~iidevhmls~~a--f-------nallktleepp~~~~fi~-att~  170 (600)
T PRK09111        118 EIIESVRYRPVSARYKVYIIDEVHMLSTAA--F-------NALLKTLEEPPPHVKFIF-ATTE  170 (600)
T ss_pred             HHHHHHCCCCCCCCEEEEEEECCCCCCHHH--H-------HHHHHHHHCCCCCEEEEE-ECCC
T ss_conf             999860538877754699960011057999--9-------999987625986549999-6285


No 225
>PRK08853 DNA polymerase III subunits gamma and tau; Validated
Probab=97.12  E-value=0.02  Score=37.40  Aligned_cols=27  Identities=37%  Similarity=0.511  Sum_probs=22.2

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             741231135444442478999999985
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      -.+.++|.|+.|+||||++-=+|+-+.
T Consensus        37 l~haylf~G~rGvGKTt~ARi~Ak~lN   63 (717)
T PRK08853         37 LHHAYLFSGTRGVGKTTIGRLFAKGLN   63 (717)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             740576108898889899999999867


No 226
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=97.11  E-value=0.032  Score=35.87  Aligned_cols=197  Identities=21%  Similarity=0.249  Sum_probs=95.7

Q ss_pred             HHHHHHHHHHHH--HHHHHHHHH---HCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-HHHH----
Q ss_conf             999999999999--999999986---056778999999999999973889899999999999875127899-8999----
Q gi|254780709|r   15 RKLTKGFASTSL--KLKEGITDI---ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS-VQRV----   84 (321)
Q Consensus        15 ~kLk~gL~kt~~--~L~~~l~~l---~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~-~~~i----   84 (321)
                      +|.++.++|+..  -|.++++.+   ++...-+++-.+++++.+=++++.-++-+++.+.+.+-..-..-+ ...+    
T Consensus       216 ~kVk~~meK~QREyyL~EQlKaIqkELG~~~d~~~e~~~~~~kie~~~~p~evkek~~~El~kL~~m~~~SaE~~ViRnY  295 (782)
T COG0466         216 KKVKEQMEKSQREYYLREQLKAIQKELGEDDDDKDEVEELREKIEKLKLPKEAKEKAEKELKKLETMSPMSAEATVIRNY  295 (782)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             99999877888999999999999998588865455899999997516999899999999999985079999168899899


Q ss_pred             --------------------------------HHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHH
Q ss_conf             --------------------------------999999878520100121000136674123113544444247899999
Q gi|254780709|r   85 --------------------------------LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS  132 (321)
Q Consensus        85 --------------------------------~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA  132 (321)
                                                      +..+++-|.+.|.-..    ...+.+-.++++|||.|||||.-.--+|
T Consensus       296 lDwll~lPW~~~sk~~~Dl~~a~~iLd~dHYGLekVKeRIlEyLAV~~----l~~~~kGpILcLVGPPGVGKTSLgkSIA  371 (782)
T COG0466         296 LDWLLDLPWGKRSKDKLDLKKAEKILDKDHYGLEKVKERILEYLAVQK----LTKKLKGPILCLVGPPGVGKTSLGKSIA  371 (782)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH----HHCCCCCCEEEEECCCCCCCHHHHHHHH
T ss_conf             999982887655421322999998744355671168999999999998----6146788579997899887011899999


Q ss_pred             HHHHHCCCCEEEEEC----------CCC---CHHH-HHHHHHHHHHHC------CCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             998522674267743----------451---2456-889999975303------53212235866124542289999651
Q gi|254780709|r  133 KKMSDAGLKVMLAAG----------DTF---RSAA-IDQLKIWADRTS------ADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       133 ~~~~~~g~kV~lva~----------Dtf---R~aA-~eQL~~~a~~~~------v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .-+.++=-+..|...          -||   =||- ++.++.-+...-      |+=.++.+..||+|..-+-++--+++
T Consensus       372 ~al~RkfvR~sLGGvrDEAEIRGHRRTYIGaMPGrIiQ~mkka~~~NPv~LLDEIDKm~ss~rGDPaSALLEVLDPEQN~  451 (782)
T COG0466         372 KALGRKFVRISLGGVRDEAEIRGHRRTYIGAMPGKIIQGMKKAGVKNPVFLLDEIDKMGSSFRGDPASALLEVLDPEQNN  451 (782)
T ss_pred             HHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECHHHCCCCCCCCHHHHHHHHCCHHHCC
T ss_conf             99589779995476542777535531233568728999999867768747864033316777788688888626976567


Q ss_pred             ---------C---CCEEEEECCCCCC-CHHHHHHHH
Q ss_conf             ---------4---8759986543332-115778999
Q gi|254780709|r  193 ---------K---VDVLIIDTAGRLH-NNSILMAGI  215 (321)
Q Consensus       193 ---------~---~DvvliDTAGR~~-~~~~lm~EL  215 (321)
                               .   .+|.+|-||-.+. .-..|++-|
T Consensus       452 ~F~DhYLev~yDLS~VmFiaTANsl~tIP~PLlDRM  487 (782)
T COG0466         452 TFSDHYLEVPYDLSKVMFIATANSLDTIPAPLLDRM  487 (782)
T ss_pred             CHHHCCCCCCCCHHHEEEEEECCCCCCCCHHHHCCE
T ss_conf             612220167664432588860375132986784303


No 227
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=97.11  E-value=0.0015  Score=45.28  Aligned_cols=139  Identities=17%  Similarity=0.279  Sum_probs=67.8

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             311354444424789999999852-2674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      |+++|+.||||||-+-++...+.. .+...     +++           .--+|..+.         .        ...+
T Consensus         2 ivilG~~~~GKTsll~~l~~~~~~~~~~~~-----~~~-----------~~Tvg~~~~---------~--------i~~~   48 (167)
T cd04160           2 VLILGLDNAGKTTFLEQLKTLFSKYKGLPP-----SKI-----------TPTVGLNIG---------T--------IEVG   48 (167)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCCCCCC-----CCC-----------CCCCCEEEE---------E--------EEEC
T ss_conf             999999998888999988750367677765-----540-----------353132689---------9--------9989


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH-HHHHHHHC---CCCE----EEEE
Q ss_conf             48759986543332115778999989987630222343011231023352257789-99876435---8976----9996
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ-VEMFHAVA---GTTG----LIMT  264 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~-a~~F~~~~---~~~g----~I~T  264 (321)
                      ++.+.+.||||.     +.+.+|-      +.+.. ..+-.++|+|++-- +.++. ...|.+.+   ...+    ++..
T Consensus        49 ~~~l~iwD~~Gq-----e~~~~l~------~~y~~-~a~~ii~VvD~sd~-~~~~~~~~~l~~~~~~~~~~~~pili~~N  115 (167)
T cd04160          49 NARLKFWDLGGQ-----ESLRSLW------DKYYA-ECHAIIYVIDSTDR-ERFEESKSALEKVLRNEALEGVPLLILAN  115 (167)
T ss_pred             CEEEEEEECCCC-----HHHHHHH------HHHCC-CCCEEEEEEECCCH-HHHHHHHHHHHHHHHCCCCCCCCEEEEEE
T ss_conf             999999968987-----8887899------87428-98789999866867-88999999999975110248962999970


Q ss_pred             CCCCCCC-H----HHHHHHHHH--HCCCEEEEE----CCCCCCCC
Q ss_conf             5457870-6----999999999--769889997----58981325
Q gi|254780709|r  265 KMDGTAR-G----GGLIPIVVT--HKIPVYFLG----VGEGINDL  298 (321)
Q Consensus       265 KlD~ta~-~----G~~ls~~~~--~~~Pi~fig----~Ge~i~Dl  298 (321)
                      |.|-... .    -..+.....  ...++.|+.    +|+.|++.
T Consensus       116 K~Dl~~~~~~~ei~~~~~~~~~~~~~~~~~~~~~SAktG~Gv~e~  160 (167)
T cd04160         116 KQDLPDALSVEEIKEVFQDKAEEIGRRDCLVLPVSALEGTGVREG  160 (167)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHH
T ss_conf             667665778999999999999985469989999887829498999


No 228
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]
Probab=97.11  E-value=0.0025  Score=43.72  Aligned_cols=47  Identities=30%  Similarity=0.322  Sum_probs=40.5

Q ss_pred             CCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCC--EEEEECCCCCH
Q ss_conf             136674123113544444247899999998522674--26774345124
Q gi|254780709|r  106 DFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLK--VMLAAGDTFRS  152 (321)
Q Consensus       106 ~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~k--V~lva~DtfR~  152 (321)
                      .....|.||.+.|+-||||.||+..|++.+.+.+.+  |-++++|-|--
T Consensus        77 ~~~~~pfIIgiaGsvavGKST~ar~L~~ll~~~~~~~~v~lvpmDGFhy  125 (283)
T COG1072          77 NNQQRPFIIGIAGSVAVGKSTTARILQALLSRWPESPKVDLVTMDGFHY  125 (283)
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCC
T ss_conf             6888887999605766557789999999996388987337871454546


No 229
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=97.11  E-value=0.0034  Score=42.76  Aligned_cols=134  Identities=16%  Similarity=0.125  Sum_probs=63.4

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE--ECC-CCCH----HHHHHHHHHHHHHCCCCCCCCC---CC-
Q ss_conf             66741231135444442478999999985226742677--434-5124----5688999997530353212235---86-
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA--AGD-TFRS----AAIDQLKIWADRTSADFVCSEI---GS-  176 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lv--a~D-tfR~----aA~eQL~~~a~~~~v~~~~~~~---~~-  176 (321)
                      ..-|+.++|.||.|+||||++-.+|.++...+..-...  +|. ..-.    -..-|...- ..-++-++....   +. 
T Consensus        36 grl~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~p~~r~i~~~-~hpdl~~i~r~~d~k~~~  114 (363)
T PRK07471         36 GRLHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDHPVARRIAAG-AHGGLLTLERSWNEKGKR  114 (363)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHCC-CCCCEEEEECCCCCCCCC
T ss_conf             9976458767999818899999999998579997777767870531258777289999526-999846676200113332


Q ss_pred             ----CCHHHHHHHHHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             ----61245422899996----5148759986543332115778999989987630222343011231023352257789
Q gi|254780709|r  177 ----DAAALAYEAFKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       177 ----dp~~v~~~a~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~  248 (321)
                          -++.-+.+-...+.    ..++-|+|||-|-+|..+.  -+-|-|       ..+..|..+++++=++.-......
T Consensus       115 ~~~~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~mn~~a--aNALLK-------~LEEPP~~t~fiLit~~~~~llpT  185 (363)
T PRK07471        115 LRTVITVDEVRETIGFFGLTAAEGGWRVVIVDTADEMNANA--ANALLK-------VLEEPPARSLLLLVSHAPARLLPT  185 (363)
T ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHCHHH--HHHHHH-------HHCCCCCCEEEEEEECCHHHCHHH
T ss_conf             12445399999999997248524896699986878738899--999999-------721589883899863997777799


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780709|r  249 VEM  251 (321)
Q Consensus       249 a~~  251 (321)
                      +..
T Consensus       186 I~S  188 (363)
T PRK07471        186 IRS  188 (363)
T ss_pred             HHH
T ss_conf             997


No 230
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=97.10  E-value=0.0029  Score=43.21  Aligned_cols=92  Identities=22%  Similarity=0.334  Sum_probs=64.4

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC---CCCCCCCCCHHHHHHHHHH
Q ss_conf             1231135444442478999999985226742677434512456889999975303532---1223586612454228999
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF---VCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~---~~~~~~~dp~~v~~~a~~~  188 (321)
                      +++-+.|+.++||||.+..+.+..++.|..|+.+-+-    .|++  ..|++.+||+.   +..++  |-+.-+++.++.
T Consensus        56 Rivei~G~essGKTtlal~~ia~aQk~gg~~~~iDaE----~a~d--~~~a~~lGVD~~~l~~~qp--~~~Eq~l~i~~~  127 (325)
T cd00983          56 RIIEIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAE----HALD--PVYAKKLGVDLDNLLISQP--DTGEQALEIADS  127 (325)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH----HCCC--HHHHHHCCCCHHHEEEECC--CHHHHHHHHHHH
T ss_conf             0899988987779999999999987359839999625----4259--8999980998467589666--389999999999


Q ss_pred             HH-HHCCCEEEEECCCCCCCHHHH
Q ss_conf             96-514875998654333211577
Q gi|254780709|r  189 AQ-AKKVDVLIIDTAGRLHNNSIL  211 (321)
Q Consensus       189 a~-~~~~DvvliDTAGR~~~~~~l  211 (321)
                      .. ....|+|++|.-|-+....++
T Consensus       128 li~s~~~dliViDSvaal~p~~E~  151 (325)
T cd00983         128 LVRSGAVDLIVVDSVAALVPKAEI  151 (325)
T ss_pred             HHCCCCCCEEEECCCCCCCCHHHH
T ss_conf             751588767998151123657887


No 231
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=97.10  E-value=0.027  Score=36.42  Aligned_cols=27  Identities=37%  Similarity=0.566  Sum_probs=22.5

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             741231135444442478999999985
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      -.+.++|.|+.|+||||+.-=+|+.+.
T Consensus        37 ~~haylf~G~rG~GKtt~ari~ak~ln   63 (643)
T PRK07994         37 IHHAYLFSGTRGVGKTSIARLLAKGLN   63 (643)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             663487458998888899999999967


No 232
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=97.08  E-value=0.0018  Score=44.63  Aligned_cols=142  Identities=20%  Similarity=0.194  Sum_probs=79.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |.++|..|+||||.+=.|-++-..-           -|.|.++.=.+..+-+..+.-.   +   .+| .-++-.+.-++
T Consensus         2 i~iigH~~aGKTtL~E~lL~~~g~i-----------~~~G~V~~g~t~~D~~~~E~~R---g---iSi-~s~~~~~~w~~   63 (268)
T cd04170           2 IALVGHSGSGKTTLAEALLYATGAI-----------DRLGSVEDGTTVSDYDPEEIKR---K---MSI-STSVAPLEWKG   63 (268)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCC-----------CCCCCCCCCCCCCCCCHHHHHC---C---CCE-ECCEEEEEECC
T ss_conf             8999089999899999999966996-----------6576545897357787889867---9---675-13557888899


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             875998654333211577899998998763022234301123102335225-----778999876435897699965457
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFHAVAGTTGLIMTKMDG  268 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~~~~~~~g~I~TKlD~  268 (321)
                      +-+=||||.|-  .  +-..|...-.++        -+-.++|+||..|-.     ..++++.++  +| .=+.++|||-
T Consensus        64 ~~inliDTPG~--~--DF~~e~~~aL~v--------~D~Av~Vida~~GVe~~T~~~w~~~~~~~--iP-~i~fINKmDr  128 (268)
T cd04170          64 HKINLIDTPGY--A--DFVGETRAALRA--------ADAALVVVSAQSGVEVGTEKLWEFADEAG--IP-RIIFINKMDR  128 (268)
T ss_pred             EEEEEEECCCC--H--HHHHHHHHHHCC--------CCEEEEEECCCCCHHHHHHHHHHHHHHCC--CC-EEEEEECCCC
T ss_conf             79999869897--5--799999998404--------78399994187547687999999999859--99-8999978787


Q ss_pred             -CCCHHH-HHHHHHHHCCCEEE
Q ss_conf             -870699-99999997698899
Q gi|254780709|r  269 -TARGGG-LIPIVVTHKIPVYF  288 (321)
Q Consensus       269 -ta~~G~-~ls~~~~~~~Pi~f  288 (321)
                       .+..-. +-++...++.++.-
T Consensus       129 ~~ad~~~~l~~i~~~lg~~~vp  150 (268)
T cd04170         129 ERADFDKTLAALQEAFGRPVVP  150 (268)
T ss_pred             CCCCHHHHHHHHHHHHCCCEEE
T ss_conf             8996477999999986898499


No 233
>pfam02421 FeoB_N Ferrous iron transport protein B. Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=97.08  E-value=0.0032  Score=42.96  Aligned_cols=147  Identities=22%  Similarity=0.262  Sum_probs=76.6

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .|.++|.+-|||+|-+=+|..      .++ .+ .               +.-|+..       |+....      ....
T Consensus         1 tVaIvG~PNvGKSTLlN~L~g------~~~-~V-s---------------~~pGtTr-------d~~~~~------~~~~   44 (188)
T pfam02421         1 TIALVGNPNVGKTTLFNALTG------ARQ-HV-G---------------NWPGVTV-------EKKEGT------FKYK   44 (188)
T ss_pred             CEEEECCCCCCHHHHHHHHHC------CCC-EE-E---------------CCCCCCC-------CEEEEE------EEEC
T ss_conf             989988999899999999959------996-56-3---------------8999723-------335768------7525


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-HCCCCEEEEECCCCCCC
Q ss_conf             48759986543332115778999989987630222343011231023352257789998764-35897699965457870
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA-VAGTTGLIMTKMDGTAR  271 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~-~~~~~g~I~TKlD~ta~  271 (321)
                      +..++++||+|=......-.+|  ++.+-  ......++-+++|+||+.-...........+ ..| .=++++|.|.-.+
T Consensus        45 ~~~~~lvDTpGi~~~~~~~~~e--~v~~~--~~~~~~aDlvl~vvDa~~~er~l~l~~~l~~~~~p-~IvVlNK~Dl~~~  119 (188)
T pfam02421        45 GYEIEIVDLPGTYSLSPYSEEE--KVARD--YLLEEKPDVIINVVDATNLERNLYLTLQLLELGIP-VVVALNMMDEAEK  119 (188)
T ss_pred             CEEEEEEECCCCCCCCCCCHHH--HHHHH--HHHHCCCCCEEEEEECCCHHHHHHHHHHHHHCCCC-EEEEECCCHHCCC
T ss_conf             1679999688850146532789--99999--98623687369997676245448999999976998-8999617020100


Q ss_pred             HHHH---HHHHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             6999---9999997698899975--898132555
Q gi|254780709|r  272 GGGL---IPIVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       272 ~G~~---ls~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      -...   -......+.|+.+|+.  |+.+++|..
T Consensus       120 ~~~~~~~~~l~~~lg~~vi~ISA~~g~Gi~eL~~  153 (188)
T pfam02421       120 KGIKIDIKKLSELLGVPVVPTSARKGEGIDELKD  153 (188)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEEECCCCHHHHHH
T ss_conf             3652039999987399689999316999999999


No 234
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=97.08  E-value=0.00086  Score=46.91  Aligned_cols=118  Identities=22%  Similarity=0.211  Sum_probs=58.8

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCC----CCCCCCHHHHHH
Q ss_conf             6741231135444442478999999985226742677434512456889999975303532122----358661245422
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCS----EIGSDAAALAYE  184 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~----~~~~dp~~v~~~  184 (321)
                      .-|+.++|.||.|+||||++-=||+.+--.+...-.-.|..-+.     =+...+-...+++..    ..|-|-..-..+
T Consensus        37 ri~HAyLF~GprGtGKTT~ArilAkaLnC~~~~~~~~pCg~C~~-----C~~I~~g~~~DViEiDaAs~~gVddIRel~e  111 (462)
T PRK06305         37 RAAHAYLFSGIRGTGKTTLARIFAKALNCQNPTEDQEPCNQCAI-----CKEISSGTSLDVIEIDGASHRGIEDIRQINE  111 (462)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHH-----HHHHHCCCCCCEEEECCCCCCCHHHHHHHHH
T ss_conf             97623430389985999999999999679999888898876688-----8998638999868643553446689999997


Q ss_pred             HHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             899996-514875998654333211577899998998763022234301123102335
Q gi|254780709|r  185 AFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT  241 (321)
Q Consensus       185 a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~  241 (321)
                      .+.++- ..+|-|.|||-+-+|++..-  +-|-|       ..+..|..+.+++ +||
T Consensus       112 ~v~~~P~~~~yKVyIIDEvhmLs~~Af--NALLK-------tLEEPP~~v~FIL-aTT  159 (462)
T PRK06305        112 TVLFTPSKSQYKIYIIDEVHMLTKEAF--NSLLK-------TLEEPPQHVKFFL-ATT  159 (462)
T ss_pred             HHCCCCCCCCEEEEEEECHHHCCHHHH--HHHHH-------HHHCCCCCEEEEE-EEC
T ss_conf             710088677505999815211799999--99999-------8618987749999-818


No 235
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=97.08  E-value=0.00091  Score=46.74  Aligned_cols=72  Identities=22%  Similarity=0.304  Sum_probs=46.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCC-CCCCH---HHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235-86612---454228999
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI-GSDAA---ALAYEAFKQ  188 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~-~~dp~---~v~~~a~~~  188 (321)
                      +|.+.||+||||||-+-+||..|..+-     |++=        .+|..|+.+|.++.-+++ +++|-   .|=+...+.
T Consensus         2 ~I~ISGpPGSGktTvA~~lA~~Lsl~~-----iSaG--------~iRelA~~~Gldl~E~~~aee~~eIDk~iD~~~~E~   68 (173)
T TIGR02173         2 IITISGPPGSGKTTVAKILAEKLSLKL-----ISAG--------DIRELAEKMGLDLAESKYAEENPEIDKKIDRRIREI   68 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCE-----ECCC--------HHHHHHHHCCCCHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             788735896864789999998639831-----2020--------078898642988777344305863116753788554


Q ss_pred             HHHHCCCEEE
Q ss_conf             9651487599
Q gi|254780709|r  189 AQAKKVDVLI  198 (321)
Q Consensus       189 a~~~~~Dvvl  198 (321)
                      |..+ -||||
T Consensus        69 A~~~-~nvvl   77 (173)
T TIGR02173        69 AEKE-KNVVL   77 (173)
T ss_pred             HCCC-CCEEE
T ss_conf             3048-96688


No 236
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=97.08  E-value=0.0029  Score=43.22  Aligned_cols=102  Identities=25%  Similarity=0.289  Sum_probs=56.1

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      +-.++.++|+||+||||++-=|+-.++-..-+|.+-.-|.......+     +.+.++.++..-.+..--.   =++..|
T Consensus        25 ~Gei~~lvG~nGaGKSTl~~~i~Gl~~p~~G~i~i~G~~i~~~~~~~-----~~~~gi~~v~qLSgG~~Qr---v~iara   96 (163)
T cd03216          25 RGEVHALLGENGAGKSTLMKILSGLYKPDSGEILVDGKEVSFASPRD-----ARRAGIAMVYQLSVGERQM---VEIARA   96 (163)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHH-----HHHCCCCEECCCCHHHHHH---HHHHHH
T ss_conf             99899999889989999999995776898578999999999999999-----9987994894699899999---999999


Q ss_pred             HHHCCCEEEEE--CCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65148759986--5433321157789999899876
Q gi|254780709|r  190 QAKKVDVLIID--TAGRLHNNSILMAGIGKMIRVL  222 (321)
Q Consensus       190 ~~~~~DvvliD--TAGR~~~~~~lm~EL~ki~~v~  222 (321)
                      -..+-+++|.|  |+|-   |....+++.++.+-+
T Consensus        97 l~~~p~llilDEPt~gL---D~~~~~~i~~~l~~l  128 (163)
T cd03216          97 LARNARLLILDEPTAAL---TPAEVERLFKVIRRL  128 (163)
T ss_pred             HHHCCCEEEEECCCCCC---CHHHHHHHHHHHHHH
T ss_conf             97299999990975579---999999999999999


No 237
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=97.07  E-value=0.0021  Score=44.24  Aligned_cols=93  Identities=24%  Similarity=0.287  Sum_probs=58.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .|+++|+.|+||||-+.+||+.+.    =+=+-+.|-||++-.++ ..++....--+-.+.  -=|-.+....+...-.+
T Consensus         2 riiilG~pGaGK~T~A~~La~~~~----i~hlstgd~~r~~~~~~-t~lg~~~k~~i~~g~--lv~d~i~~~~v~~rl~~   74 (178)
T COG0563           2 RILILGPPGAGKSTLAKKLAKKLG----LPHLDTGDILRAAIAER-TELGEEIKKYIDKGE--LVPDEIVNGLVKERLDE   74 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCC----CCEECCCCCCCHHHCCC-CHHHHHHHHHHHCCC--CCCHHHHHHHHHHHHHH
T ss_conf             799989999988999999999769----97855220111100323-689999999987589--50417699799999975


Q ss_pred             CCC---EEEEECCCCCCCHHHHHH
Q ss_conf             487---599865433321157789
Q gi|254780709|r  193 KVD---VLIIDTAGRLHNNSILMA  213 (321)
Q Consensus       193 ~~D---vvliDTAGR~~~~~~lm~  213 (321)
                      . |   .+|.|--.|.......++
T Consensus        75 ~-d~~~~~I~dg~PR~~~qa~~l~   97 (178)
T COG0563          75 A-DCKAGFILDGFPRTLCQARALK   97 (178)
T ss_pred             C-CCCCEEEEECCCCHHHHHHHHH
T ss_conf             0-6577299989983699999999


No 238
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=97.06  E-value=0.0013  Score=45.75  Aligned_cols=138  Identities=14%  Similarity=0.215  Sum_probs=67.1

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      +.+...|+++|+.||||||-+-++..    ...+.                  ..--.|..+         ..+      
T Consensus        11 ~~~~~Ki~ilG~~~sGKTsll~~l~~----~~~~~------------------~~pT~g~~~---------~~v------   53 (173)
T cd04155          11 SSEEPRILILGLDNAGKTTILKQLAS----EDISH------------------ITPTQGFNI---------KTV------   53 (173)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHC----CCCCC------------------CCCCCCEEE---------EEE------
T ss_conf             68775899997999988999999856----99866------------------068113237---------999------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHCC---CC----
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899-98764358---97----
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVAG---TT----  259 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~~---~~----  259 (321)
                        ..+++.+.+-||+|.-.     +.++-      ..+.. ..+-+++|+|++-- +.++.+ ..+++.+.   ..    
T Consensus        54 --~~~~~~~~lwD~~G~~~-----~~~~~------~~y~~-~a~~iI~VvD~td~-~~~~~~~~~l~~~l~~~~~~~~Pi  118 (173)
T cd04155          54 --QSDGFKLNVWDIGGQRA-----IRPYW------RNYFE-NTDCLIYVIDSADK-KRLEEAGAELVELLEEEKLAGVPV  118 (173)
T ss_pred             --EECCEEEEEEECCCCHH-----HHHHH------HHHCC-CCCEEEEEEECCCH-HHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             --98999999985587510-----12689------97655-56379999966756-889999999999974130069838


Q ss_pred             EEEEECCCCCC-----CHHHHHHHHHHHCCCEEEEE----CCCCCCC
Q ss_conf             69996545787-----06999999999769889997----5898132
Q gi|254780709|r  260 GLIMTKMDGTA-----RGGGLIPIVVTHKIPVYFLG----VGEGIND  297 (321)
Q Consensus       260 g~I~TKlD~ta-----~~G~~ls~~~~~~~Pi~fig----~Ge~i~D  297 (321)
                      =++.+|.|-..     ..--.|.+....+.|..++.    +||.|++
T Consensus       119 Liv~NK~Dl~~a~~~~eI~~~l~l~~~~~~~~~i~~~SA~tG~Gi~E  165 (173)
T cd04155         119 LVFANKQDLATAAPAEEIAEALNLHDLRDRTWHIQACSAKTGEGLQE  165 (173)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHCHHHCCCCCCEEEEEECCCCCCHHH
T ss_conf             99997666777899999999858764348875899957857939899


No 239
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=97.06  E-value=0.005  Score=41.55  Aligned_cols=138  Identities=18%  Similarity=0.238  Sum_probs=72.1

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      .++-.-|+++|+.||||||-+.+|..     |..+-.                      .|.++    .+...+.     
T Consensus        12 ~~k~~KililG~~~sGKTsil~~l~~-----~~~~~~----------------------~pT~G----~~~~~i~-----   55 (174)
T cd04153          12 PRKEYKVIIVGLDNAGKTTILYQFLL-----GEVVHT----------------------SPTIG----SNVEEIV-----   55 (174)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHC-----CCCCCC----------------------CCCCC----CCEEEEE-----
T ss_conf             89779999998999988999999973-----992771----------------------67236----0469999-----


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHC---CCC----
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899-9876435---897----
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVA---GTT----  259 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~---~~~----  259 (321)
                         .+++.+.+-||||+-... .+..   .+       . ...+-+++|+|++-.+ .++.+ ..+++.+   ++.    
T Consensus        56 ---~~~~~~~iwD~~G~e~~~-~~~~---~y-------~-~~a~~ii~VvD~sd~~-~~~~~~~~l~~~l~~~~~~~~pi  119 (174)
T cd04153          56 ---YKNIRFLMWDIGGQESLR-SSWN---TY-------Y-TNTDAVILVIDSTDRE-RLPLTKEELYKMLAHEDLRKAVL  119 (174)
T ss_pred             ---ECCEEEEEEECCCCCCCC-CHHH---HH-------H-CCCCEEEEEEECCCHH-HHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             ---788899999899986566-2267---77-------0-5775379999767888-99999999999972610169828


Q ss_pred             EEEEECCCCCCC-----HHHHHHHHHHHCCCEEEEE----CCCCCCC
Q ss_conf             699965457870-----6999999999769889997----5898132
Q gi|254780709|r  260 GLIMTKMDGTAR-----GGGLIPIVVTHKIPVYFLG----VGEGIND  297 (321)
Q Consensus       260 g~I~TKlD~ta~-----~G~~ls~~~~~~~Pi~fig----~Ge~i~D  297 (321)
                      =++.+|.|-...     ....+.+-...+.|+.|..    +||.|++
T Consensus       120 li~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~~~~~SAktG~Gv~e  166 (174)
T cd04153         120 LVLANKQDLKGAMTPAEISESLGLTSIRDHTWHIQGCCALTGEGLPE  166 (174)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH
T ss_conf             99995555655789999999974777635980999966858919899


No 240
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=97.05  E-value=0.0019  Score=44.50  Aligned_cols=81  Identities=22%  Similarity=0.257  Sum_probs=48.8

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC--HHHHHHHHHHHH
Q ss_conf             231135444442478999999985226742677434512456889999975303532122358661--245422899996
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA--AALAYEAFKQAQ  190 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp--~~v~~~a~~~a~  190 (321)
                      +|++.||.|+||||....||..+     ....+-+|.||+.+.    .--...|+|.--...  .|  ..+.........
T Consensus         1 liiv~GvsGsGKSTia~~La~~l-----g~~~i~~D~~h~~~n----~~km~~G~pL~d~dr--~~wl~~l~~~~~~~~~   69 (150)
T cd02021           1 IIVVMGVSGSGKSTVGKALAERL-----GAPFIDGDDLHPPAN----IAKMAAGIPLNDEDR--WPWLQALTDALLAKLA   69 (150)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH-----CCCEECCCCCCCHHH----HHHHHCCCCCCCCCH--HHHHHHHHHHHHHHHH
T ss_conf             98999189999999999999971-----995641543354768----999867999885237--8999999999999998


Q ss_pred             HHCCCEEEEECCCC
Q ss_conf             51487599865433
Q gi|254780709|r  191 AKKVDVLIIDTAGR  204 (321)
Q Consensus       191 ~~~~DvvliDTAGR  204 (321)
                      ..+..+|+-=||-+
T Consensus        70 ~~g~~vVv~cSaLk   83 (150)
T cd02021          70 SAGEGVVVACSALK   83 (150)
T ss_pred             HCCCCEEEEEHHHH
T ss_conf             44998799843323


No 241
>pfam05970 DUF889 PIF1 helicase. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated.
Probab=97.04  E-value=0.0041  Score=42.16  Aligned_cols=117  Identities=18%  Similarity=0.158  Sum_probs=67.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             5444442478999999985226742677434512456889-999975303532122358661245422899996514875
Q gi|254780709|r  118 GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ-LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDV  196 (321)
Q Consensus       118 G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQ-L~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~Dv  196 (321)
                      |+-|+||||.+-.+.++++..++.|++ +|-|=.||..=+ =.+.-.-.++|+-..+.  ....+-...-..-.-+..|+
T Consensus         1 G~AGTGKS~ll~~i~~~l~~~~~~v~v-tA~TGiAA~~i~gG~TiHs~~gi~~~~~~~--~~~~~~~~~~~~~~~~~~~v   77 (418)
T pfam05970         1 GYGGTGKTFLWNALSARIRSRGKIVLN-VASSGIAALLLPGGRTAHSRFGIPLDIDED--STCKIKRGSKLAELLKKASL   77 (418)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEE-ECCHHHHHHCCCCCEEHHHCCCCCCCCCCC--CCEEECCCHHHHHHHHHCCE
T ss_conf             979887999999999999768988999-896899985169987398526989887742--01121337788998740879


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCC---CEEEEECCC
Q ss_conf             9986543332115778999989987630222343---011231023
Q gi|254780709|r  197 LIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP---HSVLQVLDA  239 (321)
Q Consensus       197 vliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p---~~~~lVlda  239 (321)
                      +|||=...+  +..+|+-|..+.|.+.+.....|   ..++|+-|=
T Consensus        78 LIIDEiSMv--~~~lfd~id~~lr~i~~~~~~~PFGGiqvIl~GDf  121 (418)
T pfam05970        78 IIWDEAPMT--HRHCFEALDRTLRDILKNTDDKPFGGKTVVLGGDF  121 (418)
T ss_pred             EEEECCCCC--CHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCH
T ss_conf             998541135--78999999999999871278767797479982447


No 242
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional
Probab=97.02  E-value=0.0054  Score=41.34  Aligned_cols=84  Identities=24%  Similarity=0.319  Sum_probs=50.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---------------CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCH--
Q ss_conf             35444442478999999985226742677434---------------5124568899999753035321223586612--
Q gi|254780709|r  117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---------------TFRSAAIDQLKIWADRTSADFVCSEIGSDAA--  179 (321)
Q Consensus       117 vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D---------------tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~--  179 (321)
                      +-+-|+|||-++--||.+++++|++|++++=-               +..-..=|-+ .++++.++|++..+.-...+  
T Consensus        64 itvGGTGKTP~vi~L~~~L~~~G~k~~IlSRGYg~~~~~~~~v~~~~~~~~vGDEpl-lla~~~~~pV~V~~~R~~~~~~  142 (339)
T PRK01906         64 VTVGGTGKTPTVIALVDALRAAGFTPGVVSRGYGAKVKAPTAVTPASRASDAGDEPL-LIARRTDAPVWVCPDRVAAAQA  142 (339)
T ss_pred             EEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEECCCCCHHHCCCHHH-HHHHCCCCEEEEECCHHHHHHH
T ss_conf             876887577999999999997699559985464555677666237864433176899-9874359608982569999999


Q ss_pred             ----------HHHHHHHHHHH-HHCCCEEEEEC
Q ss_conf             ----------45422899996-51487599865
Q gi|254780709|r  180 ----------ALAYEAFKQAQ-AKKVDVLIIDT  201 (321)
Q Consensus       180 ----------~v~~~a~~~a~-~~~~DvvliDT  201 (321)
                                -|.-|++|+.+ .+++|+|++|+
T Consensus       143 l~~~~~~~dvIIlDDGfQh~~l~rDl~Ivl~d~  175 (339)
T PRK01906        143 LLAAHPEVDVIVSDDGLQHYRLARDVEIVVFDH  175 (339)
T ss_pred             HHHHCCCCCEEEECCCCCCCCCCCCEEEEEECC
T ss_conf             997488998899568531333468759999878


No 243
>COG0523 Putative GTPases (G3E family) [General function prediction only]
Probab=97.02  E-value=0.0048  Score=41.71  Aligned_cols=168  Identities=17%  Similarity=0.181  Sum_probs=87.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE-------ECCC---CCHHHHHHHHHHHH-HHCCCCCCCCCCCCCHHH
Q ss_conf             231135444442478999999985226742677-------4345---12456889999975-303532122358661245
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA-------AGDT---FRSAAIDQLKIWAD-RTSADFVCSEIGSDAAAL  181 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lv-------a~Dt---fR~aA~eQL~~~a~-~~~v~~~~~~~~~dp~~v  181 (321)
                      |.++.|-=|+||||.+-+|.++..  |+|++++       ..|.   ......+    +-+ -.|+=+++..  .|-...
T Consensus         3 VtvitGFLGsGKTTlL~~lL~~~~--g~kiAVIVNEfGEvgID~~~~l~~~~e~----~~El~nGCICCT~r--~dl~~~   74 (323)
T COG0523           3 VTVITGFLGSGKTTLLNHLLANRD--GKKIAVIVNEFGEVGIDGGALLSDTGEE----VVELTNGCICCTVR--DDLLPA   74 (323)
T ss_pred             EEEEEECCCCCHHHHHHHHHHCCC--CCEEEEEEECCCCCCCCCCCCCCCCCCC----EEEECCCCEEEECC--CHHHHH
T ss_conf             799811677998999999985458--9807999855740221677641348975----79836970787034--215899


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHH-HHHHHHHHCC-CC
Q ss_conf             422899996514875998654333211577899998998763022234301123102335225778-9998764358-97
Q gi|254780709|r  182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR-QVEMFHAVAG-TT  259 (321)
Q Consensus       182 ~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~-~a~~F~~~~~-~~  259 (321)
                      . ..+.. ...+.|.|+|-|.|=-+ -...+.-..... .+.  ....-+-++-|+||.-.-.... +.+.|.+.+. -+
T Consensus        75 ~-~~L~~-~~~~~D~ivIEtTGlA~-P~pv~~t~~~~~-~l~--~~~~ld~vvtvVDa~~~~~~~~~~~~~~~~Qia~AD  148 (323)
T COG0523          75 L-ERLLR-RRDRPDRLVIETTGLAD-PAPVIQTFLTDP-ELA--DGVRLDGVVTVVDAAHFLEGLDAIAELAEDQLAFAD  148 (323)
T ss_pred             H-HHHHH-CCCCCCEEEEECCCCCC-CHHHHHHHHCCC-CCC--CCEEECCEEEEEEHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9-99985-25689989996887778-699999860651-224--540413369998478865456779999999998679


Q ss_pred             EEEEECCCCCCCHH-HH-HHHHHH--HCCCEEEEECCCC
Q ss_conf             69996545787069-99-999999--7698899975898
Q gi|254780709|r  260 GLIMTKMDGTARGG-GL-IPIVVT--HKIPVYFLGVGEG  294 (321)
Q Consensus       260 g~I~TKlD~ta~~G-~~-ls~~~~--~~~Pi~fig~Ge~  294 (321)
                      -++++|.|--..-. .+ -.....  -..||.....|+.
T Consensus       149 ~ivlNK~Dlv~~~~l~~l~~~l~~lnp~A~i~~~~~~~~  187 (323)
T COG0523         149 VIVLNKTDLVDAEELEALEARLRKLNPRARIIETSYGDV  187 (323)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             999836456898899999999997599986998123668


No 244
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=97.01  E-value=0.0021  Score=44.27  Aligned_cols=143  Identities=22%  Similarity=0.317  Sum_probs=74.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      ||.++|-.-+||||-+-+|..      .+     .|  |.      .. -.+-|+.+       |+.   +..+..  ..
T Consensus         2 vVaivG~~n~GKSTL~n~L~g------~~-----~d--~~------~~-e~~~giTi-------~~~---~~~~~~--~~   49 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKALTG------IE-----TD--RL------PE-EKKRGITI-------DLG---FAYLDL--PS   49 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHC------CC-----CC--CC------HH-HHCCCEEE-------EEE---EEEEEC--CC
T ss_conf             999992688729999999849------64-----66--33------33-33486379-------854---687864--89


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCCCE--EEEECCCC
Q ss_conf             4875998654333211577899998998763022234301123102335225--7789998764358976--99965457
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGTTG--LIMTKMDG  268 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~~g--~I~TKlD~  268 (321)
                      +..+.+|||+|  |  +.++..+   .+.+.     ..+-.+||+||.-|-.  -.+..... +..++..  ++++|+|-
T Consensus        50 ~~~i~~iDtPG--h--~~~~~~~---~~~~~-----~aD~~llVvda~~g~~~q~~e~~~~~-~~~~i~~~ivvlNK~D~  116 (164)
T cd04171          50 GKRLGFIDVPG--H--EKFIKNM---LAGAG-----GIDLVLLVVAADEGIMPQTREHLEIL-ELLGIKRGLVVLTKADL  116 (164)
T ss_pred             CCEEEEEECCC--H--HHHHHHH---HHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHH-HHCCCCCEEEEEECCCC
T ss_conf             98999994878--7--9999999---99874-----26725899861778888899999999-87388727873463425


Q ss_pred             CCCHHH--HHH-HHHH------HCCCEEEEEC--CCCCCCCCC
Q ss_conf             870699--999-9999------7698899975--898132555
Q gi|254780709|r  269 TARGGG--LIP-IVVT------HKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       269 ta~~G~--~ls-~~~~------~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      ..+-..  ... +...      .+.|+.+++.  |+++++|..
T Consensus       117 v~~~~~~~~~~~i~~~l~~~~~~~~pii~iSA~tG~Gi~eL~~  159 (164)
T cd04171         117 VDEDWLELVEEEIRELLAGTFLADAPIFPVSAVTGEGIEELKE  159 (164)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             7978999999999999974399998299946989829999999


No 245
>pfam03205 MobB Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop.
Probab=97.01  E-value=0.00089  Score=46.81  Aligned_cols=37  Identities=38%  Similarity=0.539  Sum_probs=33.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEE-EEECCC
Q ss_conf             2311354444424789999999852267426-774345
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVM-LAAGDT  149 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~-lva~Dt  149 (321)
                      ++|++|+.++||||-+..|++|+.++|++|. ++-+|.
T Consensus         2 ~v~i~G~~~sGKttl~~~L~~~~~~~g~~~~~~~~~d~   39 (122)
T pfam03205         2 IVLVVGPKDSGKTTLIRKLLNYLKRRGYRVAVVKHLDH   39 (122)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             79999489998999999999999987994489998999


No 246
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=97.00  E-value=0.011  Score=39.22  Aligned_cols=92  Identities=20%  Similarity=0.233  Sum_probs=52.7

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCC------CCEEEEEC-CCCCHHHHHHHHHHH-H-----HHCCCCCCCCCCCCC
Q ss_conf             1231135444442478999999985226------74267743-451245688999997-5-----303532122358661
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAG------LKVMLAAG-DTFRSAAIDQLKIWA-D-----RTSADFVCSEIGSDA  178 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g------~kV~lva~-DtfR~aA~eQL~~~a-~-----~~~v~~~~~~~~~dp  178 (321)
                      .+.-+.|+.|+|||+-+-.+|......+      .+|+.+.+ .+|.+-=.+|+-.-- .     .-.+-++......+-
T Consensus        20 ~ItEi~G~~gsGKT~l~lqla~~~q~~~~~~~~~g~vvyIDtE~~f~~~rl~~i~~~~~~~~~~~l~~i~~~~~~~~e~~   99 (226)
T cd01393          20 RITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYIDTEGAFRPERLVQLAVRFGLDPEEVLDNIYVARPYNGEQQ   99 (226)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCHHHHHHHEEEECCCCHHHH
T ss_conf             39999999999899999999999854221169996199995577531999999987603266776433368437999999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             2454228999965148759986543
Q gi|254780709|r  179 AALAYEAFKQAQAKKVDVLIIDTAG  203 (321)
Q Consensus       179 ~~v~~~a~~~a~~~~~DvvliDTAG  203 (321)
                      ..++..........+.++|+||...
T Consensus       100 ~~~~~~l~~~~~~~~v~liViDSi~  124 (226)
T cd01393         100 LEIVEELERIMSSGRVDLVVVDSVA  124 (226)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             9999999987524784289993220


No 247
>CHL00181 cbbX CbbX; Provisional
Probab=97.00  E-value=0.0062  Score=40.93  Aligned_cols=29  Identities=31%  Similarity=0.374  Sum_probs=24.8

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             12311354444424789999999852267
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGL  140 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~  140 (321)
                      .-++|.|+.|.||||.+--+|..|+.-|.
T Consensus        60 ~h~vF~GnPGTGKTTVARl~a~il~~lG~   88 (287)
T CHL00181         60 LHMSFTGSPGTGKTTVALKMADILYRLGY   88 (287)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             53888789986799999999999998699


No 248
>PRK11823 DNA repair protein RadA; Provisional
Probab=96.99  E-value=0.0071  Score=40.50  Aligned_cols=86  Identities=23%  Similarity=0.437  Sum_probs=62.6

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC--CCCCCCCCCHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532--1223586612454228999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF--VCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~--~~~~~~~dp~~v~~~a~~~  188 (321)
                      -.++|+-|-.|+||+|-+-.+|..+. ++.+|+-+++--    ..+|++.-|+|+++.-  +.--.++|-.    +.+..
T Consensus        90 GS~iLlgGePGIGKSTLlLQ~a~~la-~~~~vLYvSGEE----S~~Qik~RA~RLg~~~~~l~l~~et~l~----~Il~~  160 (454)
T PRK11823         90 GSVVLIGGDPGIGKSTLLLQVAAALA-AGGKVLYVSGEE----SLQQIKLRAERLGLPSDNLYLLAETNLE----DILAT  160 (454)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHH-CCCCEEEECCCH----HHHHHHHHHHHHCCCCCCCEEEECCCHH----HHHHH
T ss_conf             64899507998889999999999985-599579981501----5789999999758888873788536899----99999


Q ss_pred             HHHHCCCEEEEECCCCC
Q ss_conf             96514875998654333
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRL  205 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~  205 (321)
                      ....+.|+++||.-=-+
T Consensus       161 i~~~~P~~lIIDSIQT~  177 (454)
T PRK11823        161 IEEEKPDLVVIDSIQTM  177 (454)
T ss_pred             HHHHCCCEEEEECHHEE
T ss_conf             98609988999431115


No 249
>PRK07667 uridine kinase; Provisional
Probab=96.98  E-value=0.0011  Score=46.13  Aligned_cols=42  Identities=21%  Similarity=0.373  Sum_probs=38.3

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             674123113544444247899999998522674267743451
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF  150 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf  150 (321)
                      ..-.+|.+.|..||||||-+.+|+..+...|..|.++..|-|
T Consensus        12 ~~r~iIgIaG~sgSGKTTla~~L~~~l~~~~~~v~v~~~Dd~   53 (190)
T PRK07667         12 ENRFILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDH   53 (190)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             986999977989788999999999998665983799966624


No 250
>pfam10662 PduV-EutP Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways, however the exact roles of these proteins is poorly understood.
Probab=96.98  E-value=0.0098  Score=39.51  Aligned_cols=127  Identities=24%  Similarity=0.322  Sum_probs=71.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |++||..+|||+|-+-.|.      |.+.  ++    |                         .|-.+           +
T Consensus         4 VaivGrpNvGKSTLlN~L~------g~~i--~~----~-------------------------K~qtt-----------~   35 (143)
T pfam10662         4 IMLIGRSGCGKTTLTQALN------GEEL--KY----K-------------------------KTQAI-----------E   35 (143)
T ss_pred             EEEECCCCCCHHHHHHHHC------CCCE--EE----C-------------------------CCEEE-----------E
T ss_conf             9998999999999999975------9944--51----7-------------------------87079-----------8


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH--HHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             87599865433321157789999899876302223430112310233522577--8999876435897699965457870
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL--RQVEMFHAVAGTTGLIMTKMDGTAR  271 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~--~~a~~F~~~~~~~g~I~TKlD~ta~  271 (321)
                      +...+|||.|....+..+++.+..-.   .     ..+-++||+||+-..+..  ..++.|+.  | -=+|++|.|-..+
T Consensus        36 ~~~~~IDTPG~~~~~~~~~~~~~~~~---~-----daDvil~vvDa~~~~~~~~~~~~~~~~k--p-vIlViNKiD~~~~  104 (143)
T pfam10662        36 FSDNMIDTPGEYLENRRFYSALIVTA---A-----DADVIALVQDATEPWSVFPPGFASMFNK--P-VIGIITKIDLAKD  104 (143)
T ss_pred             ECCCEEECCCCCCCCHHHHHHHHHHH---H-----HCCEEEEEEECCCCCCCCCHHHHHHCCC--C-EEEEEECCCCCCC
T ss_conf             55748999876656289999999999---6-----4999999987788667568778975479--8-8999980224575


Q ss_pred             HHHHHHHH----HHHCC-CEEEEEC--CCCCCCCCC
Q ss_conf             69999999----99769-8899975--898132555
Q gi|254780709|r  272 GGGLIPIV----VTHKI-PVYFLGV--GEGINDLEP  300 (321)
Q Consensus       272 ~G~~ls~~----~~~~~-Pi~fig~--Ge~i~Dl~~  300 (321)
                      -. .+..+    ...+. .|..|+.  |+.+|+|..
T Consensus       105 ~~-~l~~~~~~~~~~~~~~i~~iSA~~g~Gid~L~~  139 (143)
T pfam10662       105 EA-NIEMVEEWLNNAGAEKIFEVSAVTNEGIDELFA  139 (143)
T ss_pred             HH-HHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHH
T ss_conf             66-789999999758998799988989989999999


No 251
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=96.98  E-value=0.0015  Score=45.15  Aligned_cols=38  Identities=32%  Similarity=0.336  Sum_probs=32.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCCC
Q ss_conf             23113544444247899999998522--674267743451
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDA--GLKVMLAAGDTF  150 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~--g~kV~lva~Dtf  150 (321)
                      +|-+.|..||||||.+-.|...+.+.  +.+|.+++.|.|
T Consensus         1 IIGIaG~sgSGKST~a~~l~~~l~~~~~~~~v~ii~~D~f   40 (220)
T cd02025           1 IIGIAGSVAVGKSTTARVLQALLSRWPDHPNVELITTDGF   40 (220)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             9897889987799999999998600269994899978787


No 252
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=96.98  E-value=0.017  Score=37.74  Aligned_cols=118  Identities=24%  Similarity=0.239  Sum_probs=60.1

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH-HCCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCCC----CCCCCCHHHH
Q ss_conf             6741231135444442478999999985-22674-2677434512456889999975303532122----3586612454
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS-DAGLK-VMLAAGDTFRSAAIDQLKIWADRTSADFVCS----EIGSDAAALA  182 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~k-V~lva~DtfR~aA~eQL~~~a~~~~v~~~~~----~~~~dp~~v~  182 (321)
                      .-++.+||.|+.|+||||+.-=||+.+. .++.. ---..|+..|     ++...+ .-.++|+..    ..+-|-..-.
T Consensus        35 ri~HAYLFsGprG~GKTt~ARilAkaLNC~~~~~~~PCg~C~sC~-----~i~~g~-~~~~DviEiDAAS~~gVddiReL  108 (775)
T PRK07764         35 RINHAYLFSGPRGCGKTSSARILARSLNCAQGPTSTPCGVCDSCV-----ALAPGG-PGSLDVVEIDAASHGGVDDAREL  108 (775)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH-----HHHCCC-CCCCCEEEECCCCCCCHHHHHHH
T ss_conf             976337623788878889999999996689999989888876378-----886389-88886687315655688999999


Q ss_pred             HHHHHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             22899996-5148759986543332115778999989987630222343011231023352
Q gi|254780709|r  183 YEAFKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       183 ~~a~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      .+.+.|+- ..+|-|.|||-+-++....  .+-|-|       ..+..|..++|++ +||-
T Consensus       109 ~e~~~y~P~~~ryKVyIIDEaHmls~~a--fNALLK-------tLEEPP~hvvFIl-aTTe  159 (775)
T PRK07764        109 RERAFFAPAQSRYRIFIIDEAHMVTTAG--FNALLK-------IVEEPPEHLIFIF-ATTE  159 (775)
T ss_pred             HHHCCCCCCCCCEEEEEEECHHHHCHHH--HHHHHH-------HHCCCCCCEEEEE-ECCC
T ss_conf             9854768767863599985354407999--999988-------6227864627999-5487


No 253
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=96.98  E-value=0.0066  Score=40.69  Aligned_cols=134  Identities=15%  Similarity=0.179  Sum_probs=69.9

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      .++..-|+++|+.|+||||-+-+|..     +....                      -+|.+...            ++
T Consensus        14 ~~ke~~ililGLd~aGKTTil~~lk~-----~~~~~----------------------~~PT~g~~------------~e   54 (184)
T smart00178       14 WNKHAKILFLGLDNAGKTTLLHMLKN-----DRLAQ----------------------HQPTQHPT------------SE   54 (184)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHC-----CCCCC----------------------CCCCCCCC------------EE
T ss_conf             56614799996588988999999806-----99753----------------------05787886------------48


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899987643589769996545
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMD  267 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD  267 (321)
                      ..+-+++.+.+.|..|..           +++..-+.+.. ..+-+++|+|++--+..-+..+.++..            
T Consensus        55 ~~~~~~~~~~~wDlgG~~-----------~~R~lW~~Yy~-~~~~iIfVVDssD~~r~~eak~~L~~l------------  110 (184)
T smart00178       55 ELAIGNIKFTTFDLGGHQ-----------QARRLWKDYFP-EVNGIVYLVDAYDKERFAESKRELDAL------------  110 (184)
T ss_pred             EEEECCEEEEEEECCCCH-----------HHHHHHHHHHC-CCCEEEEEEECCCHHHHHHHHHHHHHH------------
T ss_conf             999999999999889877-----------78899998821-675899997268688999999999998------------


Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCC
Q ss_conf             787069999999997698899975898132555778999998728656
Q gi|254780709|r  268 GTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD  315 (321)
Q Consensus       268 ~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd  315 (321)
                              ++-....++|+..++.=|.+.+  ..++.++.+ .|++.+
T Consensus       111 --------l~~~~l~~~PlLilaNKqDl~~--a~~~~ei~~-~L~L~~  147 (184)
T smart00178      111 --------LSDEELATVPFLILGNKIDAPY--AASEDELRY-ALGLTN  147 (184)
T ss_pred             --------HHHHHHCCCCEEEEEECCCCCC--CCCHHHHHH-HHCCHH
T ss_conf             --------6467655970999997567778--999999998-819512


No 254
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=96.97  E-value=0.041  Score=35.14  Aligned_cols=109  Identities=18%  Similarity=0.165  Sum_probs=63.6

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC---------CCCCC---
Q ss_conf             7412311354444424789999999852-2674267743451245688999997530353212---------23586---
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC---------SEIGS---  176 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~---------~~~~~---  176 (321)
                      +.+++++.|..|+||||-+--....-.+ .|.+++.|+.+--    .+||..++...|.++-.         .....   
T Consensus        23 ~g~~~LV~G~pGsGKTtla~QfL~~Ga~~~GE~~lyitl~E~----~~~l~~~~~~~g~~~~~~~~~~~l~i~d~~~~~~   98 (501)
T PRK09302         23 KGRPTLVSGTAGTGKTLFALQFLHNGIKSFGEPGVFVTFEES----PEDIIRNVASFGWDLQKLIDEGKLFILDASPDPS   98 (501)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC----HHHHHHHHHHCCCCHHHHHHCCCEEEEECCCCCC
T ss_conf             997799983899999999999999998855997899985799----9999999998499868973268389996156743


Q ss_pred             --------CCHHHHHHHHHHH-HHHCCCEEEEECCC--C--CCCHHHHHHHHHHHHHHHH
Q ss_conf             --------6124542289999-65148759986543--3--3211577899998998763
Q gi|254780709|r  177 --------DAAALAYEAFKQA-QAKKVDVLIIDTAG--R--LHNNSILMAGIGKMIRVLK  223 (321)
Q Consensus       177 --------dp~~v~~~a~~~a-~~~~~DvvliDTAG--R--~~~~~~lm~EL~ki~~v~~  223 (321)
                              |...+. ..+..+ +..+.+.|.||.--  |  .....+.-+++..+.+.++
T Consensus        99 ~~~~~~~~dL~~l~-~~I~~~v~~~~~~RvViDSlt~l~~~~~~~~~~R~~l~~L~~~l~  157 (501)
T PRK09302         99 EQEEAGEYDLSALI-ERIEYAIRKIKAKRVVIDSIEALFQQYDNPAVVRRELFRLFAWLK  157 (501)
T ss_pred             CCCCCCCCCHHHHH-HHHHHHHHHHCCCEEEECCHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             11133447689999-999999997199999999978998763587899999999999998


No 255
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=96.95  E-value=0.016  Score=38.08  Aligned_cols=146  Identities=22%  Similarity=0.297  Sum_probs=74.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      +|.+||-.-|||.|-.=+|.      |++.++++                +.-|+.-       |...-      .+.-.
T Consensus         1 ~VaIvGrpNVGKStLfN~L~------~~~~aIv~----------------~~~G~TR-------D~~~~------~~~~~   45 (429)
T TIGR03594         1 VVAIVGRPNVGKSTLFNRLT------GKRDAIVA----------------DTPGVTR-------DRKYG------DAEWG   45 (429)
T ss_pred             CEEEECCCCCCHHHHHHHHH------CCCEEECC----------------CCCCCCC-------CCEEE------EEEEC
T ss_conf             98999999987899999987------88617615----------------9899887-------73379------99999


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHH-HHHHHHHCCCCCCCCEEEEECCCCCCHHH--HHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             487599865433321157789999-89987630222343011231023352257--789998764358976999654578
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIG-KMIRVLKRLDPHAPHSVLQVLDATTGQNA--LRQVEMFHAVAGTTGLIMTKMDGT  269 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~-ki~~v~~~~~~~~p~~~~lVlda~~gq~~--~~~a~~F~~~~~~~g~I~TKlD~t  269 (321)
                      +..+.||||||=...+..+...+. +....++     ..|-+++|+||..|-..  .+.++...+.-.--=+++-|.|+-
T Consensus        46 ~~~~~liDT~G~~~~~~~~~~~~~~q~~~ai~-----~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~~  120 (429)
T TIGR03594        46 GREFILIDTGGIEEDDDGLDKQIREQAEIAIE-----EADVILFVVDGREGLTPEDEEIAKWLRKSGKPVILVANKIDGK  120 (429)
T ss_pred             CEEEEEEECCCCCCCCHHHHHHHHHHHHHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             90799998989898743789999999999998-----6799999985776898679999999987199789999834675


Q ss_pred             CCHHHHHHHHHHHCCC-EEEEEC--CCCCCCCC
Q ss_conf             7069999999997698-899975--89813255
Q gi|254780709|r  270 ARGGGLIPIVVTHKIP-VYFLGV--GEGINDLE  299 (321)
Q Consensus       270 a~~G~~ls~~~~~~~P-i~fig~--Ge~i~Dl~  299 (321)
                       +.-..++-.|.+|.. +.+|+.  |..+++|.
T Consensus       121 -~~~~~~~ef~~LG~~~~i~iSA~h~~Gi~~L~  152 (429)
T TIGR03594       121 -KEDAVAAEFYSLGFGEPIPISAEHGRGIGDLL  152 (429)
T ss_pred             -CHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
T ss_conf             -31456999998368986887420467999999


No 256
>PTZ00301 uridine kinase; Provisional
Probab=96.94  E-value=0.0012  Score=45.92  Aligned_cols=42  Identities=19%  Similarity=0.355  Sum_probs=36.0

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHC-C-CCEEEEECCCCC
Q ss_conf             74123113544444247899999998522-6-742677434512
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDA-G-LKVMLAAGDTFR  151 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~-g-~kV~lva~DtfR  151 (321)
                      +|.||.++|..||||||.+.+|+..+..+ | .+|.+++.|.|.
T Consensus         2 ~~~iIgIaGgSgSGKTT~a~~i~~~l~~~~~~~~v~ii~~D~Yy   45 (210)
T PTZ00301          2 PCTVIGISGASGSGKSSLSTNIVSELMAHCGPVSIGVICEDFYY   45 (210)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             98899996887678999999999998761499807998367667


No 257
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=96.94  E-value=0.0023  Score=43.97  Aligned_cols=141  Identities=17%  Similarity=0.183  Sum_probs=74.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE---------ECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             41231135444442478999999985226742677---------434512456889999975303532122358661245
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA---------AGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL  181 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lv---------a~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v  181 (321)
                      .+-|.++|--|+||||.+=-|.+.-..-. +.+-|         .+|.   -..|+=+      ++-+.           
T Consensus         2 ~Rniai~gH~gaGKTtL~EalL~~~G~i~-r~G~V~~~~~~g~t~~D~---~~eE~~R------~iSi~-----------   60 (267)
T cd04169           2 RRTFAIISHPDAGKTTLTEKLLLFGGAIR-EAGAVKARKSRKHATSDW---MEIEKQR------GISVT-----------   60 (267)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCC-CCCEEEECCCCCCCCCCC---HHHHHHC------CCEEE-----------
T ss_conf             01799984799998999999998668633-385463036888604688---7999865------94486-----------


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH-HHHHHHHHHHCCCC-
Q ss_conf             4228999965148759986543332115778999989987630222343011231023352257-78999876435897-
Q gi|254780709|r  182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA-LRQVEMFHAVAGTT-  259 (321)
Q Consensus       182 ~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~-~~~a~~F~~~~~~~-  259 (321)
                        -++-.+.-+++.+=||||.|-    .+-..|...-.+++        +-.++|+||..|=.+ .+.+-.+.+..++- 
T Consensus        61 --~~~~~~~w~~~kinliDTPG~----~DF~~e~~~al~v~--------D~AviVv~a~~GVe~~T~~~w~~a~~~~iP~  126 (267)
T cd04169          61 --SSVMQFEYRDCVINLLDTPGH----EDFSEDTYRTLTAV--------DSAVMVIDAAKGVEPQTRKLFEVCRLRGIPI  126 (267)
T ss_pred             --CCEEEEEECCEEEEEEECCCC----HHHHHHHHHHHHHH--------HCEEEEEECCCCCCHHHHHHHHHHHHCCCCE
T ss_conf             --363788789989999979697----78999999999886--------4547995256665355899999999729997


Q ss_pred             EEEEECCCC-CCCHHHHH-HHHHHHCCCE
Q ss_conf             699965457-87069999-9999976988
Q gi|254780709|r  260 GLIMTKMDG-TARGGGLI-PIVVTHKIPV  286 (321)
Q Consensus       260 g~I~TKlD~-ta~~G~~l-s~~~~~~~Pi  286 (321)
                      =+.++|||- .+..-.+| ++...++.++
T Consensus       127 iifINKmDr~~adf~~~l~~i~~~lg~~~  155 (267)
T cd04169         127 ITFINKLDREGRDPLELLDEIEEELGIDC  155 (267)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             99985345678987899999999868775


No 258
>PRK08116 hypothetical protein; Validated
Probab=96.94  E-value=0.0068  Score=40.61  Aligned_cols=92  Identities=21%  Similarity=0.342  Sum_probs=57.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      =++|.|+.|+|||--++=+|+.+..+|.+|+.++.-.+    +++|+.-        |......+    ..+-+..  ..
T Consensus       110 GLll~G~~GtGKThLa~aIa~~l~~~g~~V~~~~~~~l----l~~lk~~--------~~~~~~~~----~~e~l~~--l~  171 (262)
T PRK08116        110 GLLLWGSPGNGKTYLAAAIANELIEKGVPVVFVNVPEL----LNRIKST--------YNSEGKED----ENEIIRA--LD  171 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH----HHHHHHH--------HHCCCCHH----HHHHHHH--HH
T ss_conf             18998989998999999999999987993999889999----9999999--------86356101----9999998--61


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             487599865433321157789999899876302
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRL  225 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~  225 (321)
                      ++|+++||--|--....--.   .++..+|+..
T Consensus       172 ~~dLLIiDDlG~e~~t~w~~---e~lf~IIn~R  201 (262)
T PRK08116        172 NADLLILDDLGAEKDTEWVR---EKLYNIIDSR  201 (262)
T ss_pred             CCCEEEEEHHCCCCCCHHHH---HHHHHHHHHH
T ss_conf             29989983221456987899---9999999999


No 259
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=96.92  E-value=0.002  Score=44.29  Aligned_cols=143  Identities=21%  Similarity=0.200  Sum_probs=74.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             13544444247899999998522674267743451245688999997530353212235866124542289999651487
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVD  195 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~D  195 (321)
                      +||..-|||+|-+-.|..      .++. ++                   +.|.-+    .||..-.      ....+..
T Consensus         1 ivG~pNvGKSTL~N~L~g------~~~~-vs-------------------~~pgtT----rd~~~~~------~~~~~~~   44 (158)
T cd01879           1 LVGNPNVGKTTLFNALTG------ARQK-VG-------------------NWPGVT----VEKKEGR------FKLGGKE   44 (158)
T ss_pred             CCCCCCCCHHHHHHHHHC------CCCE-EC-------------------CCCCCE----EEEEEEE------EEECCEE
T ss_conf             979898889999999959------9864-61-------------------789827----6347889------9629937


Q ss_pred             EEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-HCCCCEEEEECCCCCCCHH
Q ss_conf             59986543-332115778999989987630222343011231023352257789998764-3589769996545787069
Q gi|254780709|r  196 VLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA-VAGTTGLIMTKMDGTARGG  273 (321)
Q Consensus       196 vvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~-~~~~~g~I~TKlD~ta~~G  273 (321)
                      ++++||+| |.-.... .+|  ++.+..  ......+-+++|+||+.-..-...+....+ ..| .=++++|.|.-.+-.
T Consensus        45 ~~lvDtpGi~~~~~~~-~~e--~i~~~~--~~~~~~d~vl~vvD~~~~~~~l~~~~~l~~~~~p-~ivV~NK~D~~~~~~  118 (158)
T cd01879          45 IEIVDLPGTYSLSPYS-EDE--KVARDF--LLGEKPDLIVNVVDATNLERNLYLTLQLLELGLP-VVVALNMIDEAEKRG  118 (158)
T ss_pred             EEEEECCCCCCCCCCC-HHH--HHHHHH--HHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCC-EEEEEEHHHHHHHCC
T ss_conf             9999798741256413-567--899999--9851787179997774067768999999865998-899940277655225


Q ss_pred             HH---HHHHHHHCCCEEEEEC--CCCCCCCCC
Q ss_conf             99---9999997698899975--898132555
Q gi|254780709|r  274 GL---IPIVVTHKIPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       274 ~~---ls~~~~~~~Pi~fig~--Ge~i~Dl~~  300 (321)
                      ..   -.+....+.|+.+|+.  ||.+++|..
T Consensus       119 ~~~~~~~l~~~~~~~ii~iSA~~g~Gi~~L~~  150 (158)
T cd01879         119 IKIDLDKLSELLGVPVVPTSARKGEGIDELKD  150 (158)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
T ss_conf             46679999987199489998778979999999


No 260
>COG2403 Predicted GTPase [General function prediction only]
Probab=96.92  E-value=0.01  Score=39.37  Aligned_cols=137  Identities=19%  Similarity=0.265  Sum_probs=76.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC-CCC----HHHHHHHHHHHHHH--------------CCC
Q ss_conf             66741231135444442478999999985226742677434-512----45688999997530--------------353
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD-TFR----SAAIDQLKIWADRT--------------SAD  168 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D-tfR----~aA~eQL~~~a~~~--------------~v~  168 (321)
                      ..+|.+-..-=-+|+|||+.-+..|..++..|.+|..|..- .||    -.++|-|...++.-              .|+
T Consensus       124 ~ekPviaV~atrtg~GKsaVS~~v~r~l~ergyrv~vVrhPmiy~~~~ieitve~~~k~edld~ha~t~eereeye~~I~  203 (449)
T COG2403         124 LEKPVIAVTATRTGVGKSAVSRYVARLLRERGYRVCVVRHPMIYRGDRIEITVERLAKLEDLDRHAATDEEREEYESYIP  203 (449)
T ss_pred             HCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCEEECCCCCHHHHHHHHCHHHCCCCCCCHHHHHHHHHCCC
T ss_conf             14855999972366556788899999998669823799557023377310018977377652642255666887874364


Q ss_pred             CCC-CCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC-CHHHH
Q ss_conf             212-2358661245422899996514875998654333211577899998998763022234301123102335-22577
Q gi|254780709|r  169 FVC-SEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT-GQNAL  246 (321)
Q Consensus       169 ~~~-~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~-gq~~~  246 (321)
                      ... .--|-|=..+++++..     -.|+|+.|-.|-   +                +-...|+.-+-|.||.. |++..
T Consensus       204 tg~~vlAGvdy~~vlke~~~-----~aD~IlwdGgnn---d----------------fPfvkpd~~Ivvvda~rpg~ei~  259 (449)
T COG2403         204 TGGGVLAGVDYGTVLKEGEK-----EADFILWDGGNN---D----------------FPFVKPDLHIVVVDALRPGEEIG  259 (449)
T ss_pred             CCCCEEEEEEHHHHHHHHHH-----HCCEEEEECCCC---C----------------CCCCCCCCEEEEECCCCCCHHHC
T ss_conf             35534652048999987764-----155899948887---7----------------88525770599933888725652


Q ss_pred             HHHHHHHHHCC---CCEEEEECCCCCCCH
Q ss_conf             89998764358---976999654578706
Q gi|254780709|r  247 RQVEMFHAVAG---TTGLIMTKMDGTARG  272 (321)
Q Consensus       247 ~~a~~F~~~~~---~~g~I~TKlD~ta~~  272 (321)
                          .|---+.   -|-+|+||.|+...+
T Consensus       260 ----~~pGe~~irlAD~VIItkveea~~~  284 (449)
T COG2403         260 ----SFPGELRIRLADLVIITKVEEAMAE  284 (449)
T ss_pred             ----CCCCCEEEEECCEEEEECCCCHHHH
T ss_conf             ----6877315322128999613513367


No 261
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=96.91  E-value=0.0028  Score=43.27  Aligned_cols=125  Identities=21%  Similarity=0.295  Sum_probs=65.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---------CCCC--C--CCCHH
Q ss_conf             311354444424789999999852267426774345124568899999753035321---------2235--8--66124
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---------CSEI--G--SDAAA  180 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---------~~~~--~--~dp~~  180 (321)
                      |.++|--++||||.++.|.+....-..            ...+.++.-++..|-.-+         ..+.  |  -|.+.
T Consensus         2 i~iiGHvD~GKSTL~g~lL~~~g~i~~------------~~~~k~~~~~~~~gk~s~~~a~~lD~~~~ErerGiTI~~~~   69 (219)
T cd01883           2 LVVIGHVDAGKSTTTGHLLYLLGGVDK------------RTIEKYEKEAKEMGKGSFKYAWVLDTLKEERERGVTIDVGL   69 (219)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCH------------HHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHCCCCEEEEE
T ss_conf             899966899899999999998599768------------89999999998549987505566138987985892588589


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH---------HHHHHHHH
Q ss_conf             542289999651487599865433321157789999899876302223430112310233522---------57789998
Q gi|254780709|r  181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ---------NALRQVEM  251 (321)
Q Consensus       181 v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq---------~~~~~a~~  251 (321)
                      .      ++.-+++.+.||||.|.-..-.|++.-+.            ..+-.+||+||..|.         +-.+.+..
T Consensus        70 ~------~f~~~~~~~~iiDtPGH~df~~~mi~g~~------------~ad~ailvvda~~g~~e~g~~~~~QTreH~~l  131 (219)
T cd01883          70 A------KFETEKYRFTILDAPGHRDFVPNMITGAS------------QADVAVLVVDARKGEFEAGFEKGGQTREHALL  131 (219)
T ss_pred             E------EEEECCEEEEEEECCCCHHHHHHHHHHHH------------HCCEEEEEEECCCCCCCCCCCCCCHHHHHHHH
T ss_conf             9------99849936999878972667889998775------------31668999985767510366777659999999


Q ss_pred             HHHHCCCCEE--EEECCCCC
Q ss_conf             7643589769--99654578
Q gi|254780709|r  252 FHAVAGTTGL--IMTKMDGT  269 (321)
Q Consensus       252 F~~~~~~~g~--I~TKlD~t  269 (321)
                       ...+++..+  .+.|||..
T Consensus       132 -~~~lGik~iIVavNKMD~v  150 (219)
T cd01883         132 -ARTLGVKQLIVAVNKMDDV  150 (219)
T ss_pred             -HHHCCCCEEEEEEECCCCC
T ss_conf             -9984997489999875368


No 262
>PRK10037 cell division protein; Provisional
Probab=96.91  E-value=0.0012  Score=45.98  Aligned_cols=151  Identities=13%  Similarity=0.182  Sum_probs=77.5

Q ss_pred             CEEECCCCC-CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH------HHHHHHHHH---------------HHCCCC
Q ss_conf             123113544-4442478999999985226742677434512456------889999975---------------303532
Q gi|254780709|r  112 HVILVVGVN-GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA------IDQLKIWAD---------------RTSADF  169 (321)
Q Consensus       112 ~vil~vG~n-G~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA------~eQL~~~a~---------------~~~v~~  169 (321)
                      .+|.++|+. ||||||.+|-||.-+.+.|++|+.|-+|.--.-.      .++-.-|+.               .-|+.|
T Consensus         2 ~iial~s~kGGVGkTTltAnLA~aL~~~g~~VlaID~dpqN~Lrlhfg~~~~~~~Gwa~a~l~g~~W~~a~~~~~~gl~~   81 (250)
T PRK10037          2 AILGLQGVRGGVGTTSITAALAWSLQMLGENVLVIDACPDNLLRLSFNVDFTHRQGWARALLDGQDWRDAGLRYTSQLDL   81 (250)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHCCCCHHHHHHHCCCCCEE
T ss_conf             37999607888768999999999999779918999578256678754998544772999985699789998505699369


Q ss_pred             CCCCCCCCCHH--HHHHH-----------HHHHH-HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             12235866124--54228-----------99996-514875998654333211577899998998763022234301123
Q gi|254780709|r  170 VCSEIGSDAAA--LAYEA-----------FKQAQ-AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       170 ~~~~~~~dp~~--v~~~a-----------~~~a~-~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
                      .  ++|.-...  ..++.           +.... ..+||+|||||.--   ....++++-.           .-+.++.
T Consensus        82 L--PfG~l~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~~vliD~P~g---~s~~~~~~l~-----------~AD~vLv  145 (250)
T PRK10037         82 L--PFGQLSIEEQENPQHWQTTLGDICSALQQLKASGRYQWILLDLPRG---ASPLTRQLLS-----------LCDHSLA  145 (250)
T ss_pred             E--ECCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC---CCHHHHHHHH-----------HCCEEEE
T ss_conf             7--2787998998638877651799999986200257899899965999---8299999998-----------5787899


Q ss_pred             ECCCCCCHHHHHHHHHHHHHC-CCCEEEEECCCCCCCHHHH-HHHHHHH
Q ss_conf             102335225778999876435-8976999654578706999-9999997
Q gi|254780709|r  236 VLDATTGQNALRQVEMFHAVA-GTTGLIMTKMDGTARGGGL-IPIVVTH  282 (321)
Q Consensus       236 Vlda~~gq~~~~~a~~F~~~~-~~~g~I~TKlD~ta~~G~~-ls~~~~~  282 (321)
                      |+-+-    +...+..-.+.. .-..+++..+|-.+...-= ..+..+.
T Consensus       146 Vv~aD----a~s~~~L~q~~~~~g~~~liNq~~~~s~l~~Dl~~l~~q~  190 (250)
T PRK10037        146 IVNVD----ANCHIRLHQQALPAGAHILINDLRIGSQLQDDLYQLWLQS  190 (250)
T ss_pred             EECCC----HHHHHHHHHHCCCCCCCEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             83678----7789987342147898277516671104669999999974


No 263
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]
Probab=96.90  E-value=0.014  Score=38.50  Aligned_cols=164  Identities=23%  Similarity=0.291  Sum_probs=87.5

Q ss_pred             EECCCC-CCCCHHHHHHHHHHHHHHCCCCEEE--EECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCH----HHHHHHH
Q ss_conf             311354-4444247899999998522674267--74345124568899999753035321223586612----4542289
Q gi|254780709|r  114 ILVVGV-NGVGKTTVIGKLSKKMSDAGLKVML--AAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA----ALAYEAF  186 (321)
Q Consensus       114 il~vG~-nG~GKTTT~aKLA~~~~~~g~kV~l--va~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~----~v~~~a~  186 (321)
                      +++.|+ -|+||||...=|..-++++|.+|--  +.-|---|+      -+....|.|.+    +=||-    +.+++..
T Consensus         3 vvIAg~~SG~GKTTvT~glm~aL~~rg~~VqpfKvGPDYIDP~------~H~~atG~~sr----NLD~~mm~~~~v~~~f   72 (451)
T COG1797           3 VVIAGTSSGSGKTTVTLGLMRALRRRGLKVQPFKVGPDYIDPG------YHTAATGRPSR----NLDSWMMGEEGVRALF   72 (451)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCH------HHHHHHCCCCC----CCCHHHCCHHHHHHHH
T ss_conf             5995488888589999999999986687216655687863813------56676388567----7765446998999999


Q ss_pred             HHHHHHCCCEEEEECC-----CCCC-CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC-CHHHHHHHHHH---HHHC
Q ss_conf             9996514875998654-----3332-11577899998998763022234301123102335-22577899987---6435
Q gi|254780709|r  187 KQAQAKKVDVLIIDTA-----GRLH-NNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT-GQNALRQVEMF---HAVA  256 (321)
Q Consensus       187 ~~a~~~~~DvvliDTA-----GR~~-~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~-gq~~~~~a~~F---~~~~  256 (321)
                      .+ ..++.|+.+|--.     |+-. .+..=-..+.++-   +       .-++||+|+.- .+.+.-+++-|   ...+
T Consensus        73 ~~-~~~~adi~vIEGVMGLfDG~~~~~~~gSTA~lAk~l---~-------~PVvLVid~~~~s~S~AAiv~G~~~fdp~v  141 (451)
T COG1797          73 AR-AAADADIAVIEGVMGLFDGRGSATDTGSTADLAKLL---G-------APVVLVVDASGLSRSVAAIVKGFKHFDPDV  141 (451)
T ss_pred             HH-HCCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHH---C-------CCEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             98-627898799961230236887776777799999985---9-------998999957522578999998898619988


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHH-HCCCEEEEECCCCCCCCCC
Q ss_conf             8976999654578706999999999-7698899975898132555
Q gi|254780709|r  257 GTTGLIMTKMDGTARGGGLIPIVVT-HKIPVYFLGVGEGINDLEP  300 (321)
Q Consensus       257 ~~~g~I~TKlD~ta~~G~~ls~~~~-~~~Pi~fig~Ge~i~Dl~~  300 (321)
                      ++.|||+++.-+.....-+-..+.. +++|  .+|.=.+=++++.
T Consensus       142 ~iaGVIlNrVgserH~~llr~Ale~~~gv~--vlG~lpr~~~l~l  184 (451)
T COG1797         142 NIAGVILNRVGSERHYELLRDALEEYTGVP--VLGYLPRDDDLEL  184 (451)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCCCCC--EEEEECCCCCCCC
T ss_conf             257899724777889999998755327985--7987427855678


No 264
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=96.90  E-value=0.018  Score=37.69  Aligned_cols=90  Identities=24%  Similarity=0.434  Sum_probs=67.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCCHHHHHHHHHH
Q ss_conf             4123113544444247899999998522674267743451245688999997530353212--23586612454228999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC--SEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~--~~~~~dp~~v~~~a~~~  188 (321)
                      -.++|+-|=.|.||+|.+=.+|+.+.+++ +|+-|++.-    ...|.+--|+|++++.-.  .-.+.+--    +-++.
T Consensus        93 Gs~iLIgGdPGIGKSTLLLQva~~lA~~~-~vLYVsGEE----S~~QiklRA~RL~~~~~~l~l~aEt~~e----~I~~~  163 (456)
T COG1066          93 GSVILIGGDPGIGKSTLLLQVAARLAKRG-KVLYVSGEE----SLQQIKLRADRLGLPTNNLYLLAETNLE----DIIAE  163 (456)
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHHCC-CEEEEECCC----CHHHHHHHHHHHCCCCCCEEEEHHCCHH----HHHHH
T ss_conf             61799736898779899999999987059-579996776----7899999999828996455774112899----99999


Q ss_pred             HHHHCCCEEEEECCCCCCCHH
Q ss_conf             965148759986543332115
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLHNNS  209 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~~~~  209 (321)
                      ...++.|+++||.-=-++.+.
T Consensus       164 l~~~~p~lvVIDSIQT~~s~~  184 (456)
T COG1066         164 LEQEKPDLVVIDSIQTLYSEE  184 (456)
T ss_pred             HHHCCCCEEEEECCCEECCCC
T ss_conf             985499789996541230263


No 265
>PRK08769 DNA polymerase III subunit delta'; Validated
Probab=96.89  E-value=0.0037  Score=42.51  Aligned_cols=127  Identities=17%  Similarity=0.216  Sum_probs=66.5

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC---CCCCCCC-HHHHH
Q ss_conf             6674123113544444247899999998522674267743451245688999997530353212---2358661-24542
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC---SEIGSDA-AALAY  183 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~---~~~~~dp-~~v~~  183 (321)
                      ..-|+-++|.||.|+||++++-.+|.++.-++..... +|.      ..++-..+..-++.++.   ...+... ..|.-
T Consensus        23 ~rl~HA~Lf~Gp~G~GK~~~A~~~A~~llc~~~~~~~-~~~------~~~~i~~g~HPD~~~i~~~~~~~~~k~k~~I~I   95 (319)
T PRK08769         23 GRLGHGLLICGPEGLGKRAVALALAEHVLASGPDPAL-AQR------TRQLIAAGTHPDLQLVSFIPNRTGDKLRTEIVI   95 (319)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCC-CCH------HHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCH
T ss_conf             9942068758999878999999999998379979765-433------889996689989687753444454311234869


Q ss_pred             HHHHHHH--------HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             2899996--------514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  184 EAFKQAQ--------AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       184 ~a~~~a~--------~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                      +.+....        ..++-|+|||-|-+|..+..  +-|       =|..+..|..+++++=+...++....+.
T Consensus        96 dqiR~l~~~~~~~p~~g~~KV~IId~Ad~mn~~Aa--Nal-------LK~LEEPp~~~~~iL~~~~~~~ll~TI~  161 (319)
T PRK08769         96 EQVREISQKLALTPQYGIAQVVIVDPADAINRSAC--NAL-------LKTLEEPSPGRYLWLISAQPARLPATIR  161 (319)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCHHHCCHHHH--HHH-------HHHHCCCCCCEEEEEEECCHHHCCHHHH
T ss_conf             99999999961372027956999806675289999--999-------9982279988489998699365824776


No 266
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family. In Arabidopsis the region carries two binding domains, a phosphoribosylpyrophosphate-binding domain and, at the very C-terminus, a uracil-binding domain.
Probab=96.88  E-value=0.00066  Score=47.73  Aligned_cols=36  Identities=33%  Similarity=0.463  Sum_probs=30.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             231135444442478999999985226742677434
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD  148 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D  148 (321)
                      +|.+.|+.||||||.+-+|+..+...|.++..+.+|
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~~~~~~~d   36 (196)
T pfam00485         1 IIGVAGSSGAGKTTVARTFVSIFGREGVPAAGIEGD   36 (196)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCE
T ss_conf             989989985719999999999966058776412431


No 267
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=96.88  E-value=0.0041  Score=42.18  Aligned_cols=114  Identities=16%  Similarity=0.286  Sum_probs=61.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHH-CC-C-CEEEEECCCC--CHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             667412311354444424789999999852-26-7-4267743451--24568899999753035321223586612454
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSD-AG-L-KVMLAAGDTF--RSAAIDQLKIWADRTSADFVCSEIGSDAAALA  182 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g-~-kV~lva~Dtf--R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~  182 (321)
                      ..-|+-++|.||.|+||||++--+|..+-. .+ + -+=++..+..  +.=.+||.+..-+.+...              
T Consensus        23 ~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll~~~~~~~~~D~~~~~~~~~~~I~vd~IR~l~~~~~~~--------------   88 (313)
T PRK05564         23 GKFSHASLIVGEDGIGKSILAKEIANKILGKSEQREYVDIIEYKPINKKSIGVDDIRNIIEEVNKK--------------   88 (313)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHC--------------
T ss_conf             998750432799985099999999999828997788986588633225699989999999998408--------------


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             22899996514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       183 ~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                            ....+|=|+|||-|-+|.....         +.+=|..+..|..+++.+=++.-+.....+.
T Consensus        89 ------p~~g~~KV~II~~ae~m~~~Aa---------NALLKtLEEPP~~t~fIL~t~~~~~lLpTI~  141 (313)
T PRK05564         89 ------PYEGDKKVIIIYKSEKMTEQAQ---------NAFLKTIEEPPKGVFIILLCENLEQILDTIK  141 (313)
T ss_pred             ------CCCCCCEEEEECCHHHHCHHHH---------HHHHHCCCCCCCCEEEEEEECCHHHCCCHHH
T ss_conf             ------6258956999807777589999---------9984550368998589986498354757787


No 268
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]
Probab=96.88  E-value=0.0012  Score=46.03  Aligned_cols=153  Identities=18%  Similarity=0.225  Sum_probs=84.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      +.|+-++|.-+|||||.+-||...++.+|.+|+.|--+...             ..+    ...|+|+-.        .+
T Consensus         2 ~~Il~ivG~k~SGKTTLie~lv~~L~~~G~rVa~iKH~hh~-------------~~~----D~~GkDs~r--------~~   56 (161)
T COG1763           2 MKILGIVGYKNSGKTTLIEKLVRKLKARGYRVATVKHAHHD-------------FDL----DKPGKDTYR--------HR   56 (161)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCC-------------CCC----CCCCCCCCH--------HH
T ss_conf             72899996279973428999999997579379999865877-------------777----889876610--------00


Q ss_pred             HHCCCEEEEECCCCCCCHHHHH-HHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             5148759986543332115778-999989987630222343011231023352257789998764358976999654578
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILM-AGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGT  269 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm-~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~t  269 (321)
                      ..+.+.+++=+.+|...-...+ .+|..+   +..+.+.  .+..|             ++-|+ ..++-.+++-+-++.
T Consensus        57 ~aGa~~~v~~s~~~~~~~~~~~~~~L~~v---l~~l~~~--~D~vL-------------VEGFK-~~~~pKI~~~r~~~~  117 (161)
T COG1763          57 KAGADQVVVASDHRTALMTRTPDRDLDAV---LSRLDPL--LDLVL-------------VEGFK-EEPLPKIVLGRDEEG  117 (161)
T ss_pred             CCCCCEEEEECCCEEEEEEECCCCCHHHH---HHHCCCC--CCEEE-------------EECCC-CCCCCEEEEECCCCC
T ss_conf             35663499955978999982687689999---9742755--67999-------------95256-677778999566655


Q ss_pred             C---CHHHHHHH-HHHHCCCEEEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             7---06999999-99976988999758981325557789999987
Q gi|254780709|r  270 A---RGGGLIPI-VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI  310 (321)
Q Consensus       270 a---~~G~~ls~-~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~l  310 (321)
                      .   ......++ ......|+.++..= .+.++.  +++..++.+
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-p~~~~~--~~~~~~~~~  159 (161)
T COG1763         118 DREPVDVIDPAVIAVAKDAPLAEVTDL-PVLDLN--DVEALADFV  159 (161)
T ss_pred             CCCCCCCCCCHHHHHCCCCCCCCCCCC-CHHHCC--CHHHHHHHH
T ss_conf             445543222112100143000000368-423210--058888754


No 269
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=96.88  E-value=0.0098  Score=39.52  Aligned_cols=105  Identities=17%  Similarity=0.212  Sum_probs=56.5

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC--CEEEEECCCCCHHHHHHHHHHHHHH-CCCCCCCCCCCCCHHHHHHH
Q ss_conf             67412311354444424789999999852267--4267743451245688999997530-35321223586612454228
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL--KVMLAAGDTFRSAAIDQLKIWADRT-SADFVCSEIGSDAAALAYEA  185 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~--kV~lva~DtfR~aA~eQL~~~a~~~-~v~~~~~~~~~dp~~v~~~a  185 (321)
                      ..|.-+++.|++|+|||+|+-.+...++....  .+.-|-|-.++--. .=+...++.+ +.++   +..+-|..-.++.
T Consensus        53 ~~~~n~~I~G~pGTGKT~~vk~v~~~l~~~~~~~~~vyINc~~~~t~~-~i~~~i~~~L~~~~~---p~~G~s~~~~~~~  128 (394)
T PRK00411         53 SRPSNVLILGPPGTGKTTTVKKVFEELEEAALKVVYVYINCQIDRTRY-AILSEIARSLFGHPP---PSSGLSFDELFDK  128 (394)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHH-HHHHHHHHHHCCCCC---CCCCCCHHHHHHH
T ss_conf             999847998899998999999999999974689659999696689899-999999999569989---8778789999999


Q ss_pred             HHHHHHH--CCCEEEEECCCCCCCH--HHHHHHHHH
Q ss_conf             9999651--4875998654333211--577899998
Q gi|254780709|r  186 FKQAQAK--KVDVLIIDTAGRLHNN--SILMAGIGK  217 (321)
Q Consensus       186 ~~~a~~~--~~DvvliDTAGR~~~~--~~lm~EL~k  217 (321)
                      +...-.+  ++=+|++|=.-.+-..  .+++-.|-.
T Consensus       129 l~~~l~~~~~~~ivvLDEiD~L~~~~~~~vLY~L~r  164 (394)
T PRK00411        129 IAEYLDERDRVLIVALDDINYLVEKEGNDVLYSLLR  164 (394)
T ss_pred             HHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             999861669758999965540203665089999985


No 270
>PTZ00141 elongation factor 1 alpha; Provisional
Probab=96.88  E-value=0.02  Score=37.31  Aligned_cols=135  Identities=20%  Similarity=0.276  Sum_probs=71.7

Q ss_pred             CCCCCE-EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCC---------CCC-CC
Q ss_conf             667412-3113544444247899999998522674267743451245688999997530353212---------235-86
Q gi|254780709|r  108 SHRPHV-ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC---------SEI-GS  176 (321)
Q Consensus       108 ~~~p~v-il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~---------~~~-~~  176 (321)
                      ..+|++ |.++|==-+||+|.+|-|.+.+..-         |   ....++++.-+...|-.-+.         .+. ..
T Consensus         3 ~~k~~l~i~~~GhVD~GKSTL~G~Ll~~~g~v---------~---~~~~~~~~~~~~~~g~~~~~~a~~~D~~~~Er~rG   70 (443)
T PTZ00141          3 KEKTHINLVVIGHVDSGKSTTTGHLIYKLGGI---------D---KRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERG   70 (443)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHCCCC---------C---HHHHHHHHHHHHHHCCCCCEEHHHHCCCHHHHHCC
T ss_conf             88876599999477982888899999873884---------6---88999998888871787200044530776676367


Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH---------HHHH
Q ss_conf             6124542289999651487599865433321157789999899876302223430112310233522---------5778
Q gi|254780709|r  177 DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ---------NALR  247 (321)
Q Consensus       177 dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq---------~~~~  247 (321)
                      -...+++   .++.-.++.+.+||++|.-..=.|++.-.            +.+|-.+||+||..|-         .-.+
T Consensus        71 iTidv~~---~~f~t~~~~~~iiD~PGH~~fi~nmi~Ga------------s~aD~ailvVdA~~G~~e~gf~~~gQTre  135 (443)
T PTZ00141         71 ITIDIAL---WKFETPKYYYTVIDAPGHRDFIKNMITGT------------SQADVALLVVPAEVGGFEGAFSKEGQTRE  135 (443)
T ss_pred             CEEEEEE---EEEECCCEEEEEEECCCHHHHHHHHHHHH------------CCCCEEEEEEECCCCCCCCCCCCCCCCHH
T ss_conf             1073479---99943988999998997288899999634------------10775899998677852134666786399


Q ss_pred             HHHHHHHHCCCCEEE--EECCCCCC
Q ss_conf             999876435897699--96545787
Q gi|254780709|r  248 QVEMFHAVAGTTGLI--MTKMDGTA  270 (321)
Q Consensus       248 ~a~~F~~~~~~~g~I--~TKlD~ta  270 (321)
                      .+.. ...+++..+|  ++|||...
T Consensus       136 H~~i-~~~lgv~~iIVaVNKmD~v~  159 (443)
T PTZ00141        136 HALL-AFTLGVKQIIVGINKMDTCD  159 (443)
T ss_pred             HHHH-HHHCCCCEEEEEEEEECCCC
T ss_conf             9999-99739975999999621566


No 271
>PRK12377 putative replication protein; Provisional
Probab=96.87  E-value=0.006  Score=41.02  Aligned_cols=94  Identities=15%  Similarity=0.261  Sum_probs=59.6

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             36674123113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      +.....-+.|+|++|+|||.-+.=||+.+-++|++|.++++-    .=+++|+.=-          ..+..-..+    +
T Consensus        97 F~~~~~NlIf~G~pGtGKTHLA~AIg~~a~~~G~sVlF~t~~----dLv~~L~~a~----------~~g~~~~k~----l  158 (248)
T PRK12377         97 LMTGCTNFVFSGKPGTGKNHLAAAIGNRLLAKGRSVIVVTVP----DVMSRLHESY----------DNGQSGEKF----L  158 (248)
T ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH----HHHHHHHHHH----------HCCCCHHHH----H
T ss_conf             731886089989999878899999999999879969998899----9999999999----------848509999----9


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9996514875998654333211577899998998763
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLK  223 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~  223 (321)
                      .  ....+|++|||--|-.+.+..   |-..+.+++.
T Consensus       159 ~--~l~~~dLLIIDElG~~~~s~~---~~~llfqlI~  190 (248)
T PRK12377        159 Q--ELCKVDLLVLDEIGIQRETKN---EQVVLNQIID  190 (248)
T ss_pred             H--HHHCCCEEEEHHCCCCCCCHH---HHHHHHHHHH
T ss_conf             9--973389898600057889867---9999999999


No 272
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=96.87  E-value=0.0017  Score=44.85  Aligned_cols=174  Identities=16%  Similarity=0.231  Sum_probs=91.5

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             99998785201001210001366741231135444442478999999985226742677434512456889999975303
Q gi|254780709|r   87 DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTS  166 (321)
Q Consensus        87 ~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~  166 (321)
                      .+.+.|.+++....+...+   ....-+.++|.+-|||.+-+--|    ..  +..++|+                   +
T Consensus       196 ~~~~~l~~ll~~~~~g~il---r~G~kvvIiG~PNvGKSSLLNaL----~~--~d~AIVT-------------------d  247 (454)
T COG0486         196 ELIAELDELLATAKQGKIL---REGLKVVIIGRPNVGKSSLLNAL----LG--RDRAIVT-------------------D  247 (454)
T ss_pred             HHHHHHHHHHHHHHHHHHH---HCCCEEEEECCCCCCHHHHHHHH----HC--CCCEEEC-------------------C
T ss_conf             9999999999744421366---45864999879988679999988----66--7866742-------------------8


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH
Q ss_conf             5321223586612454228999-965148759986543-33211577899998998763022234301123102335225
Q gi|254780709|r  167 ADFVCSEIGSDAAALAYEAFKQ-AQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN  244 (321)
Q Consensus       167 v~~~~~~~~~dp~~v~~~a~~~-a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~  244 (321)
                      +      .|+     -+|.++. ...+|+-+.|+|||| |-+.|.-   |-.-|.|..+...  ..+.+++|+|++.+-.
T Consensus       248 I------~GT-----TRDviee~i~i~G~pv~l~DTAGiRet~d~V---E~iGIeRs~~~i~--~ADlvL~v~D~~~~~~  311 (454)
T COG0486         248 I------AGT-----TRDVIEEDINLNGIPVRLVDTAGIRETDDVV---ERIGIERAKKAIE--EADLVLFVLDASQPLD  311 (454)
T ss_pred             C------CCC-----CCCEEEEEEEECCEEEEEEECCCCCCCCCHH---HHHHHHHHHHHHH--HCCEEEEEEECCCCCC
T ss_conf             9------997-----4103789999898899998567766673489---9999999999998--5998999970887776


Q ss_pred             HHHHHHHHHHHCCC---CEEEEECCCCCCCH-HHHHHHHHHHCCCEEEEEC--CCCCCCCCCCCHHHHHH
Q ss_conf             77899987643589---76999654578706-9999999997698899975--89813255577899999
Q gi|254780709|r  245 ALRQVEMFHAVAGT---TGLIMTKMDGTARG-GGLIPIVVTHKIPVYFLGV--GEGINDLEPFVAKDFSA  308 (321)
Q Consensus       245 ~~~~a~~F~~~~~~---~g~I~TKlD~ta~~-G~~ls~~~~~~~Pi~fig~--Ge~i~Dl~~f~~~~~~~  308 (321)
                      ..+..  +.+.++-   .=+|++|.|=..+. +.-+  ...-+.|+..++.  ||.+++|+..--..|-.
T Consensus       312 ~~d~~--~~~~~~~~~~~i~v~NK~DL~~~~~~~~~--~~~~~~~~i~iSa~t~~Gl~~L~~~i~~~~~~  377 (454)
T COG0486         312 KEDLA--LIELLPKKKPIIVVLNKADLVSKIELESE--KLANGDAIISISAKTGEGLDALREAIKQLFGK  377 (454)
T ss_pred             HHHHH--HHHHCCCCCCEEEEEECHHCCCCCCCCHH--HCCCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             01177--88724368977999960211564321012--02678826999825765799999999999863


No 273
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=96.87  E-value=0.0028  Score=43.37  Aligned_cols=98  Identities=16%  Similarity=0.218  Sum_probs=52.8

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             36674123113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      +.++..-|+|+|+.|+||||-+.+|.     .+.....                      +|.++..            +
T Consensus        15 ~~~k~~kIlilGld~aGKTTil~~l~-----~~~~~~~----------------------~PT~Gfn------------~   55 (190)
T cd00879          15 LYNKEAKILFLGLDNAGKTTLLHMLK-----DDRLAQH----------------------VPTLHPT------------S   55 (190)
T ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHH-----CCCCCEE----------------------CCCCCCC------------E
T ss_conf             65770489999069998899999980-----7995315----------------------2655874------------5


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             999651487599865433321157789999899876302223430112310233522577899987643
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV  255 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~  255 (321)
                      +..+.+++++-+.|++|.-.. ..+-          +.+.. ..+-+++|+|++--+..-+..+.+++.
T Consensus        56 e~i~~~~~~~~~wDvgG~~~~-R~lW----------~~Y~~-~~~~iIfVVDssD~~r~~eak~~L~~l  112 (190)
T cd00879          56 EELTIGNIKFKTFDLGGHEQA-RRLW----------KDYFP-EVDGIVFLVDAADPERFQESKEELDSL  112 (190)
T ss_pred             EEEEECCEEEEEEECCCCCCC-CCCH----------HHHHH-CCCEEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             999989999999989998455-5438----------88843-113799999776778999999999999


No 274
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=96.86  E-value=0.0049  Score=41.62  Aligned_cols=98  Identities=20%  Similarity=0.243  Sum_probs=51.8

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .++++||.|+||||-..+|.+.     ..+                         +.+++..   |-. .+.... ...+
T Consensus         2 tvLl~Gl~~aGKT~Lf~~L~~~-----~~~-------------------------~T~tS~~---~n~-~~~~~~-~~~~   46 (203)
T cd04105           2 TVLLLGPSDSGKTALFTKLTTG-----KYR-------------------------STVTSIE---PNV-ATFILN-SEGK   46 (203)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC-----CCC-------------------------CCCCCCC---CCC-EEEECC-CCCC
T ss_conf             5999907999899999999749-----988-------------------------8778887---862-066402-4668


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-HHHHHHHHHHHHC
Q ss_conf             487599865433321157789999899876302223430112310233522-5778999876435
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-NALRQVEMFHAVA  256 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-~~~~~a~~F~~~~  256 (321)
                      +.-+-++|+.|.-.....+.+.   +..        ...-+++|+||.+=+ +.-+.|+..++.+
T Consensus        47 ~~~~~lvD~PGH~klR~~~~~~---~~~--------~~~gIVfvVDs~~~~~~l~~~Ae~Ly~iL  100 (203)
T cd04105          47 GKKFRLVDVPGHPKLRDKLLET---LKN--------SAKGIVFVVDSATFQKNLKDVAEFLYDIL  100 (203)
T ss_pred             CCEEEEEECCCCHHHHHHHHHH---HHH--------CCCEEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             7279999879968899999999---875--------49899999968875111999999999998


No 275
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=96.86  E-value=0.0053  Score=41.40  Aligned_cols=139  Identities=19%  Similarity=0.253  Sum_probs=68.6

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      +++-.-|+++|+.||||||-+-++.      +..+     +++-|           -+|..+.         .+      
T Consensus        11 ~~~~~KililG~~~sGKTsll~~l~------~~~~-----~~~~p-----------T~G~~~~---------~~------   53 (173)
T cd04154          11 KEREMRILILGLDNAGKTTILKKLL------GEDI-----DTISP-----------TLGFQIK---------TL------   53 (173)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHC------CCCC-----CCCCC-----------CCCEEEE---------EE------
T ss_conf             4573189999899978899999983------9998-----97267-----------0577789---------99------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHHHHC------CCC-
Q ss_conf             996514875998654333211577899998998763022234301123102335225778999-876435------897-
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFHAVA------GTT-  259 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~~~~------~~~-  259 (321)
                        ..+++.+.+-||||+-.     +..+-+.      +.. ..+-+++|+|++-.+ .++.++ .+++.+      +.- 
T Consensus        54 --~~~~~~l~iwD~~G~e~-----~~~~~~~------y~~-~a~~ii~VvD~td~~-~~~~~~~~l~~ll~~~~~~~~pi  118 (173)
T cd04154          54 --EYEGYKLNIWDVGGQKT-----LRPYWRN------YFE-STDALIWVVDSSDRL-RLDDCKRELKELLQEERLAGATL  118 (173)
T ss_pred             --EECCEEEEEEECCCCCC-----CCHHHHH------HHC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             --98999999996688602-----0058999------722-665389998556578-89999999999986354159847


Q ss_pred             EEEEECCCCCCC--H---HHHHHHHHHHCCCEEE--EE--CCCCCCCC
Q ss_conf             699965457870--6---9999999997698899--97--58981325
Q gi|254780709|r  260 GLIMTKMDGTAR--G---GGLIPIVVTHKIPVYF--LG--VGEGINDL  298 (321)
Q Consensus       260 g~I~TKlD~ta~--~---G~~ls~~~~~~~Pi~f--ig--~Ge~i~Dl  298 (321)
                      =++.+|.|-...  .   -..+........|..|  ++  +||.|+++
T Consensus       119 li~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~~~~~SAktG~gI~e~  166 (173)
T cd04154         119 LILANKQDLPGALSEEEIREALELDKISSHHWRIQPCSAVTGEGLLQG  166 (173)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHH
T ss_conf             999876567778899999999868744579829999889669298999


No 276
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=96.86  E-value=0.053  Score=34.37  Aligned_cols=149  Identities=18%  Similarity=0.214  Sum_probs=71.9

Q ss_pred             CCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             01366741231135444442478999999985226742677434512456889999975303532122358661245422
Q gi|254780709|r  105 WDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE  184 (321)
Q Consensus       105 ~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~  184 (321)
                      ++..+.| .|.++|=.-|||+|-+=.|.    .+ ++++++ .++  ||-.        | .+.++.             
T Consensus        13 ~p~~~~p-~IaivGrpNvGKSTL~N~L~----g~-k~~a~v-s~~--pGtT--------r-~i~~~~-------------   61 (179)
T TIGR03598        13 LPPDDGP-EIAFAGRSNVGKSSLINALT----NR-KKLART-SKT--PGRT--------Q-LINFFE-------------   61 (179)
T ss_pred             CCCCCCC-EEEEECCCCCCHHHHHHHHH----CC-CCEEEE-CCC--CCEE--------E-ECCEEE-------------
T ss_conf             9998897-89998699988899999986----89-855897-089--9736--------6-023201-------------


Q ss_pred             HHHHHHHHCCCEEEEECCCC-----CCCHHHHHHH-HHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHC
Q ss_conf             89999651487599865433-----3211577899-998998763022234301123102335225--778999876435
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGR-----LHNNSILMAG-IGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVA  256 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR-----~~~~~~lm~E-L~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~  256 (321)
                             -+.++++|||+|-     .......+.+ +.+......     .-+.++||+||..|-.  -.+.++...+.-
T Consensus        62 -------~~~~~~lvDtpGyG~~~~~~~~~~~~~~~~~~~~~~~~-----~l~~villiDa~~gl~~~D~~i~~~l~~~~  129 (179)
T TIGR03598        62 -------VNDGFRLVDLPGYGYAKVSKEEKEKWQKLIEEYLRGRE-----NLKGVVLLMDIRHPLKELDLEMLEWLDERG  129 (179)
T ss_pred             -------ECCCEEEEECCCHHHCCCCHHHHHHHHHHHHHHHHHHH-----HHHCEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             -------04736999777602112788889999999999999988-----643028987437799899999999999759


Q ss_pred             CCCEEEEECCCCCCCHHH---HHHHHHHH-----CCCEEEEEC--CCCCC
Q ss_conf             897699965457870699---99999997-----698899975--89813
Q gi|254780709|r  257 GTTGLIMTKMDGTARGGG---LIPIVVTH-----KIPVYFLGV--GEGIN  296 (321)
Q Consensus       257 ~~~g~I~TKlD~ta~~G~---~ls~~~~~-----~~Pi~fig~--Ge~i~  296 (321)
                      ---=++++|.|--.+...   .-.+...+     -.||.||+.  |+.+|
T Consensus       130 kp~iivlNK~Dll~~~~~~~~~~~i~~~l~~~~~~~~v~~ISA~~g~GID  179 (179)
T TIGR03598       130 IPVLIVLTKADKLKKSERNKQLKKIKKALKKDADDPSVQLFSSLKKTGIE  179 (179)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCC
T ss_conf             98899997813069899999999999997336688948999799983879


No 277
>PRK09354 recA recombinase A; Provisional
Probab=96.86  E-value=0.0062  Score=40.91  Aligned_cols=92  Identities=18%  Similarity=0.280  Sum_probs=63.1

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---CCCCCCCCHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321---223586612454228999
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---CSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---~~~~~~dp~~v~~~a~~~  188 (321)
                      +++-+-|+.++||||.+....+..++.|..++++-+-.  +  +  =..|++.+||++=   ..++  |...-+++.++.
T Consensus        61 RivEi~G~esSGKTtlal~~iaeaQk~Gg~~a~iDaE~--a--l--d~~~a~~lGVd~d~llv~qp--d~~Eqal~i~e~  132 (350)
T PRK09354         61 RIVEIYGPESSGKTTLALHAIAEAQKAGGTAAFIDAEH--A--L--DPVYAKKLGVDIDNLLVSQP--DTGEQALEIADA  132 (350)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECC--C--C--CHHHHHHCCCCHHHEEEECC--CHHHHHHHHHHH
T ss_conf             08999889877799999999999997599479996000--2--7--98899984977157178568--679999999999


Q ss_pred             HH-HHCCCEEEEECCCCCCCHHHH
Q ss_conf             96-514875998654333211577
Q gi|254780709|r  189 AQ-AKKVDVLIIDTAGRLHNNSIL  211 (321)
Q Consensus       189 a~-~~~~DvvliDTAGR~~~~~~l  211 (321)
                      .. ....|+|+||.-+-+....++
T Consensus       133 Lvrsg~vd~IVvDSVaAL~pk~Ei  156 (350)
T PRK09354        133 LVRSGAVDLIVVDSVAALVPKAEI  156 (350)
T ss_pred             HHHCCCCCEEEEECCCCCCCHHHH
T ss_conf             985488418998253345768887


No 278
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=96.85  E-value=0.022  Score=37.04  Aligned_cols=98  Identities=15%  Similarity=0.190  Sum_probs=53.4

Q ss_pred             CCCEEEEECCC---CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHH-HHH---------
Q ss_conf             48759986543---3321157789999899876302223430112310233522-----57789998-764---------
Q gi|254780709|r  193 KVDVLIIDTAG---RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEM-FHA---------  254 (321)
Q Consensus       193 ~~DvvliDTAG---R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~-F~~---------  254 (321)
                      +..++++||+|   |.|.+.+++.+.-   +.+.     ..+-+++|+|+.-..     +.++..+. ..+         
T Consensus        43 ~~~i~~~DtpGi~~~~~~~~~~~~~~l---~~~~-----~~d~il~vvD~~~~~~~~~~~~~~~~~~i~~el~~~~~~~~  114 (176)
T cd01881          43 GARIQVADIPGLIEGASEGRGLGNQFL---AHIR-----RADAILHVVDASEDDDIGGVDPLEDYEILNAELKLYDLETI  114 (176)
T ss_pred             CCEEEEEECCCCCCCCHHHHHHHHHHH---HHHH-----CCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCHHHH
T ss_conf             966999957875457337878999999---8741-----08899999989876554544589999999999997115665


Q ss_pred             -----HCCCCEEEEECCCCCCCHHHHH----HHHHHHCCCEEEEEC--CCCCCCCC
Q ss_conf             -----3589769996545787069999----999997698899975--89813255
Q gi|254780709|r  255 -----VAGTTGLIMTKMDGTARGGGLI----PIVVTHKIPVYFLGV--GEGINDLE  299 (321)
Q Consensus       255 -----~~~~~g~I~TKlD~ta~~G~~l----s~~~~~~~Pi~fig~--Ge~i~Dl~  299 (321)
                           ..| .=++++|.|--.+-...-    ......+.|+.+++.  |+.++.|.
T Consensus       115 ~~~~~~kp-~i~v~NK~Dl~~~~~~~~~~~~~~~~~~~~~ii~iSA~~~~gi~~L~  169 (176)
T cd01881         115 LGLLTAKP-VIYVLNKIDLDDAEELEEELVRELALEEGAEVVPISAKTEEGLDELI  169 (176)
T ss_pred             HHHHCCCC-EEEEEECEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHH
T ss_conf             55432697-19999686034700315999999974689958999777887999999


No 279
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=96.84  E-value=0.055  Score=34.28  Aligned_cols=146  Identities=20%  Similarity=0.274  Sum_probs=82.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH-HHHH
Q ss_conf             231135444442478999999985226742677434512456889999975303532122358661245422899-9965
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK-QAQA  191 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~-~a~~  191 (321)
                      +|.+||-+-|||.|-.-+|    .  |++-++|.                +.-||.-       |       -+. .+.-
T Consensus       281 ~VAIVGRPNVGKSTLFNRL----~--g~r~AIV~----------------d~pGvTR-------D-------R~~~~~~~  324 (714)
T PRK09518        281 TVAIVGRPNVGKSTLVNRI----L--GRREAVVE----------------DTPGVTR-------D-------RVSYDAEW  324 (714)
T ss_pred             EEEEECCCCCCHHHHHHHH----H--CCCEEEEC----------------CCCCCCC-------C-------CCEEEEEE
T ss_conf             7999899987689999886----2--88416846----------------9899883-------7-------55579999


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH--HHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             1487599865433321157789999899876302223430112310233522577--89998764358976999654578
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL--RQVEMFHAVAGTTGLIMTKMDGT  269 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~--~~a~~F~~~~~~~g~I~TKlD~t  269 (321)
                      .+....||||+|=......+..++..   -+.... ...+-++||+|+..|-...  ..|+...+.=.-.=+++.|.|+.
T Consensus       325 ~~~~F~lvDTGG~~~~~~~~~~~I~~---Q~~~Ai-~eADlIlFVVD~~~Glt~~D~~ia~~LRk~~KpvilvvNK~D~~  400 (714)
T PRK09518        325 AGRDFKLVDTGGWEADAEGIEAAIAS---QAEIAM-TLADAIVFVVDGQVGMTSTDEVIARMLQRAGKPVVLVANKIDDQ  400 (714)
T ss_pred             CCEEEEEEECCCCCCCCHHHHHHHHH---HHHHHH-HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             99169999799999883269999999---999999-96899999996897989789999999985699889999897887


Q ss_pred             CCHHHHHHHHHHHCCC-EEEEEC--CCCCCCCC
Q ss_conf             7069999999997698-899975--89813255
Q gi|254780709|r  270 ARGGGLIPIVVTHKIP-VYFLGV--GEGINDLE  299 (321)
Q Consensus       270 a~~G~~ls~~~~~~~P-i~fig~--Ge~i~Dl~  299 (321)
                      ..- ....-.|.+|.. +.+|+.  |..++||.
T Consensus       401 ~~e-~~~~ef~~LG~~e~~~ISA~Hg~G~~dLl  432 (714)
T PRK09518        401 ASE-YDVAEFWKLGLGEPYSISAMHGRGVADLL  432 (714)
T ss_pred             CCH-HHHHHHHHCCCCCCEEEECCCCCCHHHHH
T ss_conf             640-12999996599996898473578989999


No 280
>KOG1051 consensus
Probab=96.84  E-value=0.024  Score=36.82  Aligned_cols=121  Identities=17%  Similarity=0.245  Sum_probs=57.2

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH--
Q ss_conf             674123113544444247899999998522674267743451245688999997530353212235866124542289--
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF--  186 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~--  186 (321)
                      +++.-+||.||.|+|||--+-.||.++.  |-...+|..|-         ..|.+      +..-.+++|--+.+.+.  
T Consensus       589 ~~~awflflGpdgvGKt~lAkaLA~~~F--gse~~~IriDm---------se~~e------vskligsp~gyvG~e~gg~  651 (898)
T KOG1051         589 NPDAWFLFLGPDGVGKTELAKALAEYVF--GSEENFIRLDM---------SEFQE------VSKLIGSPPGYVGKEEGGQ  651 (898)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHC--CCCCCEEEECH---------HHHHH------HHHCCCCCCCCCCCHHHHH
T ss_conf             8885899978884138999999999972--88642689614---------55555------6530489955546305778


Q ss_pred             -HHH-HHHCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHCCCCC-CCCEEEEECCCCCCHHHH
Q ss_conf             -999-6514875998654333211-57789999899876302223-430112310233522577
Q gi|254780709|r  187 -KQA-QAKKVDVLIIDTAGRLHNN-SILMAGIGKMIRVLKRLDPH-APHSVLQVLDATTGQNAL  246 (321)
Q Consensus       187 -~~a-~~~~~DvvliDTAGR~~~~-~~lm~EL~ki~~v~~~~~~~-~p~~~~lVlda~~gq~~~  246 (321)
                       .++ +.+-|-|||+|-----|-+ .+.|.++-.=-|+....... .---+++||-+..|++.+
T Consensus       652 LteavrrrP~sVvLfdeIEkAh~~v~n~llq~lD~GrltDs~Gr~Vd~kN~I~IMTsn~~~~~i  715 (898)
T KOG1051         652 LTEAVKRRPYSVVLFEEIEKAHPDVLNILLQLLDRGRLTDSHGREVDFKNAIFIMTSNVGSSAI  715 (898)
T ss_pred             HHHHHHCCCCEEEEEECHHHCCHHHHHHHHHHHHCCCCCCCCCCEEECCCEEEEEECCCCHHHH
T ss_conf             8899716996599983022228889999999986274005888675046459999426316666


No 281
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]
Probab=96.82  E-value=0.0012  Score=45.82  Aligned_cols=180  Identities=19%  Similarity=0.229  Sum_probs=91.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC---C-------------------
Q ss_conf             231135444442478999999985226742677434512456889999975303532---1-------------------
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF---V-------------------  170 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~---~-------------------  170 (321)
                      ++.-.|--|||||||.|-|+.-+.+.|+||.+|-.|.       -|+.+--.+|.+-   |                   
T Consensus         5 IVvTSGKGGVGKTTttAnig~aLA~~GkKv~liD~Di-------GLRNLDlimGlE~RiVYd~vdVi~g~~~l~QALIkD   77 (272)
T COG2894           5 IVVTSGKGGVGKTTTTANIGTALAQLGKKVVLIDFDI-------GLRNLDLIMGLENRIVYDLVDVIEGEATLNQALIKD   77 (272)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHCCCEEEEEECCC-------CCHHHHHHHCCCCEEEEEEHHHHCCCCCHHHHHHCC
T ss_conf             9994488876743106778999997398599996676-------720446664342015654013444766365676403


Q ss_pred             ---------CCCCCCCCHHHH----HHHHHHHHHHCCCEEEEECC-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             ---------223586612454----22899996514875998654-3332115778999989987630222343011231
Q gi|254780709|r  171 ---------CSEIGSDAAALA----YEAFKQAQAKKVDVLIIDTA-GRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       171 ---------~~~~~~dp~~v~----~~a~~~a~~~~~DvvliDTA-GR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
                               +.....|--++-    ..-++..+..+||+||||.. |=-+--.+-|.               ..++-+.|
T Consensus        78 Kr~~nL~lLPAsQtrdKdalt~E~v~~vv~eL~~~~fDyIi~DsPAGIE~G~~~A~~---------------~Ad~AiVV  142 (272)
T COG2894          78 KRLENLFLLPASQTRDKDALTPEGVKKVVNELKAMDFDYIIIDSPAGIEQGFKNAVY---------------FADEAIVV  142 (272)
T ss_pred             CCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHH---------------CCCEEEEE
T ss_conf             567852661443236722279999999999997669988996484067788886541---------------02637997


Q ss_pred             CCCCC--CHHHHHH-----HHHHHHHCC---CCEEEEECCCC-CCCHHHHHHH---HHHHCCCEEEE-----------EC
Q ss_conf             02335--2257789-----998764358---97699965457-8706999999---99976988999-----------75
Q gi|254780709|r  237 LDATT--GQNALRQ-----VEMFHAVAG---TTGLIMTKMDG-TARGGGLIPI---VVTHKIPVYFL-----------GV  291 (321)
Q Consensus       237 lda~~--gq~~~~~-----a~~F~~~~~---~~g~I~TKlD~-ta~~G~~ls~---~~~~~~Pi~fi-----------g~  291 (321)
                      ..--.  =.|+-++     ++.+....+   --.+|+|+++- -.+-|.+||+   ...+.+|+.=|           -.
T Consensus       143 tnPEvSsVRDsDRiiGlLesk~~rae~~~~~~~~llvnR~~p~~v~~GeMlsv~Dv~~iL~i~liGiiPed~~Vi~asN~  222 (272)
T COG2894         143 TNPEVSSVRDSDRIIGLLESKSRRAEIGEEPKEHLLLNRYRPEMVKRGEMLSVEDVLEILSIPLIGVIPEDQDVLRASNK  222 (272)
T ss_pred             CCCCCCCCCCCHHHEEEHHCCCCHHHCCCCCCCEEEEECCCHHHHCCCCCCCHHHHHHHHCCCEEEEECCCHHHEEECCC
T ss_conf             48875542341122020121454233077666348997168888115772539999997477447760485333000478


Q ss_pred             CCCCCCCCCC----CHHHHHHHHCCCC
Q ss_conf             8981325557----7899999872865
Q gi|254780709|r  292 GEGINDLEPF----VAKDFSAVITGCL  314 (321)
Q Consensus       292 Ge~i~Dl~~f----~~~~~~~~llG~g  314 (321)
                      ||-+---...    .....++||+|..
T Consensus       223 GePv~l~~~~~a~~Ay~d~arRllGe~  249 (272)
T COG2894         223 GEPVILDDNSDAGKAYRDIARRLLGEE  249 (272)
T ss_pred             CCCEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             887675787517799999999970888


No 282
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=96.81  E-value=0.035  Score=35.64  Aligned_cols=154  Identities=18%  Similarity=0.143  Sum_probs=77.5

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             67412311354444424789999999852267426774345124568899999753035321223586612454228999
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~  188 (321)
                      ..|.-|.+||=.-|||.|-+=+|.    .+.+.  ++                ++.-|.       -.||..+.+     
T Consensus       450 ~~~~rIAIIGRPNVGKSTLiN~Ll----geeR~--IV----------------s~iaGT-------TRDsId~~~-----  495 (714)
T PRK09518        450 SGLRRVALVGRPNVGKSSLLNQLT----REERA--VV----------------NDLAGT-------TRDPVDEIV-----  495 (714)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHH----CCCEE--EE----------------CCCCCC-------EECEEEEEE-----
T ss_conf             677358886699887899999996----89758--85----------------688985-------023055679-----


Q ss_pred             HHHHCCCEEEEECCC---CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCCCEEEE
Q ss_conf             965148759986543---33211577899998998763022234301123102335225--7789998764358976999
Q gi|254780709|r  189 AQAKKVDVLIIDTAG---RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGTTGLIM  263 (321)
Q Consensus       189 a~~~~~DvvliDTAG---R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~~g~I~  263 (321)
                       .-++..+.||||||   |.+.+...  |--...|.++...  ..+-++||+||+.|-.  -..++..-.+.=---=+++
T Consensus       496 -~~~g~~~~lIDTAGiRkk~k~~~~i--E~~S~~rt~~aI~--~adVvllviDA~~git~QD~~Ia~~i~~~gk~~Iivv  570 (714)
T PRK09518        496 -NIDGKDWLFVDTAGIRRKQKKLTGA--EYYASLRTQAAIE--RCELALILFDASQPISEQDLRVMSMAVDAGRALVLAF  570 (714)
T ss_pred             -EECCEEEEEEECHHCCCCCCCCCCC--CHHHHHHHHHHHH--HCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             -9999789999860015244325432--2799999999886--5889999986776752899999999998599379999


Q ss_pred             ECCCCCCCHH-HHHH------HHHHHCCCEEEEEC--CCCCCCCCCC
Q ss_conf             6545787069-9999------99997698899975--8981325557
Q gi|254780709|r  264 TKMDGTARGG-GLIP------IVVTHKIPVYFLGV--GEGINDLEPF  301 (321)
Q Consensus       264 TKlD~ta~~G-~~ls------~~~~~~~Pi~fig~--Ge~i~Dl~~f  301 (321)
                      .|.|--.+-- ..+.      .......|+.|++.  |++++.|.+.
T Consensus       571 NKWDLv~~~~~~~~~~~i~~~l~~~~~apiv~iSA~~g~~v~kl~~~  617 (714)
T PRK09518        571 NKWDLMDEFRRQRLEREIDTEFDRVMWAERVNISAKTGRHTNRLARA  617 (714)
T ss_pred             ECHHCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             61430686689999999997563689998899966789788999999


No 283
>KOG2004 consensus
Probab=96.81  E-value=0.058  Score=34.09  Aligned_cols=100  Identities=24%  Similarity=0.281  Sum_probs=53.1

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE----------ECCCCCH---HH-HHHHHHHHHHHCC-----
Q ss_conf             366741231135444442478999999985226742677----------4345124---56-8899999753035-----
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA----------AGDTFRS---AA-IDQLKIWADRTSA-----  167 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lv----------a~DtfR~---aA-~eQL~~~a~~~~v-----  167 (321)
                      .+-+-.|++|+||.|||||.-.--+|.-+-++=.+.-+.          -.-||=.   |- ++-||.-+-..-+     
T Consensus       434 gs~qGkIlCf~GPPGVGKTSI~kSIA~ALnRkFfRfSvGG~tDvAeIkGHRRTYVGAMPGkiIq~LK~v~t~NPliLiDE  513 (906)
T KOG2004         434 GSVQGKILCFVGPPGVGKTSIAKSIARALNRKFFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKVKTENPLILIDE  513 (906)
T ss_pred             CCCCCCEEEEECCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCEEEECCCCHHHHHHHHHHCCCCCEEEEEH
T ss_conf             66788379986899877321899999984874699853663427764254211001488489999986177886588532


Q ss_pred             -CCCCCCCCCCCHHHHHHHHHHHHHHC---------C---CEEEEECCCCCC
Q ss_conf             -32122358661245422899996514---------8---759986543332
Q gi|254780709|r  168 -DFVCSEIGSDAAALAYEAFKQAQAKK---------V---DVLIIDTAGRLH  206 (321)
Q Consensus       168 -~~~~~~~~~dp~~v~~~a~~~a~~~~---------~---DvvliDTAGR~~  206 (321)
                       +=++.....||+|-.-+-++--++.+         +   -|++|=||-+..
T Consensus       514 vDKlG~g~qGDPasALLElLDPEQNanFlDHYLdVp~DLSkVLFicTAN~id  565 (906)
T KOG2004         514 VDKLGSGHQGDPASALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVID  565 (906)
T ss_pred             HHHHCCCCCCCHHHHHHHHCCHHHCCCHHHHCCCCCCCHHHEEEEEECCCCC
T ss_conf             2341788779868999874396535534542026642111068898536445


No 284
>pfam00025 Arf ADP-ribosylation factor family. Pfam combines a number of different Prosite families together
Probab=96.80  E-value=0.0028  Score=43.36  Aligned_cols=139  Identities=22%  Similarity=0.301  Sum_probs=68.4

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      .+++.-++++|..||||||-+-++.    . +.-.-..      |           -+|..+.         .+      
T Consensus        11 ~~k~~Ki~llG~~~vGKTsll~~~~----~-~~~~~~~------p-----------Tig~~~~---------~v------   53 (174)
T pfam00025        11 LNKEMRILILGLDNAGKTTILYKLK----L-GEIVTTI------P-----------TIGFNVE---------TV------   53 (174)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHH----C-CCCCCCC------C-----------CCCCEEE---------EE------
T ss_conf             8966699999999998899999995----4-9988744------7-----------4682389---------99------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHHHHC------CCCE
Q ss_conf             996514875998654333211577899998998763022234301123102335225778999-876435------8976
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFHAVA------GTTG  260 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~~~~------~~~g  260 (321)
                        ..+++.+.+.||||.-..     +.+.      +.+.. ..+-.++|.|++..+ .++.++ .+++.+      ++.-
T Consensus        54 --~~~~~~~~iwDt~Gqe~~-----~~~~------~~y~~-~a~~ii~V~D~t~~~-s~~~~~~~l~~~l~~~~~~~~pi  118 (174)
T pfam00025        54 --TYKNVKFTVWDVGGQESL-----RPLW------RNYFP-NTDAVIFVVDSADRD-RIEEAKEELHALLNEEELADAPL  118 (174)
T ss_pred             --EECCEEEEEEECCCCCCC-----CHHH------HHHHC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             --989999999827987023-----2679------98841-782689998678678-79999999999875423589708


Q ss_pred             -EEEECCCCC-CCH----HHHHHHHHHHCCCEEEEE----CCCCCCCC
Q ss_conf             -999654578-706----999999999769889997----58981325
Q gi|254780709|r  261 -LIMTKMDGT-ARG----GGLIPIVVTHKIPVYFLG----VGEGINDL  298 (321)
Q Consensus       261 -~I~TKlD~t-a~~----G~~ls~~~~~~~Pi~fig----~Ge~i~Dl  298 (321)
                       ++.+|.|-. +.-    -..+..-...+.++.|+.    +||+|+++
T Consensus       119 liv~NK~DL~~~~~~~ei~~~~~~~~~~~~~~~~~~~SAktG~gI~e~  166 (174)
T pfam00025       119 LILANKQDLPGAMSEAEIRELLGLHELKSRPWEIQGCSAVTGEGLDEG  166 (174)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHH
T ss_conf             998725667678999999999978644179968999988679598999


No 285
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=96.79  E-value=0.0063  Score=40.87  Aligned_cols=53  Identities=28%  Similarity=0.334  Sum_probs=28.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD  163 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~  163 (321)
                      -.++.++|+||+||||.+--+-+...........-.....+...++|++.+.+
T Consensus        21 Ge~~~iiG~nGsGKSTLl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   73 (176)
T cd03238          21 NVLVVVTGVSGSGKSTLVNEGLYASGKARLISFLPKFSRNKLIFIDQLQFLID   73 (176)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHCCHHHCCHHHCCCCCEEEHHHHHHHHH
T ss_conf             98999999999989999998887610311203210137553688577999997


No 286
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.
Probab=96.79  E-value=0.01  Score=39.34  Aligned_cols=38  Identities=34%  Similarity=0.535  Sum_probs=30.2

Q ss_pred             EEECCCC-CCCCHHHHHHHHHHHHHHC-CCCEEEEECCCC
Q ss_conf             2311354-4444247899999998522-674267743451
Q gi|254780709|r  113 VILVVGV-NGVGKTTVIGKLSKKMSDA-GLKVMLAAGDTF  150 (321)
Q Consensus       113 vil~vG~-nG~GKTTT~aKLA~~~~~~-g~kV~lva~Dtf  150 (321)
                      ||.|+|. -|+||||.+.-||+.+.++ +++|+++-.|..
T Consensus         1 vi~~~~~kGGvG~Tt~A~nlA~~la~~~~~~v~lvDldlq   40 (106)
T cd03111           1 VIAFIGAKGGVGATTLAANLAVALAKEAGRRVLLVDLDLQ   40 (106)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9899728998668999999999999841993899965467


No 287
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=96.77  E-value=0.0075  Score=40.32  Aligned_cols=142  Identities=20%  Similarity=0.173  Sum_probs=77.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHH---CCCCEE--EEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             311354444424789999999852---267426--774345124568899999753035321223586612454228999
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSD---AGLKVM--LAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~---~g~kV~--lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~  188 (321)
                      |.++|--|+||||-+-.|-+.-..   .|+ |-  --.+|.   -..||-+      ++.+..        +     +-.
T Consensus         2 iai~gH~~~GKTtL~e~lL~~~g~i~r~G~-v~~g~t~~D~---~~eE~~r------~isi~~--------~-----~~~   58 (237)
T cd04168           2 IGILAHVDAGKTTLTESLLYTSGAIRKLGS-VDKGTTRTDT---MELERQR------GITIFS--------A-----VAS   58 (237)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCHHHHCCC-EECCCCCCCC---HHHHHHH------CCEEEE--------E-----EEE
T ss_conf             899938998999999999996571222663-3068303785---4998984------870310--------5-----899


Q ss_pred             HHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHHHHHHCCCCEEEE
Q ss_conf             9651487599865433321157789999899876302223430112310233522-----57789998764358976999
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEMFHAVAGTTGLIM  263 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~F~~~~~~~g~I~  263 (321)
                      +.-+++-+-||||.|-    .+-..|...-.++        -+-.++|+||..|-     ...++++.++  +| .=+.+
T Consensus        59 ~~~~~~~~n~iDtPG~----~dF~~e~~~al~~--------~D~av~Vv~a~~Gv~~~t~~~~~~~~~~~--~P-~iifi  123 (237)
T cd04168          59 FQWEDTKVNLIDTPGH----MDFIAEVERSLSV--------LDGAILVISAVEGVQAQTRILWRLLRKLN--IP-TIIFV  123 (237)
T ss_pred             EEECCEEEEEEECCCC----HHHHHHHHHHHHH--------CCCEEEEEECCCCCCCCHHHHHHHHHHCC--CC-EEEEE
T ss_conf             9989987999889884----6566689889763--------48169999658882234499999999859--98-59986


Q ss_pred             ECCCC-CCCHH-HHHHHHHHHCCCEEEEECCC
Q ss_conf             65457-87069-99999999769889997589
Q gi|254780709|r  264 TKMDG-TARGG-GLIPIVVTHKIPVYFLGVGE  293 (321)
Q Consensus       264 TKlD~-ta~~G-~~ls~~~~~~~Pi~fig~Ge  293 (321)
                      .|||- .+..- .+-++...++..+..+....
T Consensus       124 NKmDre~adf~~~l~~i~~~l~~~~~p~~~p~  155 (237)
T cd04168         124 NKIDRAGADLEKVYQEIKEKLSSDIVPMQKVG  155 (237)
T ss_pred             ECCCCCCCCHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             24457899999999999999789747677775


No 288
>pfam04851 ResIII Type III restriction enzyme, res subunit.
Probab=96.77  E-value=0.0047  Score=41.76  Aligned_cols=59  Identities=31%  Similarity=0.329  Sum_probs=42.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      .+++.|+|+|||.+.+.++.++...++++++++   -|-   +-+.+|.+..                            
T Consensus        21 ~~i~~pTGsGKT~~~~~~i~~~~~~~~~~lvlv---p~~---~L~~Q~~~~~----------------------------   66 (103)
T pfam04851        21 GLIVMATGSGKTLTAAKLIARLLKGKKKVLFLV---PRK---DLLEQALEEF----------------------------   66 (103)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE---CCH---HHHHHHHHHH----------------------------
T ss_conf             699958999879999999999984699299990---829---9999999965----------------------------


Q ss_pred             CCEEEEECCCCCCCH
Q ss_conf             875998654333211
Q gi|254780709|r  194 VDVLIIDTAGRLHNN  208 (321)
Q Consensus       194 ~DvvliDTAGR~~~~  208 (321)
                        +|++|=+=|..-+
T Consensus        67 --lii~DE~H~~~a~   79 (103)
T pfam04851        67 --VIIIDEAHHSSAK   79 (103)
T ss_pred             --HHHHHHHHHCCCH
T ss_conf             --6460163523537


No 289
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein B; InterPro: IPR004435   The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism , .    In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which coverts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner . MoCF is the active co-factor in eukaryotic and some prokaryotic molybdoenzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdoenzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF . Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 () of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) .   The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=96.75  E-value=0.0013  Score=45.59  Aligned_cols=119  Identities=22%  Similarity=0.315  Sum_probs=70.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH---HHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             2311354444424789999999852267426774345124568899999---7530353212235866124542289999
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIW---ADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~---a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      |+-++|+-+|||||-+.+|+..|+.+|.+|+.|             |..   +....++.    .|+|.       ..+ 
T Consensus         1 v~~i~G~k~SGKTtL~~~l~~~L~~~Gy~V~~I-------------KH~ghG~H~~~~d~----~GkDs-------~rh-   55 (165)
T TIGR00176         1 VLQIVGYKNSGKTTLIERLVKALKARGYRVATI-------------KHDGHGHHDFDIDK----EGKDS-------YRH-   55 (165)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEE-------------EECCCCCCCCEECC----CCCCC-------HHH-
T ss_conf             937896258867899999999997079950898-------------60898887565279----98731-------332-


Q ss_pred             HHHCCCEEEEECCCCCCCHHHHH-HHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             65148759986543332115778-99998998763022234301123102335225778999876435897699965457
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSILM-AGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDG  268 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~lm-~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~  268 (321)
                      ..-|.|.++|=+.-|+-.=..+- .|=..+..++++..+.. .+.+|             ++-|+ ..++..+++-+-+.
T Consensus        56 r~AGA~~v~~~~~~~~~~~~~~~g~~e~~L~~~l~~~~~~~-~D~~L-------------vEGfK-~~~~pKi~~~r~~~  120 (165)
T TIGR00176        56 REAGADAVIVASSERYAVMTETQGEEELDLEALLKRLADRE-LDIIL-------------VEGFK-DSPLPKIVVIRNEA  120 (165)
T ss_pred             HHCCCCEEEEECCCEEEEEEECCCCCCCCHHHHHHHCCCCC-CCEEE-------------EECCC-CCCCCEEEEEECCC
T ss_conf             10436278866790689987528999878799986428552-68789-------------85245-57887489972675


Q ss_pred             CCC
Q ss_conf             870
Q gi|254780709|r  269 TAR  271 (321)
Q Consensus       269 ta~  271 (321)
                      ..+
T Consensus       121 ~~~  123 (165)
T TIGR00176       121 EEK  123 (165)
T ss_pred             CCC
T ss_conf             566


No 290
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=96.74  E-value=0.0035  Score=42.67  Aligned_cols=134  Identities=19%  Similarity=0.251  Sum_probs=68.9

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      -|+|+|..||||||-+-++-     .|...                      ..+|.++.    +...        ...+
T Consensus         2 KililG~~~sGKTsll~~l~-----~~~~~----------------------~~~pT~g~----~~~~--------~~~~   42 (159)
T cd04150           2 RILMVGLDAAGKTTILYKLK-----LGEIV----------------------TTIPTIGF----NVET--------VEYK   42 (159)
T ss_pred             EEEEECCCCCCHHHHHHHHH-----CCCCC----------------------CCCCCCCC----CEEE--------EEEC
T ss_conf             99999999999899999997-----29967----------------------75896870----1799--------9989


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC---CC----EEEEEC
Q ss_conf             48759986543332115778999989987630222343011231023352257789998764358---97----699965
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAG---TT----GLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~---~~----g~I~TK  265 (321)
                      ++.+.+-||+|.-...           .+.+.+.. ..+-+++|+|++--+.--+..+.|++.+.   +.    =++..|
T Consensus        43 ~~~l~iwD~~G~~~~r-----------~l~~~Y~~-~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK  110 (159)
T cd04150          43 NISFTVWDVGGQDKIR-----------PLWRHYFQ-NTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANK  110 (159)
T ss_pred             CEEEEEEECCCCCCCC-----------HHHHHHCC-CCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEEC
T ss_conf             8999999789972146-----------56786476-87389999977777899999999999962353369829999975


Q ss_pred             CCC-CCCHH----HHHHHHHHHCCCEEEEE----CCCCCCC
Q ss_conf             457-87069----99999999769889997----5898132
Q gi|254780709|r  266 MDG-TARGG----GLIPIVVTHKIPVYFLG----VGEGIND  297 (321)
Q Consensus       266 lD~-ta~~G----~~ls~~~~~~~Pi~fig----~Ge~i~D  297 (321)
                      .|- .+..-    ..+..-..-+.|..+..    +||.|++
T Consensus       111 ~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gv~e  151 (159)
T cd04150         111 QDLPNAMSAAEVTDKLGLHSLRNRNWYIQATCATSGDGLYE  151 (159)
T ss_pred             CCCCCCCCHHHHHHHHCHHHHHCCCEEEEEEECCCCCCHHH
T ss_conf             66778989999999968666637985999826867939899


No 291
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=96.74  E-value=0.013  Score=38.55  Aligned_cols=82  Identities=28%  Similarity=0.377  Sum_probs=40.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHH-HHHCCCCE-----EEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             412311354444424789999999-85226742-----677434512456889999975303532122358661245422
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKK-MSDAGLKV-----MLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE  184 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~-~~~~g~kV-----~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~  184 (321)
                      |.=|++=||.|||||| +|.||-- -|+...++     -+|--|-      --||.==+-+.-|+.++-+  ||.   |+
T Consensus       176 PQHiiLYGPPGVGKTT-aARl~LEe~K~~~~tPF~~DA~FvEVDG------tTLRWDPREvTNPLLGSVH--DPI---YQ  243 (616)
T TIGR02903       176 PQHIILYGPPGVGKTT-AARLALEEAKKLKNTPFAEDAPFVEVDG------TTLRWDPREVTNPLLGSVH--DPI---YQ  243 (616)
T ss_pred             CCCEEEECCCCCCHHH-HHHHHHHHCCCCCCCCCCCCCCEEEECC------CCCCCCCCCCCCCCCCCCC--CCC---CC
T ss_conf             6607855733884789-9999876213687447611378575157------6266774101477677625--765---56


Q ss_pred             HHHH--HH-------------HHCCCEEEEECCCCC
Q ss_conf             8999--96-------------514875998654333
Q gi|254780709|r  185 AFKQ--AQ-------------AKKVDVLIIDTAGRL  205 (321)
Q Consensus       185 a~~~--a~-------------~~~~DvvliDTAGR~  205 (321)
                      +-..  |.             ++| -|++||=-|=|
T Consensus       244 Ga~RDLAE~GvPEPk~GLVT~AHG-GvLFIDEIGEL  278 (616)
T TIGR02903       244 GARRDLAETGVPEPKLGLVTDAHG-GVLFIDEIGEL  278 (616)
T ss_pred             CCCHHHCCCCCCCCCCCCCCCCCC-CEEEEECHHHH
T ss_conf             764011047879898987100477-56765021122


No 292
>pfam09439 SRPRB Signal recognition particle receptor beta subunit. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Probab=96.74  E-value=0.0063  Score=40.87  Aligned_cols=98  Identities=20%  Similarity=0.281  Sum_probs=52.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .|+++||.|+||||-..+|..     |+.+-                         .+.+..   |. +..   .+...+
T Consensus         5 tvLllGl~~sGKT~Lf~~L~~-----~~~~~-------------------------T~tS~~---~n-~~~---~~~~~~   47 (181)
T pfam09439         5 AVIIAGLCDSGKTSLFTLLTT-----GSVRK-------------------------TVTSQE---PS-AAY---KYMNNK   47 (181)
T ss_pred             EEEEECCCCCCHHHHHHHHHC-----CCCCC-------------------------EECCCC---CC-CEE---EEECCC
T ss_conf             699986899989999999975-----99487-------------------------588867---86-406---875168


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-HHHHHHHHHHHHC
Q ss_conf             487599865433321157789999899876302223430112310233522-5778999876435
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-NALRQVEMFHAVA  256 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-~~~~~a~~F~~~~  256 (321)
                      +..+-+||+.|.-.....+++.+...         ..-.-+++|+|+.+-+ +..+.|+..++.+
T Consensus        48 ~~~~~lvD~PGh~klR~~~~~~~~~~---------~~~~gIVfVVDS~~~~~~l~~~Ae~Ly~iL  103 (181)
T pfam09439        48 GNSLTLIDFPGHVKLRYKLLETLKDS---------SSLRGLVFVVDSTAFPKEVTDTAEFLYDIL  103 (181)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHH---------CCCEEEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             96689998899689999999864300---------264499999978665667999999999998


No 293
>PRK00698 tmk thymidylate kinase; Validated
Probab=96.72  E-value=0.0054  Score=41.30  Aligned_cols=47  Identities=28%  Similarity=0.515  Sum_probs=35.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCCCHHHHHHHHHHH
Q ss_conf             2311354444424789999999852267426774--3451245688999997
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAA--GDTFRSAAIDQLKIWA  162 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva--~DtfR~aA~eQL~~~a  162 (321)
                      .|.|-|+-||||||-+.+|+.++..+|.+|.+..  .+|   -.-+.++.+.
T Consensus         5 fIviEGiDGsGKsTq~~~L~~~L~~~g~~v~~t~eP~~t---~~g~~ir~~~   53 (204)
T PRK00698          5 FITIEGIDGAGKSTQIELLAERLEEQGRDVVFTREPGGT---PLGEKLRELL   53 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC---CHHHHHHHHH
T ss_conf             999988999989999999999999679978998699998---0699999998


No 294
>KOG0926 consensus
Probab=96.70  E-value=0.014  Score=38.43  Aligned_cols=129  Identities=23%  Similarity=0.297  Sum_probs=82.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHH--HH-HCCCCE-EEEECCCCCHHHHHHHHHHHHHHCC-C--C-C----CCCCCCCCHH
Q ss_conf             2311354444424789999999--85-226742-6774345124568899999753035-3--2-1----2235866124
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKK--MS-DAGLKV-MLAAGDTFRSAAIDQLKIWADRTSA-D--F-V----CSEIGSDAAA  180 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~--~~-~~g~kV-~lva~DtfR~aA~eQL~~~a~~~~v-~--~-~----~~~~~~dp~~  180 (321)
                      |+.++|-+||||||-+--.-+-  |. .+--+. ++.-+-.-|.||+---+-.|.-+++ +  | |    -+..+.| .+
T Consensus       273 vvIIcGeTGsGKTTQvPQFLYEAGf~s~~~~~~gmIGITqPRRVAaiamAkRVa~EL~~~~~eVsYqIRfd~ti~e~-T~  351 (1172)
T KOG0926         273 VVIICGETGSGKTTQVPQFLYEAGFASEQSSSPGMIGITQPRRVAAIAMAKRVAFELGVLGSEVSYQIRFDGTIGED-TS  351 (1172)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCC-CE
T ss_conf             49995488888644341899871347766799870540572278999999999998525764114899853656887-40


Q ss_pred             HHH--------HHHHHHHHHCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHHCCCCCCC---CEEEEECCCCCC
Q ss_conf             542--------28999965148759986543-332115778999989987630222343---011231023352
Q gi|254780709|r  181 LAY--------EAFKQAQAKKVDVLIIDTAG-RLHNNSILMAGIGKMIRVLKRLDPHAP---HSVLQVLDATTG  242 (321)
Q Consensus       181 v~~--------~a~~~a~~~~~DvvliDTAG-R~~~~~~lm~EL~ki~~v~~~~~~~~p---~~~~lVlda~~g  242 (321)
                      |-|        +-..-+....|.+||||-|- |+-|-.-|+.=|..|.+.-.+......   -..+..++||..
T Consensus       352 IkFMTDGVLLrEi~~DflL~kYSvIIlDEAHERSvnTDILiGmLSRiV~LR~k~~ke~~~~kpLKLIIMSATLR  425 (1172)
T KOG0926         352 IKFMTDGVLLREIENDFLLTKYSVIILDEAHERSVNTDILIGMLSRIVPLRQKYYKEQCQIKPLKLIIMSATLR  425 (1172)
T ss_pred             EEEECCHHHHHHHHHHHHHHHCEEEEECHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEE
T ss_conf             47740238899988767554201578512543031278999999887788899766413567616999741477


No 295
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=96.70  E-value=0.0052  Score=41.46  Aligned_cols=154  Identities=18%  Similarity=0.239  Sum_probs=76.2

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEE-EECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             3113544444247899999998522674267-743451245688999997530353212235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVML-AAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~l-va~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      +.++|--++||||-+..|-+.-..-...-.. -..|+..   .||     + -|+.+-     ..++.+.+   ...+.+
T Consensus         3 iaiiGHvd~GKTTL~~~ll~~tg~i~~~~~~~~~~D~~~---~E~-----e-RgiTi~-----~~~~~~~~---~~~~~~   65 (179)
T cd01890           3 FSIIAHIDHGKSTLADRLLELTGTVSKREMKEQVLDSMD---LER-----E-RGITIK-----AQTVRLNY---KAKDGQ   65 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEECCCCH---HHH-----H-CCCEEE-----EEEEEEEE---ECCCCC
T ss_conf             999948998989999999998599541457324416517---678-----6-386687-----43368884---136787


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             4875998654333211577899998998763022234301123102335225-----77899987643589769996545
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFHAVAGTTGLIMTKMD  267 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~~~~~~~g~I~TKlD  267 (321)
                      .|-+-+|||.|.  -|  ...|...   .+.     .-+-.+||+||..|-.     ....+..++  +++ =++++|+|
T Consensus        66 ~~~in~iDtPGh--~d--F~~~~~~---al~-----~~D~allVVda~~Gv~~qT~~~~~~a~~~~--~p~-ivviNKiD  130 (179)
T cd01890          66 EYLLNLIDTPGH--VD--FSYEVSR---SLA-----ACEGALLLVDATQGVEAQTLANFYLALENN--LEI-IPVINKID  130 (179)
T ss_pred             CEEEEEEECCCC--CC--CHHHHHH---HHH-----HHCEEEEEEECCCCCCHHHHHHHHHHHHCC--CCE-EEEEECCC
T ss_conf             148999989986--45--1778988---997-----544278998647787374899999998769--988-99986555


Q ss_pred             C-CCCHHHHHHHH-HHHCC---CEEEEEC--CCCCCCCC
Q ss_conf             7-87069999999-99769---8899975--89813255
Q gi|254780709|r  268 G-TARGGGLIPIV-VTHKI---PVYFLGV--GEGINDLE  299 (321)
Q Consensus       268 ~-ta~~G~~ls~~-~~~~~---Pi~fig~--Ge~i~Dl~  299 (321)
                      - .+..-.++.-. ..+++   |+.+++.  |++++||.
T Consensus       131 ~~~ad~~~v~~~i~~~~g~~~~~~v~vSA~~g~gv~~Ll  169 (179)
T cd01890         131 LPSADPERVKQQIEDVLGLDPSEAILVSAKTGLGVEDLL  169 (179)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHH
T ss_conf             677899999999999868897674884378897989999


No 296
>TIGR00101 ureG urease accessory protein UreG; InterPro: IPR004400 This is a GTP hydrolase for assembly of the nickel metallocentre of urease. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel. They play a central role in nitrogen metabolism.; GO: 0005524 ATP binding, 0016151 nickel ion binding.
Probab=96.66  E-value=0.027  Score=36.45  Aligned_cols=159  Identities=20%  Similarity=0.323  Sum_probs=107.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC-------HHHHHHHH
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661-------24542289
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA-------AALAYEAF  186 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp-------~~v~~~a~  186 (321)
                      |-+.||-|+|||.-+-+|...+.+ .+.+++++-|.|----.+-|-...-...-.+++.+.|.-|       +++-..|+
T Consensus         4 iG~~GPvG~Gktal~e~l~~~~~~-~y~~av~tndiyt~eda~fl~~~~~l~~~ri~GvetGGCPhtairedas~nl~a~   82 (199)
T TIGR00101         4 IGVAGPVGSGKTALIEALTRELAK-KYDLAVITNDIYTQEDAEFLVKNSVLPPERILGVETGGCPHTAIREDASLNLEAV   82 (199)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHH-CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             665047776468999999998874-0667787311001246888876412662226774158987300100021218899


Q ss_pred             HHHHHH--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-HCCCCEEEE
Q ss_conf             999651--48759986543332115778999989987630222343011231023352257789998764-358976999
Q gi|254780709|r  187 KQAQAK--KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA-VAGTTGLIM  263 (321)
Q Consensus       187 ~~a~~~--~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~-~~~~~g~I~  263 (321)
                      +....+  ..|+++|..-|-     ||          ...+.|.-.+-+++|+|...|...-+.   -.. ...-+=+++
T Consensus        83 ~~~~~rf~~~~~~~~esGGd-----nl----------~atf~P~l~d~t~~vidva~G~kiPrk---GGPGit~sdllvi  144 (199)
T TIGR00101        83 EELEARFPDLELVFIESGGD-----NL----------SATFSPELADLTIFVIDVAEGDKIPRK---GGPGITRSDLLVI  144 (199)
T ss_pred             HHHHHCCCCEEEEEEECCCC-----CC----------EEECCCCEEEEEEEEEEECCCCCCCCC---CCCCCCCHHEEEE
T ss_conf             98862156404899832886-----20----------000276402367889972058745677---8898530012243


Q ss_pred             ECCCCCCCHHHHHHHHH------HHCCCEEEEEC
Q ss_conf             65457870699999999------97698899975
Q gi|254780709|r  264 TKMDGTARGGGLIPIVV------THKIPVYFLGV  291 (321)
Q Consensus       264 TKlD~ta~~G~~ls~~~------~~~~Pi~fig~  291 (321)
                      .|.|=..-.|+-|++..      +...|..|.-.
T Consensus       145 nk~dlaP~vGadl~~m~rd~~~mr~~~Pf~ftn~  178 (199)
T TIGR00101       145 NKIDLAPFVGADLKVMERDAKKMRGEKPFIFTNL  178 (199)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEHH
T ss_conf             2001253112303544356786406997466400


No 297
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.66  E-value=0.0026  Score=43.55  Aligned_cols=56  Identities=16%  Similarity=0.204  Sum_probs=35.3

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             12311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      ..+.++|+||+||||.+-=|+-.++-..-+|.+-..+......-..++.+..++|+
T Consensus        33 e~vaiiG~nGsGKSTLl~~l~Gll~p~~G~V~~~~~~i~~~~~~~~~~~~~~~vG~   88 (288)
T PRK13643         33 SYTALIGHTGSGKSTLLQHLNGLLQPTEGKVTVGDIVVSSTSKQKEIKPVRKKVGV   88 (288)
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHHCEEE
T ss_conf             89999999994799999999748888885699999985687735447987751799


No 298
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=96.65  E-value=0.015  Score=38.14  Aligned_cols=135  Identities=8%  Similarity=0.110  Sum_probs=71.3

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      ..+.+.|+.|+|||.=+-=+|+.+...++++..+++..+.---.+-++.                              .
T Consensus        39 ~~l~i~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~~~~~~~~~~~~l~~------------------------------l   88 (226)
T TIGR03420        39 RFLYLWGESGSGKSHLLQAACAAAEERGKSAIYLPLAELAQADPEVLEG------------------------------L   88 (226)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHH------------------------------C
T ss_conf             8699989999988999999999986269957995299987753999972------------------------------7


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHH-----HHHHHHHHCCCCEEEEECC
Q ss_conf             14875998654333211577899998998763022234301123102335225778-----9998764358976999654
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR-----QVEMFHAVAGTTGLIMTKM  266 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~-----~a~~F~~~~~~~g~I~TKl  266 (321)
                      +++|+++||-.-++..+...-.+|=.+.+.+.   .   ....+++.|...-...+     -.-.|..   .--+=+-..
T Consensus        89 ~~~d~l~iDDi~~i~~~~~~e~~lF~l~N~~~---~---~~~~ilits~~~p~~l~~~l~dL~SRl~~---~~~~~I~~p  159 (226)
T TIGR03420        89 EQADLVCLDDVEAIAGQPEWQEALFHLYNRVR---E---AGGRLLIAGRAAPAQLPLRLPDLRTRLAW---GLVFQLPPL  159 (226)
T ss_pred             CCCCEEEEECHHHHCCCHHHHHHHHHHHHHHH---H---HCCEEEEECCCCHHHCCCCHHHHHHHHHC---CCEEECCCC
T ss_conf             44899999663334378378999999999998---6---52828986788823203201779999968---856852799


Q ss_pred             CCCCCHHHHHHHHHHHCCC
Q ss_conf             5787069999999997698
Q gi|254780709|r  267 DGTARGGGLIPIVVTHKIP  285 (321)
Q Consensus       267 D~ta~~G~~ls~~~~~~~P  285 (321)
                      |...+-.++...+..-++.
T Consensus       160 dd~~~~~iL~k~~~~r~i~  178 (226)
T TIGR03420       160 SDEEKIAALQSRAARRGLQ  178 (226)
T ss_pred             CHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999985998


No 299
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=96.65  E-value=0.0077  Score=40.23  Aligned_cols=139  Identities=21%  Similarity=0.136  Sum_probs=74.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCC--CE--EEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             311354444424789999999852267--42--67743451245688999997530353212235866124542289999
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGL--KV--MLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~--kV--~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      |.++|-.|+||||-+=.|.+.-..-++  +|  .--.+|.-   ..|+-      =++.+..        +     +-.+
T Consensus         2 iai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~---~eE~~------R~isi~~--------~-----~~~~   59 (270)
T cd01886           2 IGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFM---EQERE------RGITIQS--------A-----ATTC   59 (270)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCC---HHHHH------CCCEEEC--------C-----EEEE
T ss_conf             89996899998899999998668735581553897556684---88987------6870733--------6-----6899


Q ss_pred             HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHHHHCCCCEEEEE
Q ss_conf             6514875998654333211577899998998763022234301123102335225-----77899987643589769996
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFHAVAGTTGLIMT  264 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~~~~~~~g~I~T  264 (321)
                      .-+++-+-||||.|-    .+-..|...-.++        -+-.++|+||..|-.     ..++++.++  +| .=+.++
T Consensus        60 ~w~~~~inliDTPG~----~DF~~e~~~aL~~--------~D~AviVv~a~~GVe~~T~~~w~~~~~~~--lP-~i~fIN  124 (270)
T cd01886          60 FWKDHRINIIDTPGH----VDFTIEVERSLRV--------LDGAVAVFDAVAGVEPQTETVWRQADRYN--VP-RIAFVN  124 (270)
T ss_pred             EECCEEEEEEECCCC----HHHHHHHHHHHHH--------HCEEEEEEECCCCHHHHHHHHHHHHHHCC--CC-EEEEEE
T ss_conf             989989999869696----7889999999877--------55599998467644263699998899849--99-899998


Q ss_pred             CCCC-CCCHH-HHHHHHHHHCCCEEEE
Q ss_conf             5457-87069-9999999976988999
Q gi|254780709|r  265 KMDG-TARGG-GLIPIVVTHKIPVYFL  289 (321)
Q Consensus       265 KlD~-ta~~G-~~ls~~~~~~~Pi~fi  289 (321)
                      |||- .+..- .+-++...++.++.-+
T Consensus       125 KmDre~ad~~~~l~~i~~~lg~~~vp~  151 (270)
T cd01886         125 KMDRTGADFFRVVEQIREKLGANPVPL  151 (270)
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCEEEE
T ss_conf             878778871668999999858973889


No 300
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=96.64  E-value=0.011  Score=39.22  Aligned_cols=137  Identities=19%  Similarity=0.262  Sum_probs=69.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      .++-.-|+++|+.||||||-+.+|.     .+...--                      +|.++.    +...+      
T Consensus         6 ~kk~~kililG~~~sGKTsil~~l~-----~~~~~~~----------------------~pTvg~----~~~~~------   48 (168)
T cd04149           6 GNKEMRILMLGLDAAGKTTILYKLK-----LGQSVTT----------------------IPTVGF----NVETV------   48 (168)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHH-----CCCCCCC----------------------CCCCCC----EEEEE------
T ss_conf             7888899999999999899999996-----6998760----------------------262670----07999------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHCC---CC----
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899-98764358---97----
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVAG---TT----  259 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~~---~~----  259 (321)
                        ..+++.+.+-||+|.-... .+.          +.+.. ..+-+++|+|++-.+ .+..+ +.|++.+.   +.    
T Consensus        49 --~~~~~~l~iwD~~Gqe~~r-~l~----------~~y~~-~~~~iifVvDstd~~-~~~~~~~~l~~~l~~~~~~~~pi  113 (168)
T cd04149          49 --TYKNVKFNVWDVGGQDKIR-PLW----------RHYYT-GTQGLIFVVDSADRD-RIDEARQELHRIINDREMRDALL  113 (168)
T ss_pred             --EECCEEEEEEECCCCCCCC-CHH----------HHHCC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHHCHHHCCCEE
T ss_conf             --9898899999899997466-065----------76437-886689998377678-99999999999971452279869


Q ss_pred             EEEEECCCCC-CCH----HHHHHHHHHHCCCEEEEE----CCCCCC
Q ss_conf             6999654578-706----999999999769889997----589813
Q gi|254780709|r  260 GLIMTKMDGT-ARG----GGLIPIVVTHKIPVYFLG----VGEGIN  296 (321)
Q Consensus       260 g~I~TKlD~t-a~~----G~~ls~~~~~~~Pi~fig----~Ge~i~  296 (321)
                      =++..|.|-. +..    -..+......+.|..++.    +||.|+
T Consensus       114 lI~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gv~  159 (168)
T cd04149         114 LVFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLY  159 (168)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHCHHHHHCCCCEEEEEECCCCCCHH
T ss_conf             9999756677788999999997876551798099980687896979


No 301
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348   This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.    In Escherichia coli an anion-translocating ATPase has been identified as the product of the arsenical resistance operon of resistance plasmid R773. This ATP-driven oxyanion pump catalyses extrusion of the oxyanions arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two polypeptides, the products of the arsA and arsB genes. This two-subunit enzyme produces resistance to arsenite and antimonite. A third gene, arsC, expands the substrate specificity to allow for arsenate pumping and resistance .   The ArsA and ArsB proteins form a membrane-bound pump that functions as an oxyanion-translocating ATPase. The ArsC protein is an arsenate reductase that reduces arsenate to arsenite, which is subsequently pumped out of the cell .; GO: 0005524 ATP binding, 0006820 anion transport, 0016020 membrane.
Probab=96.64  E-value=0.0019  Score=44.52  Aligned_cols=35  Identities=34%  Similarity=0.571  Sum_probs=30.5

Q ss_pred             ECCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCC
Q ss_conf             113544444247899999998522--67426774345
Q gi|254780709|r  115 LVVGVNGVGKTTVIGKLSKKMSDA--GLKVMLAAGDT  149 (321)
Q Consensus       115 l~vG~nG~GKTTT~aKLA~~~~~~--g~kV~lva~Dt  149 (321)
                      +|-|==||||||..|=.|-|+..+  ||||+||++|-
T Consensus         1 f~gGKGGVGKTt~SaAtA~~lAe~qPGkkvLl~STDP   37 (330)
T TIGR00345         1 FFGGKGGVGKTTISAATAIRLAEQQPGKKVLLVSTDP   37 (330)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             9778788238889999999998518997799984086


No 302
>TIGR01188 drrA daunorubicin resistance ABC transporter, ATP-binding protein; InterPro: IPR005894   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains the daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. In other words it functions as an ATP dependent antiporter. .
Probab=96.63  E-value=0.001  Score=46.39  Aligned_cols=45  Identities=29%  Similarity=0.325  Sum_probs=35.0

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             741231135444442478999999985226742677434512456
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
                      +-.|+-|.||||+||||||-=|+-.++=.+=+.-+.--|.-|=++
T Consensus        20 ~G~vfGfLGPNGAGKTTti~mLtTll~P~sG~A~V~GYDvvreP~   64 (343)
T TIGR01188        20 EGEVFGFLGPNGAGKTTTIRMLTTLLKPTSGTARVAGYDVVREPR   64 (343)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEEEEEECCCCHH
T ss_conf             624899768799851335634102557998768998321023630


No 303
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=96.63  E-value=0.017  Score=37.80  Aligned_cols=51  Identities=20%  Similarity=0.177  Sum_probs=32.1

Q ss_pred             EECCCCCCCCHHHHHHHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             311354444424789999999-852-26742677434512456889999975303
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKK-MSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTS  166 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~-~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~  166 (321)
                      +++++|+|+|||++..-.+.. +.. +++++++ -+.| |+-+.+|.+.+....+
T Consensus         3 ~lv~~ptGsGKT~~~~~~~~~~~~~~~~~~~li-l~Pt-~~L~~q~~~~~~~~~~   55 (144)
T cd00046           3 VLLAAPTGSGKTLAALLPILELLDSLKGGQVLV-LAPT-RELANQVAERLKELFG   55 (144)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEE-ECCH-HHHHHHHHHHHHHHCC
T ss_conf             999889971799999999999997568976999-7467-9999999999999748


No 304
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=96.61  E-value=0.015  Score=38.12  Aligned_cols=133  Identities=17%  Similarity=0.229  Sum_probs=66.4

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+++|..||||||-+-++...    ...      .+ -           --+|+.+.         .+        .-++
T Consensus         2 i~ilG~~~vGKTsll~~l~~~----~~~------~~-~-----------pTig~~~~---------~i--------~~~~   42 (158)
T cd00878           2 ILILGLDGAGKTTILYKLKLG----EVV------TT-I-----------PTIGFNVE---------TV--------EYKN   42 (158)
T ss_pred             EEEECCCCCCHHHHHHHHHCC----CCC------CC-C-----------CEECCCEE---------EE--------EECC
T ss_conf             999999999889999999539----988------74-4-----------56074089---------99--------8488


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHHHHC---C---CC-EEEEEC
Q ss_conf             875998654333211577899998998763022234301123102335225778999-876435---8---97-699965
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFHAVA---G---TT-GLIMTK  265 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~~~~---~---~~-g~I~TK  265 (321)
                      +.+.+.||+|.-.     ++.+.+.      +. ...+-+++|.|++-- +.++.++ .+++.+   .   +- =++.+|
T Consensus        43 ~~l~iwDt~G~~~-----~~~~~~~------y~-~~a~~~i~V~D~t~~-~s~~~~~~~~~~~~~~~~~~~~piliv~NK  109 (158)
T cd00878          43 VSFTVWDVGGQDK-----IRPLWKH------YY-ENTNGIIFVVDSSDR-ERIEEAKEELHKLLNEEELKGVPLLIFANK  109 (158)
T ss_pred             EEEEEEECCCCCC-----CCHHHHH------HH-CCCCEEEEEEECCCH-HHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             9999998899722-----1448998------72-768776899837988-899999999999986605576538987605


Q ss_pred             CCCCC-----CHHHHHHHHHHHCCCEEEEE----CCCCCCCC
Q ss_conf             45787-----06999999999769889997----58981325
Q gi|254780709|r  266 MDGTA-----RGGGLIPIVVTHKIPVYFLG----VGEGINDL  298 (321)
Q Consensus       266 lD~ta-----~~G~~ls~~~~~~~Pi~fig----~Ge~i~Dl  298 (321)
                      .|-..     ..-..+..-...+.|+.|+.    +||+|++.
T Consensus       110 ~Dl~~~~~~~ei~~~l~~~~~~~~~~~~~~~SAktg~gI~e~  151 (158)
T cd00878         110 QDLPGALSVSELIEKLGLEKILGRRWHIQPCSAVTGDGLDEG  151 (158)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHH
T ss_conf             476657899999999858751079989999988879298999


No 305
>PRK05917 DNA polymerase III subunit delta'; Validated
Probab=96.60  E-value=0.016  Score=38.06  Aligned_cols=128  Identities=13%  Similarity=0.127  Sum_probs=68.1

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCC-CCCC---CCHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122-3586---6124542
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCS-EIGS---DAAALAY  183 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~-~~~~---dp~~v~~  183 (321)
                      ..-|+-++|.||.|+||+|++-.+|..+..++..     +..++         .+...--+++.. +.+.   .....+.
T Consensus        16 ~Rl~HAyLf~Gp~G~GK~~~A~~~A~~LLc~~~p-----~~~~~---------i~~~~HPD~~~i~pe~k~~~~~Id~iR   81 (290)
T PRK05917         16 QKVPSAILLHGQDLSNLSQYAYELASLILLESSP-----EAQYK---------ISQKIHPDIHEFFPEGKGRLHSIETPR   81 (290)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCC-----CHHHH---------HHHCCCCCEEEECCCCCCCCCCHHHHH
T ss_conf             9966068768999865999999999998578996-----16889---------874689985996157778878678999


Q ss_pred             HHHHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             2899996----51487599865433321157789999899876302223430112310233522577899987643589
Q gi|254780709|r  184 EAFKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGT  258 (321)
Q Consensus       184 ~a~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~  258 (321)
                      +-.....    ..++-|++||-|-||.....  +-|       =|..+..|..+++.+=++.-+.....+..=++.+.+
T Consensus        82 ~l~~~i~~~p~~g~~KV~IId~Ad~Mn~~Aa--NAL-------LKtLEEPP~~tvfILit~~~~~lLpTI~SRCQ~I~i  151 (290)
T PRK05917         82 AIKKQIWIHPYEANYKIYIIHEADRMTLDAI--SAF-------LKVLEDPPKHSVIILTSAKPQRLPPTIRSRSLSIHI  151 (290)
T ss_pred             HHHHHHCCCCCCCCCEEEEECCHHHHCHHHH--HHH-------HHHHCCCCCCEEEEEEECCHHHCCHHHHHCCCEEEC
T ss_conf             9999964186468826999756776389999--999-------997347987859999869925482377633511677


No 306
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=96.59  E-value=0.01  Score=39.44  Aligned_cols=134  Identities=22%  Similarity=0.295  Sum_probs=71.0

Q ss_pred             CCCCCE-EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCC--CCC-------
Q ss_conf             667412-3113544444247899999998522674267743451245688999997530353212235--866-------
Q gi|254780709|r  108 SHRPHV-ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI--GSD-------  177 (321)
Q Consensus       108 ~~~p~v-il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~--~~d-------  177 (321)
                      ..+|++ |.++|=--+||||.++-|.+...            .......++++..++..|-+-+.-..  ...       
T Consensus         3 ~~K~~l~i~~~GhVD~GKSTL~G~Ll~~~g------------~~~~~~~~~~~~~~~~~g~~s~~~a~~~D~~~eEr~rG   70 (426)
T PRK12317          3 KEKPHLNLAVIGHVDHGKSTLVGRLLYETG------------AVDEHIIEEYEEEAKKKGKESFKFAWVMDRLKEERERG   70 (426)
T ss_pred             CCCCEEEEEEEEECCCCHHHHHHHHHHHCC------------CCCHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCC
T ss_conf             989784999995228768888768987729------------94489999999899864877521432125786687558


Q ss_pred             -CHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC--CHH--HHHHHHHH
Q ss_conf             -1245422899996514875998654333211577899998998763022234301123102335--225--77899987
Q gi|254780709|r  178 -AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT--GQN--ALRQVEMF  252 (321)
Q Consensus       178 -p~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~--gq~--~~~~a~~F  252 (321)
                       ...+++   .++...++.+.+||++|.-..=.|++.-            ...+|-.+||+||.-  |-.  -.+.+.. 
T Consensus        71 iTid~~~---~~f~~~~~~~~iiD~PGH~~fi~nmi~G------------as~~D~ailvV~A~~~~G~~~QT~eHl~l-  134 (426)
T PRK12317         71 VTIDLAH---KKFETDKYYFTIIDCPGHRDFVKNMITG------------ASQADAAVLVVSARDAGGVMPQTREHVFL-  134 (426)
T ss_pred             CEEEEEE---EEEECCCCEEEEEECCCCHHHHHHHHHH------------HCCCCEEEEEEECCCCCCCCHHHHHHHHH-
T ss_conf             2788316---9995498169998789636678778745------------34677279999636566764778999999-


Q ss_pred             HHHCCCCEE--EEECCCCC
Q ss_conf             643589769--99654578
Q gi|254780709|r  253 HAVAGTTGL--IMTKMDGT  269 (321)
Q Consensus       253 ~~~~~~~g~--I~TKlD~t  269 (321)
                      ...+++..+  .+||||-.
T Consensus       135 ~~~lgi~~iiV~vnKmD~v  153 (426)
T PRK12317        135 ARTLGINQLIVAINKMDAV  153 (426)
T ss_pred             HHHHCCCEEEEEEECCCCC
T ss_conf             9980998399999533356


No 307
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.57  E-value=0.0036  Score=42.56  Aligned_cols=57  Identities=16%  Similarity=0.168  Sum_probs=38.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             412311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      -..+.++|+||+||||.+-=|+-.++-..-+|.+-..|...-.--..++.+..++|+
T Consensus        33 Ge~~aiiG~nGsGKSTLl~~l~GLl~p~~G~I~~~g~~i~~~~~~~~~~~~r~~ig~   89 (286)
T PRK13646         33 GKYYAIVGQTGSGKSTLIQNINALLKPTTGTVTVDDITITHKTKDKYIRPVRKRIGM   89 (286)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHHCEEE
T ss_conf             989999999998199999999707888887599998987555746789998740899


No 308
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=96.57  E-value=0.0081  Score=40.09  Aligned_cols=139  Identities=17%  Similarity=0.246  Sum_probs=69.6

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      .++-.-|+++|+.||||||-+-++.    . |.-.                      ..+|.++.    +...       
T Consensus        14 ~kk~~kililGl~~sGKTsil~~l~----~-~~~~----------------------~~~pTvg~----~~~~-------   55 (182)
T PTZ00133         14 GKKEVRILMVGLDAAGKTTILYKLK----L-GEVV----------------------TTIPTIGF----NVET-------   55 (182)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHH----C-CCCC----------------------CCCCCCCC----CEEE-------
T ss_conf             7874799999679988999999996----2-9977----------------------73786884----5699-------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHC---CCCE---
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899-9876435---8976---
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVA---GTTG---  260 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~---~~~g---  260 (321)
                       ...+++.+.+-||||.-.. ..+          .+.+.. ..+-+++|+|++--+ .++.+ ..+++.+   .+.+   
T Consensus        56 -~~~~~~~l~iwD~~Gqe~~-r~l----------w~~yy~-~~~giI~VvD~sd~~-~~~~~~~~l~~~l~~~~~~~~pi  121 (182)
T PTZ00133         56 -VEYKNLKFTMWDVGGQDKL-RPL----------WRHYYQ-NTNGIIFVVDSNDRE-RIGDARQELEKMLAEDELRNAVL  121 (182)
T ss_pred             -EEECCEEEEEEECCCCCCC-CHH----------HHHCCC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHCCHHHCCCEE
T ss_conf             -9978889999989998454-747----------876056-764499999667878-99999999999971442248859


Q ss_pred             -EEEECCCCCC-CH-H---HHHHHHHHHCCCEEEEE----CCCCCCCC
Q ss_conf             -9996545787-06-9---99999999769889997----58981325
Q gi|254780709|r  261 -LIMTKMDGTA-RG-G---GLIPIVVTHKIPVYFLG----VGEGINDL  298 (321)
Q Consensus       261 -~I~TKlD~ta-~~-G---~~ls~~~~~~~Pi~fig----~Ge~i~Dl  298 (321)
                       ++..|.|-.. .. .   ..+.+....+.+..|..    +||.|++.
T Consensus       122 Li~~NK~Dl~~a~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gi~e~  169 (182)
T PTZ00133        122 LVFANKQDLPNAMSTTEVTEKLGLHSVRQRNWYIQGCCATTAQGLYEG  169 (182)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHCHHHHHCCCCEEEEEECCCCCCHHHH
T ss_conf             999706687788899999999695556159958998257589498999


No 309
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=96.57  E-value=0.0086  Score=39.90  Aligned_cols=147  Identities=18%  Similarity=0.252  Sum_probs=75.2

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+|+|+.||||||-+.+|.    ...          |..             -+|.++.+.    ..+        ..++
T Consensus         2 IlilGl~~sGKTtil~~l~----~~~----------~~~-------------~~pT~G~~~----~~i--------~~~~   42 (169)
T cd04158           2 VVTLGLDGAGKTTILFKLK----QDE----------FMQ-------------PIPTIGFNV----ETV--------EYKN   42 (169)
T ss_pred             EEEECCCCCCHHHHHHHHH----CCC----------CCC-------------CCCCCCCCE----EEE--------EECC
T ss_conf             9999989998899999995----799----------689-------------778688166----999--------9898


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHHHHC---CCCE----EEEEC
Q ss_conf             875998654333211577899998998763022234301123102335225778999-876435---8976----99965
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFHAVA---GTTG----LIMTK  265 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~~~~---~~~g----~I~TK  265 (321)
                      +.+.+-||+|+-.. ..+          .+.+.. ..+-+++|+|++- .+.++.++ .+++.+   .+.+    ++..|
T Consensus        43 ~~l~iwD~gG~~~~-r~~----------w~~Yy~-~~~~iIfVvDssd-~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK  109 (169)
T cd04158          43 LKFTIWDVGGKHKL-RPL----------WKHYYL-NTQAVVFVVDSSH-RDRVSEAHSELAKLLTEKELRDALLLIFANK  109 (169)
T ss_pred             EEEEEEECCCCCCC-CHH----------HHHHCC-CCCEEEEEEECCH-HHHHHHHHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             89999989997244-636----------787555-7627999998630-6779999999999971275379849999735


Q ss_pred             CCCC-C----CHHHHHHHHHH-HCCCEEEEE----CCCCCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             4578-7----06999999999-769889997----58981325557789999987286564
Q gi|254780709|r  266 MDGT-A----RGGGLIPIVVT-HKIPVYFLG----VGEGINDLEPFVAKDFSAVITGCLDY  316 (321)
Q Consensus       266 lD~t-a----~~G~~ls~~~~-~~~Pi~fig----~Ge~i~Dl~~f~~~~~~~~llG~gd~  316 (321)
                      -|-. +    ..-..+++... .+.|..+..    +|+.+++.    -+++++.|+..|-+
T Consensus       110 ~Dl~~~~~~~ei~~~l~l~~~~~~~~~~i~~~SA~tG~Gi~e~----~~WL~~~ii~~~~~  166 (169)
T cd04158         110 QDVAGALSVEEMTELLSLHKLCCGRSWYIQGCDARSGMGLYEG----LDWLSRQLVAAGVL  166 (169)
T ss_pred             CCCCCCCCHHHHHHHHCCHHHCCCCCEEEEEEECCCCCCHHHH----HHHHHHHHHHCCCC
T ss_conf             5677798999999985705452699629995557279598999----99999999865786


No 310
>pfam05621 TniB Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.
Probab=96.57  E-value=0.016  Score=38.05  Aligned_cols=110  Identities=16%  Similarity=0.210  Sum_probs=72.9

Q ss_pred             CCCCCCCEEECCCCCCCCHHHHHHHHHHHHHH----C--CCCEEEEECCCCCHHHHHHHHHHHHH---HCCCCCCCCCCC
Q ss_conf             13667412311354444424789999999852----2--67426774345124568899999753---035321223586
Q gi|254780709|r  106 DFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD----A--GLKVMLAAGDTFRSAAIDQLKIWADR---TSADFVCSEIGS  176 (321)
Q Consensus       106 ~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~----~--g~kV~lva~DtfR~aA~eQL~~~a~~---~~v~~~~~~~~~  176 (321)
                      +...++--+|+||..|.|||+-+-|.+..+-.    .  ...|+.+-+    +..-++-+-|+.+   +++|+   ....
T Consensus        56 P~~~Rmp~lLlvGdsnnGKT~Iv~rF~~~hp~~~d~~~~~~PVl~vq~----P~~p~~~~lY~~IL~~l~aP~---~~~~  128 (302)
T pfam05621        56 PNKQRMPNLLLVGPTNNGKSMIVEKFRRAHPAGSDADQEHIPVLVVQM----PSEPSVIRFYVALLAAMGAPL---RPRP  128 (302)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEC----CCCCCHHHHHHHHHHHHCCCC---CCCC
T ss_conf             864688755887079887899999999967998786667021899976----999886899999999837877---8887


Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEC-----CCCCCCHHHHHHHHHHHHHHH
Q ss_conf             6124542289999651487599865-----433321157789999899876
Q gi|254780709|r  177 DAAALAYEAFKQAQAKKVDVLIIDT-----AGRLHNNSILMAGIGKMIRVL  222 (321)
Q Consensus       177 dp~~v~~~a~~~a~~~~~DvvliDT-----AGR~~~~~~lm~EL~ki~~v~  222 (321)
                      ..++....++...+.-+.-+++||-     +|........|+-|+-+.+.+
T Consensus       129 ~~~~~~~~~~~ll~~~~vrmLIIDEiHnlL~Gs~~~qr~~ln~LK~L~Nel  179 (302)
T pfam05621       129 RLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSVNRREFLNLLRFLGNEL  179 (302)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECHHHHCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             789999999999997498789985436560486889999999999986365


No 311
>PRK05595 replicative DNA helicase; Provisional
Probab=96.56  E-value=0.085  Score=32.94  Aligned_cols=118  Identities=14%  Similarity=0.199  Sum_probs=72.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEE--------------------CCCCCHHH-----HHHHHHHHHH
Q ss_conf             41231135444442478999999985-2267426774--------------------34512456-----8899999753
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAA--------------------GDTFRSAA-----IDQLKIWADR  164 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva--------------------~DtfR~aA-----~eQL~~~a~~  164 (321)
                      -..|.+.|-+|+|||+.+--+|.+.. ++|++|++.+                    ....|-|-     .+++...+..
T Consensus       201 GdLiiiaaRP~mGKTa~alnia~~~a~~~g~~V~~fSlEMs~~ql~~R~ls~~s~i~~~~i~~g~l~~~~~~~~~~a~~~  280 (444)
T PRK05595        201 GDMILIAARPSMGKTTFALNIAEYAALREGKSVVIFSLEMSKEQLAYKLLCSEANVDMLRLRTGNLEDKDWENIARASGP  280 (444)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             77799985798980799999999999866993799958899999999999964698844232689799999999999999


Q ss_pred             H-CCCCCCCCCC-CCCHHHHHHHHHHHHHHCCCEEEEECCCCCC---CHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             0-3532122358-6612454228999965148759986543332---1157789999899876302223
Q gi|254780709|r  165 T-SADFVCSEIG-SDAAALAYEAFKQAQAKKVDVLIIDTAGRLH---NNSILMAGIGKMIRVLKRLDPH  228 (321)
Q Consensus       165 ~-~v~~~~~~~~-~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~---~~~~lm~EL~ki~~v~~~~~~~  228 (321)
                      + +.|+|-.... -.+..+...+-...+.++.|+|+||--+-+.   ...+.-.|+..|.+-+|.....
T Consensus       281 l~~~~l~i~d~~~~ti~~i~~~~r~~~~~~~~~liiiDYlqLi~~~~~~~~r~~ev~~isr~LK~lAke  349 (444)
T PRK05595        281 LAAAKIYIDDTAGVSVMEMRSKCRRLKIEHGIDLILIDYLQLMSGGKSSESRQQEVSEISRSIKALAKE  349 (444)
T ss_pred             HHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             854897054899964899999999999873999899823763578988888999999999999999999


No 312
>PRK13766 Hef nuclease; Provisional
Probab=96.56  E-value=0.083  Score=32.99  Aligned_cols=21  Identities=33%  Similarity=0.479  Sum_probs=12.6

Q ss_pred             CHHHHHHHHHHHCCCEEEEEC
Q ss_conf             069999999997698899975
Q gi|254780709|r  271 RGGGLIPIVVTHKIPVYFLGV  291 (321)
Q Consensus       271 ~~G~~ls~~~~~~~Pi~fig~  291 (321)
                      =.|++.++...+|+||.|...
T Consensus       646 i~gal~~i~~~~~i~ii~t~~  666 (764)
T PRK13766        646 IRGALASIAVDFGIPILFTRD  666 (764)
T ss_pred             HHHHHHHHHHHCCCCEEECCC
T ss_conf             999999999983997686499


No 313
>PRK01184 hypothetical protein; Provisional
Probab=96.55  E-value=0.021  Score=37.22  Aligned_cols=104  Identities=22%  Similarity=0.350  Sum_probs=59.6

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH--------HHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             12311354444424789999999852267426774345124568--------8999997530353212235866124542
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI--------DQLKIWADRTSADFVCSEIGSDAAALAY  183 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~--------eQL~~~a~~~~v~~~~~~~~~dp~~v~~  183 (321)
                      .+|.++|..||||+| +++   ++++.|..|. -+.|..|-.+.        +.+..++..+     ....|.|  .+|.
T Consensus         2 ~iIGlTG~iGSGKst-va~---i~~e~G~~vi-~~~Divr~~v~~~g~~~~~~~~~~~~~~l-----R~~~G~~--~~a~   69 (183)
T PRK01184          2 MIIIVTGMPGSGKGE-FSK---IARELGIPVV-VMGDVIREEVKKRGLPPTDENIGKVATDL-----RKELGMD--AVAI   69 (183)
T ss_pred             EEEEEECCCCCCHHH-HHH---HHHHCCCEEE-ECCHHHHHHHHHCCCCCCHHHHHHHHHHH-----HHHHCCH--HHHH
T ss_conf             399996899887899-999---9997799399-86077899999838999778999999999-----9871955--8999


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             2899996514875998654333211577899998998763022234301123102335
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT  241 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~  241 (321)
                      .++++....+.+.++||-- |+      +.|..-+.+       ..|.-++++++|..
T Consensus        70 ~~~~~i~~~~~~~~vidgi-r~------~~E~~~~~~-------~~~~~~li~V~A~~  113 (183)
T PRK01184         70 RTVPKIRELGSELVVVDGV-RG------DAEVEYFRK-------EFEDFILVAIHAPP  113 (183)
T ss_pred             HHHHHHHHCCCCEEEEECC-CC------HHHHHHHHH-------HCCCEEEEEEECCH
T ss_conf             9999997037982898167-87------899999997-------46984999998988


No 314
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=96.55  E-value=0.007  Score=40.55  Aligned_cols=95  Identities=18%  Similarity=0.235  Sum_probs=51.1

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH--
Q ss_conf             311354444424789999999852267426774345124568899999753035321223586612454228999965--
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA--  191 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~--  191 (321)
                      |+|+|+.||||+|-+.+||..|.    =+-+.+.|.+|..+-.+=..+ +.+.--+-.+.  -=|..++.+-+..+-.  
T Consensus         2 i~l~G~PGsGKgTqa~~La~~~~----~~~is~gdlLR~~~~~~t~~g-~~i~~~~~~G~--lvp~~i~~~l~~~~l~~~   74 (194)
T cd01428           2 ILLLGPPGSGKGTQAERLAKKYG----LPHISTGDLLREEIASGTELG-KKAKEYIDSGK--LVPDEIVIKLLKERLKKP   74 (194)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC----CEEECHHHHHHHHHHCCCHHH-HHHHHHHHCCC--CCCHHHHHHHHHHHHHCC
T ss_conf             89989999987999999999979----846768899999997499589-99999998799--778999999999998476


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             148759986543332115778999
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGI  215 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL  215 (321)
                      ....-+++|---|.......++++
T Consensus        75 ~~~~g~ilDGfPR~~~Qa~~l~~~   98 (194)
T cd01428          75 DCKKGFILDGFPRTVDQAEALDEL   98 (194)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             543877874797989999999999


No 315
>PRK08058 DNA polymerase III subunit delta'; Validated
Probab=96.55  E-value=0.013  Score=38.54  Aligned_cols=130  Identities=13%  Similarity=0.096  Sum_probs=63.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      ..-|+-++|+||.|+||++.+--+|..+.-.+. ..--+|+.-+.-   |.-.-+..-++-++.....+-...=+++-.+
T Consensus        25 ~rl~HA~Lf~Gp~G~GK~~~A~~~A~~LlC~~~-~~~~~Cg~C~~C---~~~~~~~HPD~~~i~p~~~~i~idqiR~L~~  100 (329)
T PRK08058         25 NRLAHAYLFEGAKGTGKKATALWLAKSLFCLER-NGVEPCGTCTNC---KRIESGNHPDVHLVAPDGQSIKKDQIRYLKE  100 (329)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-CCCCCCCCCHHH---HHHHCCCCCCEEEECCCCCCCCHHHHHHHHH
T ss_conf             996615655789998899999999999739999-999988788899---9987699997677456614077999999999


Q ss_pred             HHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             996----514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  188 QAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       188 ~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                      .+.    ..++-|+|||-|-||.....  +-|       =|..+..|..+++++=++.-+..+..+.
T Consensus       101 ~~~~~p~~g~~KV~II~~Ae~m~~~Aa--NAL-------LKtLEEPp~~t~fIL~t~~~~~lLpTI~  158 (329)
T PRK08058        101 EFSKSGVESNKKVYIIEHADKMTASAA--NSL-------LKFLEEPSGDTTAILLTENKHQILPTIL  158 (329)
T ss_pred             HHCCCCCCCCCEEEEEECHHHHCHHHH--HHH-------HHHHHCCCCCCEEEEEECCHHHHHHHHH
T ss_conf             964387578867999734776299999--999-------9986468978679987299666436886


No 316
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=96.55  E-value=0.045  Score=34.84  Aligned_cols=53  Identities=25%  Similarity=0.324  Sum_probs=36.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH------HCCCCEEEEECC-CCCHHHHHHHHHHHHHHC
Q ss_conf             41231135444442478999999985------226742677434-512456889999975303
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS------DAGLKVMLAAGD-TFRSAAIDQLKIWADRTS  166 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~------~~g~kV~lva~D-tfR~aA~eQL~~~a~~~~  166 (321)
                      -.+..++|+.|+|||+-+-.||....      ..+.+|+.+.+. +|++   +.|..+++..+
T Consensus        19 G~itEi~G~~GsGKTql~lqla~~~~~~~~~~g~~~~vvyIdtE~~f~~---~Rl~qia~~~~   78 (235)
T cd01123          19 GSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDTEGTFRP---ERLVQIAERFG   78 (235)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCH---HHHHHHHHHHC
T ss_conf             8799999999984999999999998424753678962999953677588---99999999713


No 317
>PRK00089 era GTP-binding protein Era; Reviewed
Probab=96.54  E-value=0.03  Score=36.09  Aligned_cols=152  Identities=18%  Similarity=0.280  Sum_probs=82.4

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      ..+...|.++|.+-|||.|-+=.|.      |.++.+++-                +.+..       .|+..-.+    
T Consensus         5 ~~ksG~VaivG~PNvGKSTL~N~l~------~~k~siVS~----------------k~~TT-------R~~i~gi~----   51 (296)
T PRK00089          5 KFKSGFVAIVGRPNVGKSTLLNALV------GQKISIVSP----------------KPQTT-------RHRIRGIV----   51 (296)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHH------CCCEEEECC----------------CCCCC-------CCCEEEEE----
T ss_conf             9837999999899988899999996------896176149----------------59987-------28389999----


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCCCEEEEEC
Q ss_conf             996514875998654333211577899998998763022234301123102335225--778999876435897699965
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGTTGLIMTK  265 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~~g~I~TK  265 (321)
                        ...+..++++||+|= +...+.+++. ....+....  ...|-+++|+||+.+-.  -...++...+.---.=++++|
T Consensus        52 --~~~~~q~i~iDTpGi-~~~~~~l~~~-~~~~~~~ai--~~aDlil~viD~~~~~~~~d~~i~~~l~~~~kp~ilviNK  125 (296)
T PRK00089         52 --TEDDAQIIFVDTPGI-HKPKRALNRA-MNKAAWSSL--KDVDLVLFVVDADEKIGPGDEFILEKLKKVKTPVILVLNK  125 (296)
T ss_pred             --EECCEEEEEEECCCC-CCCHHHHHHH-HHHHHHHHH--HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEH
T ss_conf             --979979999989986-6746778789-999999999--7599999998578898988999999888749988999547


Q ss_pred             CCCCCCHHHHHHHHHHHCC-----CEEEEEC--CCCCCCCC
Q ss_conf             4578706999999999769-----8899975--89813255
Q gi|254780709|r  266 MDGTARGGGLIPIVVTHKI-----PVYFLGV--GEGINDLE  299 (321)
Q Consensus       266 lD~ta~~G~~ls~~~~~~~-----Pi~fig~--Ge~i~Dl~  299 (321)
                      .|--.+- .++........     .+.+|+.  |+.+++|.
T Consensus       126 iDlv~k~-~l~~~~~~l~~~~~f~~if~iSA~~~~gi~~L~  165 (296)
T PRK00089        126 IDLVDKE-ELLPLLEELSELMDFAEIVPISALKGDNVDELL  165 (296)
T ss_pred             HHHCCHH-HHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHH
T ss_conf             8842898-899999999853797659999677888989999


No 318
>pfam00071 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Probab=96.53  E-value=0.024  Score=36.80  Aligned_cols=138  Identities=20%  Similarity=0.287  Sum_probs=72.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+++|-.|||||+-+-++.+---...          |.+           .++.+++...       +..      ....
T Consensus         2 i~vvG~~~vGKTsli~r~~~~~f~~~----------~~~-----------t~~~~~~~~~-------~~~------~~~~   47 (162)
T pfam00071         2 LVLVGDGGVGKSSLLIRFTQNKFPEE----------YIP-----------TIGVDFYTKT-------IEV------DGKT   47 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCC----------CCC-----------CCEEEEEEEE-------EEE------CCEE
T ss_conf             89999799779999999961999987----------477-----------4135567899-------999------9999


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----HCC--C-CEEEEECC
Q ss_conf             8759986543332115778999989987630222343011231023352257789998764----358--9-76999654
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA----VAG--T-TGLIMTKM  266 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~----~~~--~-~g~I~TKl  266 (321)
                      +.+.|.||+|.-.. ..    +..  ..++     ..+-.++|.|.+. ++.++.++.+.+    ..+  + -=+|-+|.
T Consensus        48 ~~~~i~Dt~G~e~~-~~----~~~--~~~~-----~ad~~iivfd~~~-~~S~~~i~~~~~~i~~~~~~~~piilvgnK~  114 (162)
T pfam00071        48 VKLQIWDTAGQERF-RA----LRP--LYYR-----GAQGFLLVYDITS-RDSFENVKKWLEEILRHADDNVPIVLVGNKC  114 (162)
T ss_pred             EEEEEEECCCCHHH-HH----HHH--HHHC-----CCCCCEEECCCCC-HHHHHHHHHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             99999978987204-67----889--9862-----5765504234898-8999999999999998579886288997524


Q ss_pred             CC-CCC---HHHHHHHHHHHCCCEEEEEC--CCCCCCC
Q ss_conf             57-870---69999999997698899975--8981325
Q gi|254780709|r  267 DG-TAR---GGGLIPIVVTHKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       267 D~-ta~---~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl  298 (321)
                      |- ..+   .=-+-..+...+.|...++.  |++|+++
T Consensus       115 Dl~~~~~i~~~e~~~~a~~~~~~y~e~Sak~g~gI~~~  152 (162)
T pfam00071       115 DLEDQRVVSTEEGEALAKELGLPFMETSAKTNENVEEA  152 (162)
T ss_pred             CHHHCCCCCHHHHHHHHHHHCCEEEEECCCCCCCHHHH
T ss_conf             74651889999999999980997999737888299999


No 319
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=96.53  E-value=0.079  Score=33.13  Aligned_cols=147  Identities=18%  Similarity=0.212  Sum_probs=76.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      .|.++|.+-+||+|-+-.|.      |.++.+ + +  +|+-.                    .|+..      .....+
T Consensus         2 ~VaivG~pNvGKStL~N~L~------g~~~~v-~-~--~p~TT--------------------r~~~~------~~~~~~   45 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLT------RAKPEV-A-P--YPFTT--------------------KSLFV------GHFDYK   45 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHH------CCCCEE-C-C--CCCCC--------------------CCCEE------EEEEEC
T ss_conf             79998899988999999995------898602-3-7--58723--------------------57436------899983


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHH-HHHHCCCCCCCCEEEEECCCCCCH--HHHHHHHHHHHHCC-----CCEEEEE
Q ss_conf             487599865433321157789999899-876302223430112310233522--57789998764358-----9769996
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMI-RVLKRLDPHAPHSVLQVLDATTGQ--NALRQVEMFHAVAG-----TTGLIMT  264 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~-~v~~~~~~~~p~~~~lVlda~~gq--~~~~~a~~F~~~~~-----~~g~I~T  264 (321)
                      +..+.++||+|=.+....-+..+.+.. ..+.    ...+-+++|+|++...  ...++.+.|++.-.     --=+++.
T Consensus        46 ~~~~~liDTpGi~~~~~~~~~~ie~~~~~~l~----~~~d~il~viD~~~~~~~~~~~~~~l~~~i~~~~~~~p~i~v~N  121 (168)
T cd01897          46 YLRWQVIDTPGLLDRPLEERNTIEMQAITALA----HLRAAVLFLFDPSETCGYSLEEQLSLFEEIKPLFKNKPVIVVLN  121 (168)
T ss_pred             CCEEEEECCCCCCCCCHHHHHHHHHHHHHHHH----HCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             72768724886556747888899999999998----35776899996887678489999999998776525888799994


Q ss_pred             CCCCCCCHH--HHHHHHHHHCCCEEEEEC--CCCCCCCC
Q ss_conf             545787069--999999997698899975--89813255
Q gi|254780709|r  265 KMDGTARGG--GLIPIVVTHKIPVYFLGV--GEGINDLE  299 (321)
Q Consensus       265 KlD~ta~~G--~~ls~~~~~~~Pi~fig~--Ge~i~Dl~  299 (321)
                      |.|--..-.  .+.......+.|+.+|+.  |+.+++|.
T Consensus       122 K~Dl~~~~~~~~~~~~~~~~~~~vi~ISA~~g~Gi~~L~  160 (168)
T cd01897         122 KIDLLTFEDLSEIEEEEELEGEEVLKISTLTEEGVDEVK  160 (168)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCCEEEEECCCCCCHHHHH
T ss_conf             753458100799999997089988999815896999999


No 320
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]
Probab=96.52  E-value=0.073  Score=33.38  Aligned_cols=160  Identities=21%  Similarity=0.201  Sum_probs=91.9

Q ss_pred             EECCCCCCCCHHHHHHHHHH-HHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---CCCCCCCCH----------
Q ss_conf             31135444442478999999-9852267426774345124568899999753035321---223586612----------
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSK-KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---CSEIGSDAA----------  179 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~-~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---~~~~~~dp~----------  179 (321)
                      .|+|=|||-|||+-++=.+. ||...++|+++.|--  +|=..+|-+.+.+.+++|--   .-...-+|.          
T Consensus        32 tLvvlPTGLGKT~IA~~V~~~~l~~~~~kvlfLAPT--KPLV~Qh~~~~~~v~~ip~~~i~~ltGev~p~~R~~~w~~~k  109 (542)
T COG1111          32 TLVVLPTGLGKTFIAAMVIANRLRWFGGKVLFLAPT--KPLVLQHAEFCRKVTGIPEDEIAALTGEVRPEEREELWAKKK  109 (542)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECCC--CHHHHHHHHHHHHHHCCCHHHEEEECCCCCHHHHHHHHHHCC
T ss_conf             389952875079999999999987458848996589--517999999999985898433231117778688999875177


Q ss_pred             ------HHHHHHHHHHH--HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             ------45422899996--5148759986543332115778999989987630222343011231023352257789998
Q gi|254780709|r  180 ------ALAYEAFKQAQ--AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM  251 (321)
Q Consensus       180 ------~v~~~a~~~a~--~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~  251 (321)
                            .|+.+-+....  ..+++++++|-|-|---|..-.       .|.+.+...+.+-.+|-|.|+-|.+--.+.+.
T Consensus       110 VfvaTPQvveNDl~~Grid~~dv~~lifDEAHRAvGnyAYv-------~Va~~y~~~~k~~~ilgLTASPGs~~ekI~eV  182 (542)
T COG1111         110 VFVATPQVVENDLKAGRIDLDDVSLLIFDEAHRAVGNYAYV-------FVAKEYLRSAKNPLILGLTASPGSDLEKIQEV  182 (542)
T ss_pred             EEEECCHHHHHHHHCCCCCHHHCEEEEECHHHHCCCCCHHH-------HHHHHHHHHCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             89956387776876176676780589862355413760699-------99999998256843798723899987999999


Q ss_pred             HHHHCCCCEEEE-ECCCCCCCHHHHHHHHHHHCCCEEEEE
Q ss_conf             764358976999-654578706999999999769889997
Q gi|254780709|r  252 FHAVAGTTGLIM-TKMDGTARGGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       252 F~~~~~~~g~I~-TKlD~ta~~G~~ls~~~~~~~Pi~fig  290 (321)
                       .+.+++..+++ |--|.+-+       .|..++-+-+|-
T Consensus       183 -~~nLgIe~vevrTE~d~DV~-------~Yv~~~kve~ik  214 (542)
T COG1111         183 -VENLGIEKVEVRTEEDPDVR-------PYVKKIKVEWIK  214 (542)
T ss_pred             -HHHCCCCEEEEECCCCCCHH-------HHHCCCEEEEEE
T ss_conf             -98379542898457885177-------751404248996


No 321
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=96.52  E-value=0.0027  Score=43.45  Aligned_cols=63  Identities=25%  Similarity=0.311  Sum_probs=45.8

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH------------------------HHHHHHHH--
Q ss_conf             6741231135444442478999999985226742677434512456------------------------88999997--
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA------------------------IDQLKIWA--  162 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA------------------------~eQL~~~a--  162 (321)
                      .++.+|.+.|.-||||||-+-+|...+..+  +|.+++-|.|=-.-                        .+||+.+-  
T Consensus         6 ~~~iiIgIaG~SgSGKTTv~~~l~~~~~~~--~~~~I~~D~YYk~~~~~~~~~~~~~n~d~p~A~D~dLl~~~L~~L~~g   83 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKELSEQLGVE--KVVVISLDDYYKDQSHLPFEERNKINYDHPEAFDLDLLIEHLKDLKQG   83 (218)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHCCC--CCEEEECCCCCCCHHHCCHHHCCCCCCCCHHHHCHHHHHHHHHHHHCC
T ss_conf             766999986798778899999999982867--524765223202530166755378574482343689999999999769


Q ss_pred             HHHCCCCCCCC
Q ss_conf             53035321223
Q gi|254780709|r  163 DRTSADFVCSE  173 (321)
Q Consensus       163 ~~~~v~~~~~~  173 (321)
                      ..+.+|+|...
T Consensus        84 ~~v~~P~yd~~   94 (218)
T COG0572          84 KPVDLPVYDYK   94 (218)
T ss_pred             CCCCCCCCCHH
T ss_conf             92245642031


No 322
>PRK05439 pantothenate kinase; Provisional
Probab=96.51  E-value=0.018  Score=37.73  Aligned_cols=46  Identities=30%  Similarity=0.325  Sum_probs=39.2

Q ss_pred             CCCCCCCEEECCCCCCCCHHHHHHHHHHHHHH--CCCCEEEEECCCCC
Q ss_conf             13667412311354444424789999999852--26742677434512
Q gi|254780709|r  106 DFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD--AGLKVMLAAGDTFR  151 (321)
Q Consensus       106 ~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~--~g~kV~lva~DtfR  151 (321)
                      .....|+||-+.|-=-|||+||+--|...+.+  .+.+|-||++|-|=
T Consensus        81 ~~~~~PfIIGIaGSVAVGKSTtARlLq~LL~r~~~~~~V~LvTTDGFL  128 (312)
T PRK05439         81 NGQKVPFIIGIAGSVAVGKSTTARLLQALLSRWPEHPKVDLVTTDGFL  128 (312)
T ss_pred             CCCCCCEEEEEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCC
T ss_conf             988999899976201026288999999999507899945899346655


No 323
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=96.50  E-value=0.054  Score=34.29  Aligned_cols=109  Identities=17%  Similarity=0.176  Sum_probs=59.9

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH------HCC--CCCCCCCCCCCHH
Q ss_conf             67412311354444424789999999852267426774345124568899999753------035--3212235866124
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR------TSA--DFVCSEIGSDAAA  180 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~------~~v--~~~~~~~~~dp~~  180 (321)
                      +....+++.|+-++|||+-+-+.+..+...+..+.  -.|..|....+++..+...      ++.  +-.......++..
T Consensus        18 ~~~~~ivi~G~RR~GKTsLi~~~~~~~~~~~~~~i--~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~   95 (223)
T pfam01637        18 GTYPIIVVYGPRRCGKTALLREFLEELRELGYRVI--YYDPLRREFEEKLDRFEEAKRLAEALGDALPKIGIAKSKLAFL   95 (223)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEE--EEECHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             99718999868878799999999986334685289--9951444379999988888999999876512332221120788


Q ss_pred             HHHHHHHHHHHHCCC-EEEEECCCCCC---CHHHHHHHHHHHH
Q ss_conf             542289999651487-59986543332---1157789999899
Q gi|254780709|r  181 LAYEAFKQAQAKKVD-VLIIDTAGRLH---NNSILMAGIGKMI  219 (321)
Q Consensus       181 v~~~a~~~a~~~~~D-vvliDTAGR~~---~~~~lm~EL~ki~  219 (321)
                      .+.....+....+.+ +|+||=.-.+-   .+..++..|+.+.
T Consensus        96 ~l~~~~~~l~~~~~~~iiviDEfq~l~~~~~~~~~~~~l~~~~  138 (223)
T pfam01637        96 SLTLLFELLKRKGKKIAIIIDEVQYAIGLNGAESYVKLLLNLI  138 (223)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECHHHHHHCCCCHHHHHHHHHHH
T ss_conf             9999999998559965999701677640244305999999999


No 324
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.50  E-value=0.0033  Score=42.87  Aligned_cols=58  Identities=16%  Similarity=0.227  Sum_probs=37.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             4123113544444247899999998522674267743451245688999997530353
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~  168 (321)
                      -.++.++|+||+||||.+-=|+..++-..-+|.+-.-|...--.-..++.+..++|+-
T Consensus        33 Ge~~~iiG~nGsGKSTLl~~l~Gll~P~sG~V~i~G~~i~~~~~~~~~~~~r~~vg~v   90 (286)
T PRK13641         33 GSFVALIGHTGSGKSTLMQHFNALLKPSSGKITIAGYHITPETSNKNLKDLRKKVGLV   90 (286)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCHHHHHHHHHHEEEE
T ss_conf             9999999999839999999996598988549999989997666555799998515489


No 325
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=96.48  E-value=0.0072  Score=40.44  Aligned_cols=32  Identities=28%  Similarity=0.503  Sum_probs=23.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             31135444442478999999985226742677434
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD  148 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D  148 (321)
                      +|+.||.|+|||+.+--+|+.+.   ..+.-+.+.
T Consensus         1 iLl~GppGtGKT~~a~~la~~~~---~~~~~v~~~   32 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKELG---APFIEISGS   32 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHC---CCCEECCCC
T ss_conf             98789999999999999999978---985332420


No 326
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=96.48  E-value=0.0061  Score=40.97  Aligned_cols=152  Identities=15%  Similarity=0.173  Sum_probs=77.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-HCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             311354444424789999999852267426774345124568899999753-0353212235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR-TSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~-~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      |.++|=-..||||.+..|.+.+...+.....-.      .+.++...  |+ -|+.+.       .+.+.|      ...
T Consensus         5 i~iiGHVDhGKTTL~~~l~~~~~~~~~~~~~~~------~~~D~~~~--EreRGiTI~-------~~~~~~------~~~   63 (195)
T cd01884           5 VGTIGHVDHGKTTLTAAITKVLAKKGGAKFKKY------DEIDKAPE--EKARGITIN-------TAHVEY------ETA   63 (195)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCC------HHCCCCHH--HHCCCCCCC-------CEEEEE------ECC
T ss_conf             999960588698999999998866344441120------01005466--650588614-------418999------608


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHH--HHCCCCEE-E-EECCC
Q ss_conf             4875998654333211577899998998763022234301123102335225778999-876--43589769-9-96545
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFH--AVAGTTGL-I-MTKMD  267 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~--~~~~~~g~-I-~TKlD  267 (321)
                      ++.+-+|||.|--  |  .+.++.   +.+.     ..+-.+||+||.-|..  .|.+ .+.  ...++.-+ | ++|+|
T Consensus        64 ~~~~~~IDtPGH~--d--F~~~~i---~g~~-----~~D~aiLVVdA~eGv~--~QT~eh~~la~~lgi~~iiV~iNK~D  129 (195)
T cd01884          64 NRHYAHVDCPGHA--D--YIKNMI---TGAA-----QMDGAILVVSATDGPM--PQTREHLLLARQVGVPYIVVFLNKAD  129 (195)
T ss_pred             CEEEEECCCCCHH--H--HHHHHH---HHHH-----HCCEEEEEEECCCCCC--HHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             8169962689607--7--888998---6351-----1362689985277874--78999999999809996279996877


Q ss_pred             CCCCHH-------HHHHHHHHHC-----CCEEEEEC--CCCCCCCCC
Q ss_conf             787069-------9999999976-----98899975--898132555
Q gi|254780709|r  268 GTARGG-------GLIPIVVTHK-----IPVYFLGV--GEGINDLEP  300 (321)
Q Consensus       268 ~ta~~G-------~~ls~~~~~~-----~Pi~fig~--Ge~i~Dl~~  300 (321)
                      -...--       -+......++     .|+.|++-  |-...|..+
T Consensus       130 ~~~~~~~~~~v~~ei~~~l~~~g~~~~~~p~ip~Sa~~g~~~~~~~~  176 (195)
T cd01884         130 MVDDEELLELVEMEVRELLSKYGFDGDNTPIVRGSALKALEGDDPNK  176 (195)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEHHHHHCCCCCCC
T ss_conf             89878999999999999998429995568299977387535788875


No 327
>PRK04040 adenylate kinase; Provisional
Probab=96.48  E-value=0.0074  Score=40.36  Aligned_cols=171  Identities=19%  Similarity=0.256  Sum_probs=73.5

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCHH-------HHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             412311354444424789999999852267426774345-1245-------68899999753035321223586612454
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-FRSA-------AIDQLKIWADRTSADFVCSEIGSDAAALA  182 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-fR~a-------A~eQL~~~a~~~~v~~~~~~~~~dp~~v~  182 (321)
                      +.+++++|+.||||||.+.++...+.. +.++. -.+|. |+.|       .-++++.    +.++.        --.+-
T Consensus         2 ~k~VvvtGiPGvGKTTv~~~~~~~l~~-~~~~v-n~G~~M~e~A~~~glv~~RDemRk----L~~~~--------q~~lQ   67 (189)
T PRK04040          2 MKVVVVTGVPGVGKTTVLNKALEKLKE-DYKIV-NFGDVMLEVAKEEGLVEHRDEMRK----LPLEE--------QKELQ   67 (189)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCC-CCEEE-EHHHHHHHHHHHCCCCCCHHHHCC----CCHHH--------HHHHH
T ss_conf             418999758988789999999997235-87598-677999999998177347788747----99999--------99999


Q ss_pred             HHHHHHHHH-HCCCEEEEECCCCCCCHHHHHHHH-HHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH---CC
Q ss_conf             228999965-148759986543332115778999-9899876302223430112310233522577899987643---58
Q gi|254780709|r  183 YEAFKQAQA-KKVDVLIIDTAGRLHNNSILMAGI-GKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV---AG  257 (321)
Q Consensus       183 ~~a~~~a~~-~~~DvvliDTAGR~~~~~~lm~EL-~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~---~~  257 (321)
                      ..|.++-.. .+-..|||||-.=-.+..--+--| ....+.++      |+..+ ++.|.-. ..+..-  -++.   -+
T Consensus        68 ~~Aa~~I~~~~~~~~ViIDTHa~Iktp~GylpGLP~~Vl~~L~------P~~iv-lieA~P~-eIl~RR--~~D~tR~RD  137 (189)
T PRK04040         68 REAAERIAEMAGEGPVIVDTHATIKTPGGYLPGLPEWVLEELN------PDVIV-LIEADPD-EILMRR--LRDPTRRRD  137 (189)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHCC------CCEEE-EEECCHH-HHHHHH--HCCCCCCCC
T ss_conf             9999999983578728994452002688677899899998669------98899-9975889-999988--425566898


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             9769996545787069999999997698899975898132555778999998728
Q gi|254780709|r  258 TTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG  312 (321)
Q Consensus       258 ~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG  312 (321)
                      +.+.=--+..-...-.++.+-+..+|.|++++-+       +++.++.-+..|..
T Consensus       138 ~es~~~I~~hq~~nR~~a~ayavltga~Vkiv~N-------~e~~~e~Aa~~iv~  185 (189)
T PRK04040        138 VETEESIEEHQEMNRAAAMAYAVLTGATVKIVEN-------HEGLLEEAAEEIVE  185 (189)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEC-------CCCCHHHHHHHHHH
T ss_conf             7889999999999999999999973984899978-------99988999999999


No 328
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring. This family contains the X subunit of this three-subunit enzyme. Sequence and structure similarity between bchX, protochlorophyllide reductase L subunit (bchL and chlL) and nitrogenase Fe protein (nifH gene) suggest their functional similarity. Members of the BchX family serve as the unique electron donors to their respective catalytic subunits (bchN-bchB, bchY-bchZ and nitrogenase component 1). Mechanistically, they hydrolyze ATP and transfer electrons through a Fe4-S4 cluster.
Probab=96.47  E-value=0.0038  Score=42.40  Aligned_cols=161  Identities=21%  Similarity=0.356  Sum_probs=97.3

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC------------HHHHHHHHHH---HHHHCC----
Q ss_conf             366741231135444442478999999985226742677434512------------4568899999---753035----
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR------------SAAIDQLKIW---ADRTSA----  167 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR------------~aA~eQL~~~---a~~~~v----  167 (321)
                      ..++..+|.+-|=-|.||.||.+.+++-+...|+||++|.||--.            +--.+.++.-   ++.+.+    
T Consensus        27 ~~k~~~~IAiYGKGGIGKSTts~NlsAAlA~~GkkVm~IGCDPKaDSTrlLlgG~~~~TVLd~~~~~~~~~e~v~~~dv~  106 (329)
T cd02033          27 PTKKTQIIAIYGKGGIGKSFTLANLSYMMAQQGKRVLLIGCDPKSDTTSLLFGGKACPTIIETSAKKKLAGEEVQIGDVC  106 (329)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHCCCCCCCCHHHHHHHHCCCCCCCCCHHHEE
T ss_conf             75445499997688435616889999999977996999788884603341058988840999998728864434250178


Q ss_pred             ----CCCCCCCCC-CC--------HHHHHHHHHHHH--HHCCCEEEEECCCC-------CCCHHHHHHHHHHHHHHHHCC
Q ss_conf             ----321223586-61--------245422899996--51487599865433-------321157789999899876302
Q gi|254780709|r  168 ----DFVCSEIGS-DA--------AALAYEAFKQAQ--AKKVDVLIIDTAGR-------LHNNSILMAGIGKMIRVLKRL  225 (321)
Q Consensus       168 ----~~~~~~~~~-dp--------~~v~~~a~~~a~--~~~~DvvliDTAGR-------~~~~~~lm~EL~ki~~v~~~~  225 (321)
                          .++..+.|. .|        .-.+++-++...  ..++|+|+.|--|-       ++..+                
T Consensus       107 ~~g~Gv~CvEsGGPEPGvGCAGRGIItai~lLe~lg~~~~d~D~V~yDVLGDVVCGGFAmPiR~----------------  170 (329)
T cd02033         107 FKRDGVFAMELGGPEVGRGCGGRGIIHGFELLEKLGFHDWDFDYVLLDFLGDVVCGGFGLPIAR----------------  170 (329)
T ss_pred             ECCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEECCCCEEECCCCCCCCC----------------
T ss_conf             6259988986679999876788730136678776377525899999922453566463353356----------------


Q ss_pred             CCCCCCEEEEECCCCC-----CHHHHHHHHHHHHH---CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             2234301123102335-----22577899987643---589769996545787069999999997698899
Q gi|254780709|r  226 DPHAPHSVLQVLDATT-----GQNALRQVEMFHAV---AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYF  288 (321)
Q Consensus       226 ~~~~p~~~~lVlda~~-----gq~~~~~a~~F~~~---~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~f  288 (321)
                        ..-++++.|.+.-.     -+|...-++.|.+.   +.+.|+|..+-|++.   -+=..+...+.|+..
T Consensus       171 --g~A~evyIVtSgE~MalyAANNI~~~i~~~a~~gg~vrl~GlI~N~~~~~~---e~e~fa~~~g~~~l~  236 (329)
T cd02033         171 --DMAQKVIVVGSNDLQSLYVANNVCNAVEYFRKLGGNVGVAGMVINKDDGTG---EAQAFAAHAGIPILA  236 (329)
T ss_pred             --CCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCH---HHHHHHHHCCCCEEE
T ss_conf             --876289999678088999887899999999863897101159860688724---999999971995799


No 329
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=96.46  E-value=0.0099  Score=39.47  Aligned_cols=47  Identities=28%  Similarity=0.485  Sum_probs=39.4

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHH
Q ss_conf             667412311354444424789999999852-26742677434512456
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA  154 (321)
                      +.+-.+|.|.|+.||||||-+--|...+.. .|+.|.+.-.|..|.+=
T Consensus       389 ~~~G~tiwlTGLsgsGKsTiA~al~~~L~~~~~~~v~lLDGD~~R~~l  436 (568)
T PRK05537        389 HKQGFTVFFTGLSGAGKSTIAKALMAKLMEMRGRPVTLLDGDVVRKHL  436 (568)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             458649998457888776999999999997189279995468887421


No 330
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=96.46  E-value=0.022  Score=37.05  Aligned_cols=126  Identities=17%  Similarity=0.282  Sum_probs=67.1

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCE-EEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             31135444442478999999985226742-67743451245688999997530353212235866124542289999651
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKV-MLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV-~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      |+++|+.|+||||-+.+|..     +..+ ..                      +|.++.    +...+        ..+
T Consensus         2 IlilGLd~aGKTTil~~l~~-----~~~~~~~----------------------~PT~Gf----~~~~i--------~~~   42 (164)
T cd04162           2 ILVLGLDGAGKTSLLHSLSS-----ERSLESV----------------------VPTTGF----NSVAI--------PTQ   42 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHC-----CCCCCCC----------------------CCCCCC----CEEEE--------EEC
T ss_conf             99996799989999999816-----9987653----------------------563277----46999--------989


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHCCCCEEEEECCCCCCC
Q ss_conf             487599865433321157789999899876302223430112310233522577899-9876435897699965457870
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVAGTTGLIMTKMDGTAR  271 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~~~~g~I~TKlD~ta~  271 (321)
                      ++.+.+.|++|.-           +++..-+.+.. ..+-+++|+|++-- +-++.+ +.+++.+.          .   
T Consensus        43 ~~~l~~wDlgGq~-----------~~R~~W~~Y~~-~~~gIIfVVDssD~-~rl~eak~~L~~ll~----------~---   96 (164)
T cd04162          43 DAIMELLEIGGSQ-----------NLRKYWKRYLS-GSQGLIFVVDSADS-ERLPLARQELHQLLQ----------H---   96 (164)
T ss_pred             CEEEEEEECCCHH-----------HHHHHHHHHHH-CCCEEEEEEECCCH-HHHHHHHHHHHHHHH----------C---
T ss_conf             9999998537528-----------88656998711-77589999956888-899999999999970----------8---


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCC-CCCHHHHHHHHCCCCCCC
Q ss_conf             6999999999769889997589813255-577899999872865646
Q gi|254780709|r  272 GGGLIPIVVTHKIPVYFLGVGEGINDLE-PFVAKDFSAVITGCLDYG  317 (321)
Q Consensus       272 ~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~-~f~~~~~~~~llG~gd~~  317 (321)
                               ..++|+..++.=|   |+. ...+.++ ...||+.++.
T Consensus        97 ---------~~~~PlLIlaNKq---Dl~~a~s~~ei-~~~L~L~~i~  130 (164)
T cd04162          97 ---------PPDLPLVVLANKQ---DLPAARSVQEI-HKELELEPIA  130 (164)
T ss_pred             ---------CCCCEEEEEEECC---CCCCCCCHHHH-HHHCCCCCCC
T ss_conf             ---------7998699998632---43369999999-9866994637


No 331
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
Probab=96.45  E-value=0.098  Score=32.48  Aligned_cols=89  Identities=19%  Similarity=0.241  Sum_probs=52.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHH-HHCCCCEEEEECCCCCHHHHHHH--HHHHHHHCCCCCCCCCCC---CCHHHHHH
Q ss_conf             4123113544444247899999998-52267426774345124568899--999753035321223586---61245422
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKM-SDAGLKVMLAAGDTFRSAAIDQL--KIWADRTSADFVCSEIGS---DAAALAYE  184 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~-~~~g~kV~lva~DtfR~aA~eQL--~~~a~~~~v~~~~~~~~~---dp~~v~~~  184 (321)
                      -..+.+.|-+|+|||+.+--+|... .++|+.|++.+..-=    .+||  |..|...+|+.-.-..+.   +...-+..
T Consensus       194 g~LiIiaARPsmGKTafalnia~n~A~~~g~~Vl~fSLEMs----~eql~~R~la~~s~i~~~~i~~g~l~~~~~~~~~~  269 (421)
T TIGR03600       194 GDLIVIGARPSMGKTTLALNIAENVALREGKPVLFFSLEMS----AEQLGERLLASKSGINTGNIRTGRFNDSDFNRLLN  269 (421)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCC----HHHHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHH
T ss_conf             86899985467874599999999999866983899925799----99999999998548977666528999899999999


Q ss_pred             HHHHHHHHCCCEEEEECCCCC
Q ss_conf             899996514875998654333
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGRL  205 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR~  205 (321)
                      |+..  ..+..+.+-||++..
T Consensus       270 a~~~--l~~~~l~i~d~~~~t  288 (421)
T TIGR03600       270 AVDR--LSEKDLYIDDTGGLT  288 (421)
T ss_pred             HHHH--HHCCCEEEECCCCCC
T ss_conf             9998--616878996699887


No 332
>PRK06761 hypothetical protein; Provisional
Probab=96.45  E-value=0.0048  Score=41.66  Aligned_cols=41  Identities=32%  Similarity=0.421  Sum_probs=33.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE-------ECCCCCHH
Q ss_conf             231135444442478999999985226742677-------43451245
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA-------AGDTFRSA  153 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lv-------a~DtfR~a  153 (321)
                      .|++=|+.|||||||+.+|+..+...|..|-+.       .+|-+|.|
T Consensus         4 LIiIEGlPGsGKSTta~~l~d~L~~~g~~v~~~~Egd~~hP~D~~~~A   51 (281)
T PRK06761          4 LIIIEGLPGFGKSTTAHLLNDKLSQLKIEVELFVEGDLNHPADYDWVA   51 (281)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHH
T ss_conf             799966899980149999999998669853899507899961112221


No 333
>PRK07413 hypothetical protein; Validated
Probab=96.45  E-value=0.053  Score=34.37  Aligned_cols=175  Identities=16%  Similarity=0.195  Sum_probs=82.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCC------CHHHHHH--HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHH
Q ss_conf             88989999999999987512789------9899999--999987852010012100013667412311354444424789
Q gi|254780709|r   57 DIGVAVAQKIVEELLTKRYAKDV------SVQRVLY--DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI  128 (321)
Q Consensus        57 DVg~~va~~Iie~ik~~~~~~~i------~~~~i~~--~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~  128 (321)
                      +.|+--.+++++-|+++-...++      -+++++.  +|..++...-.|...+...+++..-.|=.+. -||=||||.+
T Consensus       139 ~~Gll~~deVl~~L~~RP~~~eVVlTGR~AP~eLIe~ADLVTEMrp~~hp~~~~~~~~~~~~~~I~VYT-G~GKGKTTAA  217 (382)
T PRK07413        139 DLGLLPVDEVVKTLKSRPEGLEIIITGRAAPQSLLDIADLHSEMRAHRRPEASEDGVPFNSSGGIEIYT-GEGKGKSTSA  217 (382)
T ss_pred             HCCCCCHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHCHHHHCCCCCCCCCCCCCCCCCCCCCEEEEC-CCCCCHHHHH
T ss_conf             579805999999997099998899959999999998623355257656886553454457889759955-8997699999


Q ss_pred             HHHHHHHHHCC------CCEEEEE-----CCCCCHHHHHHHHH-HH-----HHHCCCCCCCCCCCCCH--HHHHHHHHHH
Q ss_conf             99999985226------7426774-----34512456889999-97-----53035321223586612--4542289999
Q gi|254780709|r  129 GKLSKKMSDAG------LKVMLAA-----GDTFRSAAIDQLKI-WA-----DRTSADFVCSEIGSDAA--ALAYEAFKQA  189 (321)
Q Consensus       129 aKLA~~~~~~g------~kV~lva-----~DtfR~aA~eQL~~-~a-----~~~~v~~~~~~~~~dp~--~v~~~a~~~a  189 (321)
                      -=||-+..-+|      +||+++-     -..=.-+|++-|.. |.     .+.|-+.|.-.....|.  ..|.+|.+.|
T Consensus       218 lGlAlRA~G~G~~~~~~~rV~iiQFiKG~~~ygE~~a~~~l~~~~p~~~~~~~~g~~~~~~~~~~~~~d~~~A~~a~e~a  297 (382)
T PRK07413        218 LGKALQAIGRGISQDKSHRVLILQWLKGGSGYTEDAAIAALRESYPHLVDHLRSGRDAIVWRGQQQPIDYVEAERAWEIA  297 (382)
T ss_pred             HHHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHCCCCHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99999974499876778569999985599973289999987500752447743178556669999888999999999999


Q ss_pred             H----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             6----514875998654333211577899998998763022234301123102
Q gi|254780709|r  190 Q----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD  238 (321)
Q Consensus       190 ~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVld  238 (321)
                      +    +..||+||.|-..     ..+--+|-.+..|++-. ...|..+-||+-
T Consensus       298 ~~~i~sg~ydlVILDEin-----~Al~~gll~~e~Vl~~l-~~rP~~~elVlT  344 (382)
T PRK07413        298 RAAIASGLYKTIILDELN-----PTVDLELLPVEPIVQTL-LRKPRDTEVIIT  344 (382)
T ss_pred             HHHHHCCCCCEEEEECCH-----HHHHCCCCCHHHHHHHH-HHCCCCCEEEEE
T ss_conf             999865885889983316-----88875997799999999-848998889995


No 334
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents DP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligases (MurE; 6.3.2.13 from EC). An exception is found with Staphylococcus aureus, in which diaminopimelate is replaced by lysine in the peptidoglycan and MurE is (6.3.2.7 from EC). The Mycobacteria, part of the closest neighbouring branch outside of the low-GC Gram-positive bacteria, use diaminopimelate.; GO: 0005524 ATP binding, 0016881 acid-amino acid ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=96.44  E-value=0.0046  Score=41.78  Aligned_cols=79  Identities=19%  Similarity=0.208  Sum_probs=52.5

Q ss_pred             EEECCCCCCC-CHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHH-HHHHHHHHH
Q ss_conf             2311354444-42478999999985226742677434512456889999975303532122358661245-422899996
Q gi|254780709|r  113 VILVVGVNGV-GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL-AYEAFKQAQ  190 (321)
Q Consensus       113 vil~vG~nG~-GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v-~~~a~~~a~  190 (321)
                      -+-+|||||. |||||+-=++.+|.+.|+|++|+.+=-||.+.- ++-....          ..+-|.++ ++..+..+.
T Consensus        87 ~l~viGvTGTNGKTtt~~li~~~l~~~G~~tgliGT~g~~~~g~-~~~~~~~----------~~TTP~~~~~q~~L~~~~  155 (494)
T TIGR01085        87 KLKVIGVTGTNGKTTTTSLIAQLLELLGKKTGLIGTIGYRLGGN-ELIKDPA----------SLTTPEALTLQKTLAEMV  155 (494)
T ss_pred             CEEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEEEECCCC-CCCCCCC----------CCCCCCCHHHHHHHHHHH
T ss_conf             51689997128744899999999986797089986545304776-3126655----------567997189999999999


Q ss_pred             HHCCCEEEEECC
Q ss_conf             514875998654
Q gi|254780709|r  191 AKKVDVLIIDTA  202 (321)
Q Consensus       191 ~~~~DvvliDTA  202 (321)
                      .++.+..++-..
T Consensus       156 ~~g~~~~v~EvS  167 (494)
T TIGR01085       156 EAGAQYAVMEVS  167 (494)
T ss_pred             HCCCCEEEEEEE
T ss_conf             659979999863


No 335
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]
Probab=96.43  E-value=0.022  Score=37.07  Aligned_cols=156  Identities=19%  Similarity=0.271  Sum_probs=86.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             412311354444424789999999852267426774-3451245688999997530353212235866124542289999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAA-GDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva-~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      -.++=+.||-|+||||-+--++.-.++.|.+|+.|. .-+||+.=..|+-..-  ++--++..++..+.....-+.+...
T Consensus        60 g~ItEiyG~~gsGKT~lal~~~~~aq~~g~~a~fIDtE~~l~p~r~~~l~~~~--~d~l~v~~~~~~e~q~~i~~~~~~~  137 (279)
T COG0468          60 GRITEIYGPESSGKTTLALQLVANAQKPGGKAAFIDTEHALDPERAKQLGVDL--LDNLLVSQPDTGEQQLEIAEKLARS  137 (279)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHH--HCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             35899846887654668999988865379808999589998999999988754--2153686689779999999999875


Q ss_pred             HHHCCCEEEEECCCCCCCH------------HHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             6514875998654333211------------5778999989987630222343011231023352257789998764358
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNN------------SILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAG  257 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~------------~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~  257 (321)
                      -.+.+|+|+||...-+-..            ..+...|.++.+.++++.      +..++        .+|..   ..++
T Consensus       138 ~~~~i~LvVVDSvaa~~r~~~~~d~~~~~~~r~ls~~l~~L~~~a~~~~------~~vi~--------~NQv~---~k~~  200 (279)
T COG0468         138 GAEKIDLLVVDSVAALVRAEEIEDGHLGLRARLLSKALRKLTRLANKYN------TAVIF--------TNQVR---AKIG  200 (279)
T ss_pred             CCCCCCEEEEECCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCC------CEEEE--------ECCEE---EECC
T ss_conf             4688788998257434636554853489999999999999999999749------58999--------78403---4067


Q ss_pred             CCEEEEECCC-CCCCHHHHHHHHHHHCCCEEEEE
Q ss_conf             9769996545-78706999999999769889997
Q gi|254780709|r  258 TTGLIMTKMD-GTARGGGLIPIVVTHKIPVYFLG  290 (321)
Q Consensus       258 ~~g~I~TKlD-~ta~~G~~ls~~~~~~~Pi~fig  290 (321)
                      ..   +-  | .++-||.+|-......+-+.-++
T Consensus       201 ~~---f~--~~~~~~GG~~L~~~as~rl~l~k~~  229 (279)
T COG0468         201 VM---FG--DPETTTGGNALKFYASVRLDLRRIE  229 (279)
T ss_pred             CC---CC--CCCCCCCCHHHHHHHHEEEEEEECC
T ss_conf             66---68--8665877238875532477765224


No 336
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]
Probab=96.43  E-value=0.026  Score=36.54  Aligned_cols=90  Identities=21%  Similarity=0.251  Sum_probs=58.6

Q ss_pred             EEECC-CCCCCCHHHHHHHHH-------HHHH---HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC-------CCCC
Q ss_conf             23113-544444247899999-------9985---2267426774345124568899999753035321-------2235
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLS-------KKMS---DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV-------CSEI  174 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA-------~~~~---~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~-------~~~~  174 (321)
                      +.+|+ |+-|+||||-+--|.       +||-   .+-.+|+.++|.-+|.-+.+-|+-...+++++--       ..-.
T Consensus        90 ~~~~~~gdsg~GKttllL~l~IalaaG~~lfG~~v~epGkvlyvslEl~re~~L~Rl~~v~a~mgLsPadvrn~dltd~~  169 (402)
T COG3598          90 YVSILYGDSGVGKTTLLLYLCIALAAGKNLFGNKVKEPGKVLYVSLELYREDILERLEPVRARMGLSPADVRNMDLTDVS  169 (402)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCHHHHHHEECCCCC
T ss_conf             05898448862376899999999986477745335588807999822686889999999998709985763220000245


Q ss_pred             CCCC----HHH--HHHHHHHHHHHCCCEEEEECC
Q ss_conf             8661----245--422899996514875998654
Q gi|254780709|r  175 GSDA----AAL--AYEAFKQAQAKKVDVLIIDTA  202 (321)
Q Consensus       175 ~~dp----~~v--~~~a~~~a~~~~~DvvliDTA  202 (321)
                      |+++    .+-  ...-+.......+|+|+||+-
T Consensus       170 Gaa~~~d~l~pkl~rRfek~~~Q~rp~~vViDp~  203 (402)
T COG3598         170 GAADESDVLSPKLYRRFEKILEQKRPDFVVIDPF  203 (402)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             6787200105899999999998747874997344


No 337
>PRK02362 ski2-like helicase; Provisional
Probab=96.43  E-value=0.029  Score=36.25  Aligned_cols=123  Identities=17%  Similarity=0.228  Sum_probs=71.8

Q ss_pred             EECCCCCCCCHHHHHHHHHHH-HHHCCCCEEEEECCCCCHHHHHHHHHHHHH--HCCCC--CCCCCCCCCHH-----HHH
Q ss_conf             311354444424789999999-852267426774345124568899999753--03532--12235866124-----542
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKK-MSDAGLKVMLAAGDTFRSAAIDQLKIWADR--TSADF--VCSEIGSDAAA-----LAY  183 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~-~~~~g~kV~lva~DtfR~aA~eQL~~~a~~--~~v~~--~~~~~~~dp~~-----v~~  183 (321)
                      ++++=|||+||| -+|-+|.. ...+|+|++.++  .|||=|-|+.+.|.+.  .|+.+  ..+....++..     |+-
T Consensus        42 lvvsaPTgsGKT-lvAElail~~l~~g~k~vYi~--P~kALa~EK~~~~~~~~~~gi~V~~~tGd~~~~~~~l~~~dIiV  118 (736)
T PRK02362         42 LLAAIPTASGKT-LLAELAMLKAIAEGGKALYIV--PLRALASEKFEEFSEFSELGLRVGISTGDYDRRDEYLGRNDIIV  118 (736)
T ss_pred             EEEECCCCCCHH-HHHHHHHHHHHHHCCEEEEEC--CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHCCCCCEEE
T ss_conf             899799998589-999999999998399799985--87999999999999874579989998089887831436899999


Q ss_pred             HHHHHHH---------HHCCCEEEEECCC------CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             2899996---------5148759986543------332115778999989987630222343011231023352257789
Q gi|254780709|r  184 EAFKQAQ---------AKKVDVLIIDTAG------RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       184 ~a~~~a~---------~~~~DvvliDTAG------R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~  248 (321)
                      -+.+++.         .++..+|+||=.-      |-.+=+.++.   ++..       ..|+--+.-|+||.+ |+-+.
T Consensus       119 ~T~EK~dsl~r~~~~~l~~v~lVViDEiHli~d~~RG~~lE~~ls---kl~~-------~~~~iqiIgLSATl~-N~~~l  187 (736)
T PRK02362        119 ATSEKTDSLLRNGAPWIDDISCVVADEVHLIDSPNRGPTLEVTLA---KLRR-------LNPDMQVIALSATIG-NADEL  187 (736)
T ss_pred             ECHHHHHHHHHCCCHHHHCCCEEEEECCEEECCCCCHHHHHHHHH---HHHH-------CCCCCEEEEEECCCC-CHHHH
T ss_conf             997999999844816765089899817678668872499999999---9973-------387743898624558-99999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780709|r  249 VE  250 (321)
Q Consensus       249 a~  250 (321)
                      |+
T Consensus       188 a~  189 (736)
T PRK02362        188 AA  189 (736)
T ss_pred             HH
T ss_conf             99


No 338
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=96.42  E-value=0.003  Score=43.09  Aligned_cols=78  Identities=24%  Similarity=0.310  Sum_probs=43.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCC---CCCCCHHHHHHHHHHH
Q ss_conf             2311354444424789999999852267426774345124568899999753035321223---5866124542289999
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSE---IGSDAAALAYEAFKQA  189 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~---~~~dp~~v~~~a~~~a  189 (321)
                      -|+++|++|+||||++.-|+.++-.. .++..+ -|++-.    .|.   ...-+.+....   .+..+.+ ..+++..+
T Consensus        27 nIlIsG~tGSGKTTll~al~~~i~~~-~rivti-Ed~~El----~l~---~~~~v~l~~~~~~~~~~~~~~-~~~li~~a   96 (186)
T cd01130          27 NILISGGTGSGKTTLLNALLAFIPPD-ERIITI-EDTAEL----QLP---HPNWVRLVTRPGNVEGSGEVT-MADLLRSA   96 (186)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCC-CCEEEE-CCCHHH----CCC---CCCEEEEEEECCCCCCCCEEC-HHHHHHHH
T ss_conf             89998999998999999999613345-645984-153540----477---775688886046457865034-99998873


Q ss_pred             HHHCCCEEEEE
Q ss_conf             65148759986
Q gi|254780709|r  190 QAKKVDVLIID  200 (321)
Q Consensus       190 ~~~~~DvvliD  200 (321)
                      ...+-|.|++-
T Consensus        97 LR~~pd~iivG  107 (186)
T cd01130          97 LRMRPDRIIVG  107 (186)
T ss_pred             CCCCCCEEECC
T ss_conf             66899737317


No 339
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=96.42  E-value=0.0036  Score=42.56  Aligned_cols=57  Identities=19%  Similarity=0.482  Sum_probs=47.8

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH-----------HHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456-----------8899999753
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA-----------IDQLKIWADR  164 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA-----------~eQL~~~a~~  164 (321)
                      .++|.++.|.|+.|+||||-+-.|...|...|+++.+.-.|..|.|=           .|.++-.|+.
T Consensus       440 g~~~~~iw~tGlsgsGKstiA~~le~~L~~~g~~~~~LDGd~lR~gl~~dlgf~~~dR~enirR~~ev  507 (613)
T PRK05506        440 GQKPATVWFTGLSGSGKSTIANLVERRLHALGRHTYVLDGDNVRHGLNRDLGFTDADRVENIRRVAEV  507 (613)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             89976999977898974799999999999779987998808987410457797989999999999999


No 340
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=96.40  E-value=0.026  Score=36.53  Aligned_cols=38  Identities=21%  Similarity=0.354  Sum_probs=27.5

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             41231135444442478999999985226742677434
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD  148 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D  148 (321)
                      -.++.++||||+||||.+-=++-.++-..-+|.+-.-+
T Consensus        27 Ge~~~lvGpnGaGKSTLl~~i~Gl~~p~~G~I~~~G~~   64 (255)
T PRK11248         27 GELLVVLGPSGCGKTTLLNLIAGFVPPQHGSITLDGKP   64 (255)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCCC
T ss_conf             98999999998469999999975998899718579964


No 341
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=96.40  E-value=0.0042  Score=42.06  Aligned_cols=47  Identities=32%  Similarity=0.541  Sum_probs=43.1

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             66741231135444442478999999985226742677434512456
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
                      ..+|.+|-|.|+-|+||||-+-.|+..+..+|+++-+.-.|.-|-+=
T Consensus        20 ~~~~~viW~TGLSGsGKSTiA~ale~~L~~~G~~~y~LDGDnvR~gL   66 (197)
T COG0529          20 GQKGAVIWFTGLSGSGKSTIANALEEKLFAKGYHVYLLDGDNVRHGL   66 (197)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHCC
T ss_conf             79985999646888878799999999999759758985574676500


No 342
>PRK05632 phosphate acetyltransferase; Reviewed
Probab=96.38  E-value=0.11  Score=32.20  Aligned_cols=31  Identities=32%  Similarity=0.437  Sum_probs=20.7

Q ss_pred             EECCCC-CCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             311354-4444247899999998522674267
Q gi|254780709|r  114 ILVVGV-NGVGKTTVIGKLSKKMSDAGLKVML  144 (321)
Q Consensus       114 il~vG~-nG~GKTTT~aKLA~~~~~~g~kV~l  144 (321)
                      |+++.. .|+||||.+==|...+.++|.||+.
T Consensus         4 IyIa~te~~sGKTsVaLGL~~aL~r~g~KVGf   35 (702)
T PRK05632          4 IYLAPTGTGVGLTSVSLGLVRALERKGVKVGF   35 (702)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99962799987999999999999836884799


No 343
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.38  E-value=0.0052  Score=41.46  Aligned_cols=54  Identities=22%  Similarity=0.233  Sum_probs=37.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             412311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      -.++.++|+||+||||.+-=|+-.++-..-+|.+-.-|+-......++   ..++|+
T Consensus        28 Ge~vaiiG~nGsGKSTL~~~l~Gll~P~~G~I~v~G~d~~~~~~~~~~---r~~ig~   81 (274)
T PRK13644         28 GEYIGIIGKNGSGKSTLALHLNGLLRPQKGKVLVSGIDTGDFSKLQGI---RKLVGI   81 (274)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHH---HHHEEE
T ss_conf             999999999998099999999706858887299999987870567999---873179


No 344
>PRK13342 recombination factor protein RarA; Reviewed
Probab=96.38  E-value=0.011  Score=39.07  Aligned_cols=28  Identities=25%  Similarity=0.356  Sum_probs=20.0

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6741231135444442478999999985
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      +++.-++|-||.|+||||.+-=||+.+.
T Consensus        35 ~~~~s~Il~GPPG~GKTTlA~iiA~~~~   62 (417)
T PRK13342         35 GRLSSMILWGPPGTGKTTLARIIAGATD   62 (417)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             9997599889699989999999999868


No 345
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345   These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. .
Probab=96.35  E-value=0.019  Score=37.50  Aligned_cols=173  Identities=21%  Similarity=0.225  Sum_probs=89.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCC-C-----------CEEEEECCCCCHHHHHHHHHHHHHHCCCCCCC-CCCCC
Q ss_conf             41231135444442478999999985226-7-----------42677434512456889999975303532122-35866
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAG-L-----------KVMLAAGDTFRSAAIDQLKIWADRTSADFVCS-EIGSD  177 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g-~-----------kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~-~~~~d  177 (321)
                      ..|+.+.|=+|.||||++-=++..|.+.+ .           -..+-||-|=|||=  ||...--+.-..++.. .++.|
T Consensus       365 ~Kv~iLTGGPGTGKtT~t~~i~~~~~~~~gl~l~~~~~vndd~~v~LaAPTGrAAk--Rl~E~TG~~a~TIHRLlG~~~~  442 (769)
T TIGR01448       365 DKVVILTGGPGTGKTTITKAIIELYEELKGLDLDKDDYVNDDLPVVLAAPTGRAAK--RLAEVTGLEALTIHRLLGYGSD  442 (769)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCHHHHH--HCCCCCCCHHHHHHHHHCCCCC
T ss_conf             94899857788861689999999998716877553124567764887377437888--5110026212347786368988


Q ss_pred             CHHHHHH-HHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCC--EEEEECCCCC------CHHHHHH
Q ss_conf             1245422-89999651487599865433321157789999899876302223430--1123102335------2257789
Q gi|254780709|r  178 AAALAYE-AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPH--SVLQVLDATT------GQNALRQ  248 (321)
Q Consensus       178 p~~v~~~-a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~--~~~lVlda~~------gq~~~~~  248 (321)
                        .-.++ -++  ..=+||+||||=.+.  .|.-||..|-..          -|+  ..+||-|+-.      ||--.+-
T Consensus       443 --~~~~~k~~~--~~~~~DL~IvDE~SM--~Dt~L~~~lL~a----------~P~~a~lllVGD~DQLPSV~pG~VL~DL  506 (769)
T TIGR01448       443 --TKSENKNLE--DPIDADLLIVDESSM--VDTWLASSLLAA----------VPDHARLLLVGDADQLPSVGPGQVLKDL  506 (769)
T ss_pred             --CCCCCHHHC--CCCCCCEEEEECCCH--HHHHHHHHHHHH----------CCCCCEEEEECCCCCCCCCCCCHHHHHH
T ss_conf             --873211011--347877699814621--889999999861----------7977779888376888988644089999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEE-EEECCCCCCCCCCCCHHH
Q ss_conf             998764358976999654578706999999999769889-997589813255577899
Q gi|254780709|r  249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVY-FLGVGEGINDLEPFVAKD  305 (321)
Q Consensus       249 a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~-fig~Ge~i~Dl~~f~~~~  305 (321)
                      ++  .+.+|.  +=|||.===+.+-.++..+.....-.. -+-..+.-.|+..+..++
T Consensus       507 i~--s~~iP~--~~LT~vyRQ~~~S~Ii~~Ah~~~~G~~Pvlnss~~~~Df~~~~~~~  560 (769)
T TIGR01448       507 IQ--SKVIPV--TRLTKVYRQAEGSSIITLAHKILQGEAPVLNSSSAKKDFKFLKLDR  560 (769)
T ss_pred             HH--CCCCCE--EECCCEEEECCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             84--688661--2121112411366467888987317887523244676677776400


No 346
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=96.35  E-value=0.053  Score=34.36  Aligned_cols=140  Identities=17%  Similarity=0.230  Sum_probs=75.2

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      .-|+++|-.|||||+-+-++...--..                     .|...+|+++....       +-.      ..
T Consensus         4 ~KivlvGd~~vGKTsli~r~~~~~f~~---------------------~~~~Tig~~~~~k~-------v~~------~~   49 (167)
T cd01867           4 FKLLLIGDSGVGKSCLLLRFSEDSFNP---------------------SFISTIGIDFKIRT-------IEL------DG   49 (167)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCCC---------------------CCCCCCCEEEEEEE-------EEE------CC
T ss_conf             999999999978899999996099999---------------------86898646889999-------999------99


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHC----C--CC-EEEEE
Q ss_conf             14875998654333211577899998998763022234301123102335225778999876435----8--97-69996
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVA----G--TT-GLIMT  264 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~----~--~~-g~I~T  264 (321)
                      +.+.+-|.||||.-...     .+....  .     ...+-.+||.|.+. +++++.++.+.+.+    +  +- -+|-+
T Consensus        50 ~~i~l~iwDt~G~e~~~-----~~~~~y--~-----~~a~~~ilvfdit~-~~Sf~~~~~w~~~i~~~~~~~~~~ilVgN  116 (167)
T cd01867          50 KKIKLQIWDTAGQERFR-----TITTAY--Y-----RGAMGIILVYDITD-EKSFENIRNWMRNIEEHASEDVERMLVGN  116 (167)
T ss_pred             EEEEEEEEECCCCCCHH-----HHHHHH--H-----HHCCEEEEECCCCC-HHHHHHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             99999999899970011-----667998--5-----65058899556898-79999999999999986699970576421


Q ss_pred             CCCCCC----CHHHHHHHHHHHCCCEEEEEC--CCCCCCC
Q ss_conf             545787----069999999997698899975--8981325
Q gi|254780709|r  265 KMDGTA----RGGGLIPIVVTHKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       265 KlD~ta----~~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl  298 (321)
                      |.|-..    ..--+-..+...+.|...++.  |++|+++
T Consensus       117 K~Dl~~~r~v~~~e~~~~a~~~~~~~~e~SAktg~nI~e~  156 (167)
T cd01867         117 KCDMEEKRVVSKEEGEALADEYGIKFLETSAKANINVEEA  156 (167)
T ss_pred             CCCCHHCCCCCHHHHHHHHHHHCCEEEEECCCCCCCHHHH
T ss_conf             2450230779999999999980996999822579078999


No 347
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism]
Probab=96.34  E-value=0.11  Score=32.05  Aligned_cols=163  Identities=19%  Similarity=0.213  Sum_probs=90.2

Q ss_pred             EECCCC-CCCCHHHHHHHHHHHHHHCCCCEEE---EECCCCCHH---HHHHHHHHHHHHC----CCCCCCCCCCCCHH--
Q ss_conf             311354-4444247899999998522674267---743451245---6889999975303----53212235866124--
Q gi|254780709|r  114 ILVVGV-NGVGKTTVIGKLSKKMSDAGLKVML---AAGDTFRSA---AIDQLKIWADRTS----ADFVCSEIGSDAAA--  180 (321)
Q Consensus       114 il~vG~-nG~GKTTT~aKLA~~~~~~g~kV~l---va~DtfR~a---A~eQL~~~a~~~~----v~~~~~~~~~dp~~--  180 (321)
                      +.+.|- +|+|||...+=||++++.+|.+|..   |.+.+...+   -.+.|+..+...-    +..|.-....-|.-  
T Consensus         5 ~fVtGTDT~VGKTv~S~aL~~~l~~~g~~~~~~KPVqsG~~~~~~~~D~~~l~~~~~~~~~~~~~~py~f~~P~sPhlAa   84 (223)
T COG0132           5 FFVTGTDTGVGKTVVSAALAQALKQQGYSVAGYKPVQTGSEETAENSDALVLQRLSGLDLSYELINPYRFKEPLSPHLAA   84 (223)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCEEECCCCCCCCCHHHHHHHHCCCCCCCCCCCCEECCCCCCCHHHH
T ss_conf             99982799964999999999999968970598775221787789974599999851998663354335307888847778


Q ss_pred             ------HHH----HHHHHHHHHCCCEEEEECCCCC--CCHHH-HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--HH
Q ss_conf             ------542----2899996514875998654333--21157-789999899876302223430112310233522--57
Q gi|254780709|r  181 ------LAY----EAFKQAQAKKVDVLIIDTAGRL--HNNSI-LMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--NA  245 (321)
Q Consensus       181 ------v~~----~a~~~a~~~~~DvvliDTAGR~--~~~~~-lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--~~  245 (321)
                            |-.    +.+... .+.||.|||--||=+  +..++ .+.   ++.+..       -..++||...-.|-  .+
T Consensus        85 ~~eg~~I~~~~l~~~l~~l-~~~~d~vlVEGAGGl~vPl~~~~~~~---D~~~~~-------~lpvILV~~~~LGtINHt  153 (223)
T COG0132          85 ELEGRTIDLEKLSQGLRQL-LKKYDLVLVEGAGGLLVPLTEEYTFA---DLAVQL-------QLPVILVVGIKLGTINHT  153 (223)
T ss_pred             HHCCCCCCHHHHHHHHHHH-HCCCCEEEEECCCCEEEECCCCCCHH---HHHHHC-------CCCEEEEECCCCCHHHHH
T ss_conf             7648935699998788854-05467899967873333257865299---999980-------999999966775778799


Q ss_pred             HHHHHHH-HHHCCCCEEEEECCCCCCCHHHHH--HHHHHHCCCEE
Q ss_conf             7899987-643589769996545787069999--99999769889
Q gi|254780709|r  246 LRQVEMF-HAVAGTTGLIMTKMDGTARGGGLI--PIVVTHKIPVY  287 (321)
Q Consensus       246 ~~~a~~F-~~~~~~~g~I~TKlD~ta~~G~~l--s~~~~~~~Pi~  287 (321)
                      +=.++.- +.-+++-|+|+-........=...  .+...++.|+.
T Consensus       154 lLt~eal~~~gl~l~G~I~n~~~~~~~~~~~~~~~l~~~~~~p~~  198 (223)
T COG0132         154 LLTVEALRARGLPLAGWVANGINPELDHYAEINATLLKRIGAPLL  198 (223)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             999999997799878999726788555788889999974289743


No 348
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.34  E-value=0.0063  Score=40.84  Aligned_cols=164  Identities=12%  Similarity=0.068  Sum_probs=73.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -.++.++|+||+||||.+-=|+..+.-..-+|.+-.-|.-..    .+..+..++|. +|..+...-+...+++-+.++.
T Consensus        30 GE~vaivG~nGsGKSTL~~~l~Gll~p~~G~I~i~G~~i~~~----~~~~lr~~ig~-VfQ~p~~~~~~~tV~e~i~fgl  104 (276)
T PRK13650         30 GEWLSIIGHNGSGKSTTVRLIDGLLEAESGSIIIDGDLLTEE----NVWEIRHKIGM-VFQNPDNQFVGATVEDDVAFGL  104 (276)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCC----CHHHHHHCEEE-EEECCCHHCCCCCHHHHHHHHH
T ss_conf             989999999998799999999738898860899999999867----76887641469-9767201056363999998799


Q ss_pred             H-HCCC--------------EEEEECCCCCCCHH-HHHHHHHHHHHHHHCCCCCCCCEEEEECCC-CCCHHHHHH-----
Q ss_conf             5-1487--------------59986543332115-778999989987630222343011231023-352257789-----
Q gi|254780709|r  191 A-KKVD--------------VLIIDTAGRLHNNS-ILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-TTGQNALRQ-----  248 (321)
Q Consensus       191 ~-~~~D--------------vvliDTAGR~~~~~-~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-~~gq~~~~~-----  248 (321)
                      . .+.+              +=+-|-+-|.+..- -=+.+...|.+++-    ..|.  +|++|= |++.|...+     
T Consensus       105 ~~~g~~~~e~~~rv~~~l~~~gl~~~~~r~p~~LSGGQrQRvaIA~aLa----~~P~--lLilDEPTs~LD~~~~~~i~~  178 (276)
T PRK13650        105 ENKGIPHEEMKERVNEALELVGMQDFKEREPARLSGGQKQRVAIAGAVA----MRPK--IIILDEATSMLDPEGRLELIK  178 (276)
T ss_pred             HHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHH----CCCC--EEEEECCCCCCCHHHHHHHHH
T ss_conf             8779999999999999998779924553890338999999999999997----3999--999838866589999999999


Q ss_pred             -HHHHHHHCCCCEEEEEC-CCCCCCHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             -99876435897699965-4578706999999999769889997589813
Q gi|254780709|r  249 -VEMFHAVAGTTGLIMTK-MDGTARGGGLIPIVVTHKIPVYFLGVGEGIN  296 (321)
Q Consensus       249 -a~~F~~~~~~~g~I~TK-lD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~  296 (321)
                       .+..++..+.|-+++|- ||.      +    . .---|..+-.|+-+.
T Consensus       179 ~l~~l~~~~g~Tvi~iTHdl~~------v----~-~aDrvivm~~G~Iv~  217 (276)
T PRK13650        179 TIKNIRDDYQLTVISITHDLDE------V----A-LSDRVLVMKDGQVES  217 (276)
T ss_pred             HHHHHHHHCCCEEEEEEECHHH------H----H-CCCEEEEEECCEEEE
T ss_conf             9999998429899999577899------9----6-099999998999999


No 349
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=96.33  E-value=0.038  Score=35.35  Aligned_cols=81  Identities=28%  Similarity=0.409  Sum_probs=54.7

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      ++.-++|.|+.|+|||--++=+|+.+.+.|.+|+++++--    -+.+|+.--..          +.-...     +.. 
T Consensus       104 ~~~nl~l~G~~G~GKthLa~Ai~~~l~~~g~sv~f~~~~e----l~~~Lk~~~~~----------~~~~~~-----l~~-  163 (254)
T COG1484         104 RGENLVLLGPPGVGKTHLAIAIGNELLKAGISVLFITAPD----LLSKLKAAFDE----------GRLEEK-----LLR-  163 (254)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH----HHHHHHHHHHC----------CCHHHH-----HHH-
T ss_conf             5882899899998799999999999998398499988599----99999998745----------526899-----998-


Q ss_pred             HHHCCCEEEEECCCCCCCHHH
Q ss_conf             651487599865433321157
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSI  210 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~  210 (321)
                      ...++||++||--|=.+.+..
T Consensus       164 ~l~~~dlLIiDDlG~~~~~~~  184 (254)
T COG1484         164 ELKKVDLLIIDDIGYEPFSQE  184 (254)
T ss_pred             HHHHCCEEEEECCCCCCCCCH
T ss_conf             875289899823677668815


No 350
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.33  E-value=0.0058  Score=41.11  Aligned_cols=61  Identities=13%  Similarity=0.063  Sum_probs=34.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             412311354444424789999999852267426774345124568899999753035321223
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSE  173 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~  173 (321)
                      -..+.++|+||+||||.+-=|+..+.-.....+-+..|-...... .+..+.+++|. +|..+
T Consensus        34 Ge~vaiiG~nGsGKSTL~~~l~Gll~P~~~~~G~i~~~g~~i~~~-~~~~lr~~vg~-VfQ~P   94 (283)
T PRK13640         34 GSWTALIGHNGSGKSTISKLINGLLLPDDNPKSKITVDGITLTAK-TVWDIREKVGI-VFQNP   94 (283)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCEECCCC-CHHHHHHCEEE-EEECC
T ss_conf             999999999998799999999640378888617999999999967-98899626189-98688


No 351
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=96.32  E-value=0.02  Score=37.32  Aligned_cols=176  Identities=17%  Similarity=0.202  Sum_probs=95.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH----------HCCCC--CCCCCCCCC
Q ss_conf             412311354444424789999999852267426774345124568899999753----------03532--122358661
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR----------TSADF--VCSEIGSDA  178 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~----------~~v~~--~~~~~~~dp  178 (321)
                      |..+++-|.||.|||--+..+++=+-.+|++|..+++-.==-.=+.|....+--          .=+|+  ++...+..+
T Consensus        28 GsL~lIEGd~~tGKSvLsqr~~YG~L~~g~~v~yvsTe~T~refi~qm~sl~ydv~~~~l~G~l~~~~~~~~~~~~~~~~  107 (235)
T COG2874          28 GSLILIEGDNGTGKSVLSQRFAYGFLMNGYRVTYVSTELTVREFIKQMESLSYDVSDFLLSGRLLFFPVNLEPVNWGRRS  107 (235)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHCCCCCHHHHHCCEEEEEEECCCCCCCCHHH
T ss_conf             76999988898548899999999887089548999840359999998886388716877506268999324542257377


Q ss_pred             H-HHHHHHHHHHHHHCCCEEEEECCCCCCCHH------HHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             2-454228999965148759986543332115------778999989987630222343011231023352257789998
Q gi|254780709|r  179 A-ALAYEAFKQAQAKKVDVLIIDTAGRLHNNS------ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM  251 (321)
Q Consensus       179 ~-~v~~~a~~~a~~~~~DvvliDTAGR~~~~~------~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~  251 (321)
                      + +....-++.-+..+.||+|||+---...+.      +.|..++++..-        ---++++    ..|.+++..-.
T Consensus       108 ~~~~L~~l~~~~k~~~~dViIIDSls~~~~~~~~~~vl~fm~~~r~l~d~--------gKvIilT----vhp~~l~e~~~  175 (235)
T COG2874         108 ARKLLDLLLEFIKRWEKDVIIIDSLSAFATYDSEDAVLNFMTFLRKLSDL--------GKVIILT----VHPSALDEDVL  175 (235)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHHHHCCCHHHHHHHHHHHHHHHHC--------CCEEEEE----ECHHHCCHHHH
T ss_conf             89999999755775237789995343776526499999999999998728--------9789999----47343378999


Q ss_pred             HHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHH
Q ss_conf             76435897699965457870699999999976988999758981325557789
Q gi|254780709|r  252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK  304 (321)
Q Consensus       252 F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~  304 (321)
                      +.=..--|..+.  |--..=||-..++..    -++|-|.++.+.++-+|+.+
T Consensus       176 ~rirs~~d~~l~--L~~~~~Gg~~~~~~~----i~K~~ga~~s~~~~I~F~V~  222 (235)
T COG2874         176 TRIRSACDVYLR--LRLEELGGDLIKVLE----IVKYRGARKSFQNIISFRVE  222 (235)
T ss_pred             HHHHHHHHEEEE--EEHHHHCCEEEEEEE----EEEECCCHHHCCCCEEEEEC
T ss_conf             999875202589--870231784558778----76654713321774058855


No 352
>PRK07132 DNA polymerase III subunit delta'; Validated
Probab=96.31  E-value=0.019  Score=37.53  Aligned_cols=121  Identities=12%  Similarity=0.096  Sum_probs=62.3

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH-HHHHH
Q ss_conf             6674123113544444247899999998522-674267743451245688999997530353212235866124-54228
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDA-GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA-LAYEA  185 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~-g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~-v~~~a  185 (321)
                      ..-|+.++|.|+.|+||||++..+|+.+-.. +....  .|+            +.  .++..+. ..+.+-++ -..+.
T Consensus        17 ~klsHAYLF~G~~G~Gk~~~a~~~a~~l~~~~~~~~~--~~~------------~~--~~~~~id-~~~~~i~~~~i~~~   79 (303)
T PRK07132         17 NKISHSFLLKSNYNNDLDESILYFLNKFNNLQSLNLN--LEE------------LP--YNIFLFD-IFDEDLSKEEFLSA   79 (303)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC--CCC------------CC--CCCEEEC-CCCCCHHHHHHHHH
T ss_conf             9976168867899867999999999997299878887--545------------65--3230413-32220016889999


Q ss_pred             HHHHH-----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99996-----5148759986543332115778999989987630222343011231023352257789998764
Q gi|254780709|r  186 FKQAQ-----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA  254 (321)
Q Consensus       186 ~~~a~-----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~  254 (321)
                      ++...     ..++-+++||-|-++.....         +++=|..+..|..+++.+-++..+.....+..=++
T Consensus        80 i~~~~~~~~~~~~~Kv~IIdea~~lt~~A~---------NaLLKtLEEPp~~~~fil~t~~~~~il~TI~SRCq  144 (303)
T PRK07132         80 IEKFSFSSFVSNQKKILIIKNIEKTSNSSL---------NALLKTIEEPSKNTYFLLTTKNINKVIPTIVSRCQ  144 (303)
T ss_pred             HHHHHHCCCCCCCEEEEEEECHHHCCHHHH---------HHHHHHCCCCCCCEEEEEEECCHHHCCHHHHHCCE
T ss_conf             999973665568706999816553399999---------99998703898684899972882438377863665


No 353
>PRK06762 hypothetical protein; Provisional
Probab=96.31  E-value=0.01  Score=39.35  Aligned_cols=90  Identities=19%  Similarity=0.315  Sum_probs=50.1

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      +..|.+=|.-||||||++..|-.+|   |..++||+-|+.|=   +=|+.          ...+|.-...+....+.++.
T Consensus         2 t~LIiiRGNSgSGKtT~Ak~L~~~~---G~g~lLvsQD~vRR---~mLr~----------kD~~g~~~i~Li~~~~~yg~   65 (166)
T PRK06762          2 TTLIIIRGNSGSGKTTIAKQLQERL---GRGTLLVSQDVVRR---DMLRV----------KDGPGNLSIDLIEQLVRYGL   65 (166)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEHHHHHH---HHHHC----------CCCCCCCCHHHHHHHHHHHH
T ss_conf             5289997888888789999999986---88857853758999---98405----------57799978689999999998


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             514875998654333211577899998
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGK  217 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~k  217 (321)
                      .++ +.||+.--=.......+..+|..
T Consensus        66 ~~~-~~VIlEGIL~a~~Yg~ml~~l~~   91 (166)
T PRK06762         66 QHC-EFVILEGILNSDRYGPMLKELIH   91 (166)
T ss_pred             HCC-CEEEEEEECCHHHHHHHHHHHHH
T ss_conf             569-98999741004489999999998


No 354
>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional
Probab=96.30  E-value=0.011  Score=39.16  Aligned_cols=27  Identities=41%  Similarity=0.661  Sum_probs=20.2

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             674123113544444247899999998
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKM  135 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~  135 (321)
                      -.|.-|+|+||+|||||--+-.||...
T Consensus        48 i~pkNILmIGPTGvGKTeIARrLAkl~   74 (442)
T PRK05201         48 VTPKNILMIGPTGVGKTEIARRLAKLA   74 (442)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             464316887888866789999999984


No 355
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344   This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. C-terminal part of the protein matches a domain found in viral RNA helicase, superfamily 1, IPR000606 from INTERPRO. ; GO: 0008854 exodeoxyribonuclease V activity, 0009338 exodeoxyribonuclease V complex.
Probab=96.30  E-value=0.0046  Score=41.81  Aligned_cols=123  Identities=21%  Similarity=0.240  Sum_probs=69.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHH-HHHH---HCCCC-E-EEEECCCCCHHHH--HHHHHHHHHHCCC---CCCCCCCCCCH
Q ss_conf             4123113544444247899999-9985---22674-2-6774345124568--8999997530353---21223586612
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLS-KKMS---DAGLK-V-MLAAGDTFRSAAI--DQLKIWADRTSAD---FVCSEIGSDAA  179 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA-~~~~---~~g~k-V-~lva~DtfR~aA~--eQL~~~a~~~~v~---~~~~~~~~dp~  179 (321)
                      ....+++|=+|.|||||++||= +..+   .+|+- . .-+++-|=+|||-  |-|+.....+...   +=...-.+.|+
T Consensus       242 ~~f~li~GGPGTGKTTTv~~LL~al~~~~~~~G~~~~~I~l~APTGKAa~RL~esl~~~~~~L~~~~~aid~~~~~~~~~  321 (753)
T TIGR01447       242 SNFSLITGGPGTGKTTTVARLLLALIKQSPKQGKPRLRIALAAPTGKAAARLAESLRKAVKKLAAENMAIDEDLIAALPS  321 (753)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCH
T ss_conf             87689987988977899999999999989864997404788668447999999999988632234236658798548720


Q ss_pred             HHHHHHHHHHH--------------H--HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC---CCCCEEEEECCCC
Q ss_conf             45422899996--------------5--148759986543332115778999989987630222---3430112310233
Q gi|254780709|r  180 ALAYEAFKQAQ--------------A--KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDP---HAPHSVLQVLDAT  240 (321)
Q Consensus       180 ~v~~~a~~~a~--------------~--~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~---~~p~~~~lVlda~  240 (321)
                      .+  .+|.+.-              .  -.+||++||=|=  ..|-+||.-|.   +.+....-   -+.+.-+|+-|..
T Consensus       322 ~~--~TiHrLLG~~~I~~~~fr~h~~N~L~~DVLvvDEaS--MVdl~lm~kL~---~A~~~~~k~~KLy~~~LIllGD~n  394 (753)
T TIGR01447       322 EA--TTIHRLLGIKPIDTKRFRHHERNPLPLDVLVVDEAS--MVDLPLMAKLL---KALPPNTKDKKLYADRLILLGDKN  394 (753)
T ss_pred             HH--HHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEECCCH--HCCHHHHHHHH---HHCCCCCCCCCHHHCCCCEECCCC
T ss_conf             45--688886166147876776777788985527870600--22679999999---722630013201010200122678


No 356
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=96.30  E-value=0.013  Score=38.72  Aligned_cols=74  Identities=18%  Similarity=0.188  Sum_probs=42.9

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             412311354444424789999999852267426774345124568899999753035321223586612454228999
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~  188 (321)
                      -.++.++|+||+||||.+-=|+..++-..-+|.+-..|+...   ..+..+.+++|. +|..+...-....+++-+.+
T Consensus        37 GE~v~iiG~nGsGKSTL~r~l~gl~~P~~G~I~i~G~~~~~~---~~~~~~r~~ig~-vfQ~P~~~l~~~tV~e~i~f  110 (281)
T PRK13633         37 GEFLVILGHNGSGKSTIAKHMNALLLPSEGKVYVDGLDTSDE---ENLWDIRNKAGM-VFQNPDNQIVATIVEEDVAF  110 (281)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCH---HHHHHHHHCEEE-EEECCCCCCCHHHHHHHHHH
T ss_conf             989999999998499999999758878885699999987885---669998736089-86688642028899999998


No 357
>PTZ00035 Rad51; Provisional
Probab=96.29  E-value=0.12  Score=31.88  Aligned_cols=88  Identities=22%  Similarity=0.280  Sum_probs=50.2

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHH---HC-C--CCEEEE-ECCCCCHHHHHHHHHHHHHHCCC--------CCCCCCCC
Q ss_conf             1231135444442478999999985---22-6--742677-43451245688999997530353--------21223586
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMS---DA-G--LKVMLA-AGDTFRSAAIDQLKIWADRTSAD--------FVCSEIGS  176 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~---~~-g--~kV~lv-a~DtfR~aA~eQL~~~a~~~~v~--------~~~~~~~~  176 (321)
                      .+-=+.|..|+|||.-|--||-..+   .. |  -+|+.| +=.||||-=+.|+   |++.+.+        .|...+..
T Consensus       131 sITEi~Ge~gsGKTQlChqLaV~~QLP~~~GG~~GkvvYIDTEgtFrpeRi~qI---A~~~gld~~~vL~nI~~ara~n~  207 (350)
T PTZ00035        131 GITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRPERIVAI---AKRYGLHPTDCLNNIAYAKAYNC  207 (350)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHCCCCHHHCCCCCCEEEEECCCCCCHHHHHHH---HHHCCCCHHHHHHHEEEEEECCH
T ss_conf             587897279897899999999990485777798862799968899878999999---98709997998533223220687


Q ss_pred             C-CHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             6-1245422899996514875998654
Q gi|254780709|r  177 D-AAALAYEAFKQAQAKKVDVLIIDTA  202 (321)
Q Consensus       177 d-p~~v~~~a~~~a~~~~~DvvliDTA  202 (321)
                      | -..++..+.......++-+|+||.+
T Consensus       208 ehq~~ll~~~~~~~~e~~vrLlIVDSi  234 (350)
T PTZ00035        208 DHQTELLIDASAMMADARFALLIVDSA  234 (350)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEEHHH
T ss_conf             889999999999851167589985445


No 358
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.29  E-value=0.0055  Score=41.29  Aligned_cols=58  Identities=16%  Similarity=0.130  Sum_probs=36.6

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             4123113544444247899999998522674267743451245688999997530353
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~  168 (321)
                      -.++.++|+||+||||.+-=|+-.+.-..-+|.+-..|......-..++.+..++|.-
T Consensus        33 Ge~~aiiG~nGsGKSTLl~~l~Gl~~p~~G~i~~~g~~i~~~~~~~~~~~~~~~iG~v   90 (280)
T PRK13649         33 GSYTAFIGHTGSGKSTIMQLLNGLHVPTTGIVSVDDTDITSHSKNKEIKSIRKKVGLV   90 (280)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCHHHHHHHHHHEEEE
T ss_conf             9899999599986999999996699988608999999987778201399998764699


No 359
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.29  E-value=0.024  Score=36.79  Aligned_cols=182  Identities=17%  Similarity=0.149  Sum_probs=84.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -.++.++||+|+||||.+-=+|-.++-..-+|.+-.-|.......      -++++  ++.-.+.--|.--+++-+.+.-
T Consensus        25 Ge~~~iiGpSGsGKSTLlr~i~Gl~~p~~G~I~~~G~di~~~~~~------~r~ig--~vfQ~~~Lfp~~tV~eNi~~~l   96 (235)
T cd03299          25 GDYFVILGPTGSGKSVLLETIAGFIKPDSGKILLNGKDITNLPPE------KRDIS--YVPQNYALFPHMTVYKNIAYGL   96 (235)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHH------HCCEE--EECCCCCCCCCCCHHHHHHHHH
T ss_conf             989999999963599999999749999965999999999999976------78978--9457986689990999999999


Q ss_pred             H-HC-------------CCEEEE-ECCCCCCCH-HHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-CCCH------HHHH
Q ss_conf             5-14-------------875998-654333211-5778999989987630222343011231023-3522------5778
Q gi|254780709|r  191 A-KK-------------VDVLII-DTAGRLHNN-SILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-TTGQ------NALR  247 (321)
Q Consensus       191 ~-~~-------------~Dvvli-DTAGR~~~~-~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-~~gq------~~~~  247 (321)
                      . ++             .+.+=+ +-+.|.+.+ .-=|++-..|-|++-    ..|.  +|.+|= +++.      +..+
T Consensus        97 ~~~~~~~~e~~~rv~e~l~~~gl~~~~~~~p~~LSGGq~QRVaiARAl~----~~P~--llllDEP~s~LD~~~~~~i~~  170 (235)
T cd03299          97 KKRKVDKKEIERKVLEIAEMLGIDHLLNRKPETLSGGEQQRVAIARALV----VNPK--ILLLDEPFSALDVRTKEKLRE  170 (235)
T ss_pred             HHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHH----CCCC--EEEEECCCCCCCHHHHHHHHH
T ss_conf             8769999999999999998779977874894458999999999999997----3899--899928876469999999999


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCC-----CCHHHHHHHHCCCCC
Q ss_conf             99987643589769996545787069999999997698899975898132555-----778999998728656
Q gi|254780709|r  248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP-----FVAKDFSAVITGCLD  315 (321)
Q Consensus       248 ~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~-----f~~~~~~~~llG~gd  315 (321)
                      ..+..++..++|-+++|-=         ++.+....=-|.++-.|+-+..=.|     =-...|+.+++|.-+
T Consensus       171 ~l~~l~~~~~~T~i~vTHd---------~~~a~~~aDri~vl~~G~iv~~G~p~ev~~~P~~~~~a~flG~~n  234 (235)
T cd03299         171 ELKKIRKEFGVTVLHVTHD---------FEEAWALADKVAIMLNGKLIQVGKPEEVFKKPKNEFVAEFLGFNN  234 (235)
T ss_pred             HHHHHHHHHCCEEEEECCC---------HHHHHHHCCEEEEEECCEEEEECCHHHHHHCCCCHHHHHHCCCCC
T ss_conf             9999999829999998789---------999999699999998999999868899985899879998458132


No 360
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=96.28  E-value=0.012  Score=38.83  Aligned_cols=82  Identities=24%  Similarity=0.304  Sum_probs=42.7

Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHH-----HH
Q ss_conf             9999999998751278998999999999878520100121000136674123113544444247899999998-----52
Q gi|254780709|r   63 AQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKM-----SD  137 (321)
Q Consensus        63 a~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~-----~~  137 (321)
                      -++|++.+-+...+++-....+--.|+.-++....+  ..  +...-.|.-|+|+||+|||||--+-.||...     |-
T Consensus         6 PreIV~eLd~yIIGQ~~AKkaVAIALRNR~RR~qL~--~~--lr~EV~PKNILMIGpTGVGKTEIARRLAkl~~aPFiKV   81 (444)
T COG1220           6 PREIVSELDRYIIGQDEAKKAVAIALRNRWRRMQLE--EE--LRDEVTPKNILMIGPTGVGKTEIARRLAKLAGAPFIKV   81 (444)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC--HH--HHHCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEE
T ss_conf             799999987674071777889999999899997547--87--76225755358888888768899999999848983788


Q ss_pred             C--CC-CEEEEECC
Q ss_conf             2--67-42677434
Q gi|254780709|r  138 A--GL-KVMLAAGD  148 (321)
Q Consensus       138 ~--g~-kV~lva~D  148 (321)
                      +  .. .|+.|.-|
T Consensus        82 EATKfTEVGYVGrD   95 (444)
T COG1220          82 EATKFTEVGYVGRD   95 (444)
T ss_pred             EEEEEEECCCCCCC
T ss_conf             76421340325645


No 361
>PRK08699 DNA polymerase III subunit delta'; Validated
Probab=96.28  E-value=0.016  Score=38.08  Aligned_cols=130  Identities=18%  Similarity=0.181  Sum_probs=63.4

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCC-----CCCCCCHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122-----3586612454
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCS-----EIGSDAAALA  182 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~-----~~~~dp~~v~  182 (321)
                      ..-|+-++|.||.|+||++.+--+|+.+.=+.....-.+|..-+.-.   +-.-+..-++-++..     +.|.....|-
T Consensus        18 ~rl~HA~L~~Gp~G~Gk~~~A~~~A~~llC~~~~~~~~~Cg~C~sC~---~~~~g~HPD~~~i~p~~~~~~~g~~~~~I~   94 (325)
T PRK08699         18 ERRPNAWLFVGKKGTGKTAFARFAAKALLCETPAPGCKPCGECMSCH---LFGQGSHPDFYEITPLADEPENGRKLLQIK   94 (325)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH---HHHCCCCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             45011797579999789999999999982899988899898888899---986599999688513445300166556676


Q ss_pred             HHHHHH----HH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             228999----96----51487599865433321157789999899876302223430112310233522577899
Q gi|254780709|r  183 YEAFKQ----AQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV  249 (321)
Q Consensus       183 ~~a~~~----a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a  249 (321)
                      -+.+..    +.    ..++-|+|||-|-||.....  +-|-|       ..+..|..+++++=+...+.....+
T Consensus        95 idqiR~l~~~~~~~~~~~~~kV~ii~~ae~mn~~aa--NaLLK-------~LEEPp~~~~fiL~t~~~~~llpTI  160 (325)
T PRK08699         95 IDAVREIIDNVYLTSVRGGLRVILIHPAESMNVQAA--NSLLK-------VLEEPPPQVVFLLVSHAADKVLPTI  160 (325)
T ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEECCHHHHCHHHH--HHHHH-------HHCCCCCCEEEEEEECCHHHCCCHH
T ss_conf             999999999971086568946999857777589999--99999-------8417888848999879846462339


No 362
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=96.27  E-value=0.0051  Score=41.51  Aligned_cols=139  Identities=19%  Similarity=0.285  Sum_probs=72.5

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             36674123113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      +.++..-|+++|+.||||||-+-++.     .|..+--                      +|.++.    +...      
T Consensus         9 f~kk~~kililG~~~~GKTsil~~l~-----~~~~~~~----------------------~pTvg~----~~~~------   51 (175)
T smart00177        9 FGNKEMRILMVGLDAAGKTTILYKLK-----LGESVTT----------------------IPTIGF----NVET------   51 (175)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHH-----CCCCCCC----------------------CCCCCC----EEEE------
T ss_conf             37888999999889999899999996-----5997775----------------------797881----0799------


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHC---CCC---
Q ss_conf             999651487599865433321157789999899876302223430112310233522577899-9876435---897---
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVA---GTT---  259 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~---~~~---  259 (321)
                        ...+++.+.+-||||.-.     ++.|      ...+.. ..+=+++|+|++-.+ .++.+ ..+++.+   .+.   
T Consensus        52 --~~~~~~~l~iwD~~Gqe~-----~r~l------~~~Yy~-~a~~iIfVvD~sd~~-~~~~~~~~l~~~l~~~~~~~~p  116 (175)
T smart00177       52 --VTYKNISFTVWDVGGQDK-----IRPL------WRHYYT-NTQGLIFVVDSNDRD-RIDEAREELHRMLNEDELRDAV  116 (175)
T ss_pred             --EEECCEEEEEEECCCCCC-----CCHH------HHHHCC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHCCHHHCCCE
T ss_conf             --998989999998999854-----5536------777557-761899998668778-9999999999996315316986


Q ss_pred             -EEEEECCCC-CCCH----HHHHHHHHHHCCCEEEEE----CCCCCCC
Q ss_conf             -699965457-8706----999999999769889997----5898132
Q gi|254780709|r  260 -GLIMTKMDG-TARG----GGLIPIVVTHKIPVYFLG----VGEGIND  297 (321)
Q Consensus       260 -g~I~TKlD~-ta~~----G~~ls~~~~~~~Pi~fig----~Ge~i~D  297 (321)
                       =++..|.|- .+..    -..+......+.|..+..    +|+.|++
T Consensus       117 iLil~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~GI~e  164 (175)
T smart00177      117 ILVFANKQDLPDAMKAAEITEKLGLHSIRDRNWYIQPTCATSGDGLYE  164 (175)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHCHHHHCCCCEEEEEEECCCCCCHHH
T ss_conf             999984566767889999999968665407975999826878969899


No 363
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=96.26  E-value=0.033  Score=35.77  Aligned_cols=139  Identities=19%  Similarity=0.327  Sum_probs=72.8

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      -|+++|-.|||||+-+-++..---.....                     ..++.+++....       ..      ...
T Consensus         2 Ki~vvG~~~vGKTsli~r~~~~~f~~~~~---------------------~ti~~~~~~k~i-------~~------~~~   47 (162)
T cd04123           2 KVVLLGEGRVGKTSLVLRYVENKFNEKHE---------------------STTQASFFQKTV-------NI------GGK   47 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCCCCC---------------------CCCEEEEEEEEE-------EE------CCE
T ss_conf             89999999967999999998398998767---------------------752647999999-------99------999


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH----HHHCC--CC-EEEEEC
Q ss_conf             487599865433321157789999899876302223430112310233522577899987----64358--97-699965
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF----HAVAG--TT-GLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F----~~~~~--~~-g~I~TK  265 (321)
                      .+.+.|.||+|+.....     +...      + -...+-.++|.|.+. .++.+.++.+    .+..+  +. =+|-||
T Consensus        48 ~~~l~iwDt~G~~~~~~-----~~~~------~-~~~a~~~ilv~d~t~-~~Sf~~i~~~~~~i~~~~~~~~~iilvgnK  114 (162)
T cd04123          48 RIDLAIWDTAGQERYHA-----LGPI------Y-YRDADGAILVYDITD-ADSFQKVKKWIKELKQMRGNNISLVIVGNK  114 (162)
T ss_pred             EEEEEEEECCCCCCCCC-----CCHH------H-EECCCEEEEEEECCC-HHHHHHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             99999995899730355-----6313------3-011445799963899-899999999999999876999746866332


Q ss_pred             CCCCC----CHHHHHHHHHHHCCCEEEEE--CCCCCCCC
Q ss_conf             45787----06999999999769889997--58981325
Q gi|254780709|r  266 MDGTA----RGGGLIPIVVTHKIPVYFLG--VGEGINDL  298 (321)
Q Consensus       266 lD~ta----~~G~~ls~~~~~~~Pi~fig--~Ge~i~Dl  298 (321)
                      .|-..    ..=-+.+.+...+.|...++  +|++|+++
T Consensus       115 ~Dl~~~r~v~~~e~~~~a~~~~~~y~e~Sak~g~nV~e~  153 (162)
T cd04123         115 IDLERQRVVSKSEAEEYAKSVGAKHFETSAKTGKGIEEL  153 (162)
T ss_pred             CCCHHHCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHH
T ss_conf             132540888999999999982998999812788198999


No 364
>CHL00071 tufA elongation factor Tu
Probab=96.26  E-value=0.0081  Score=40.07  Aligned_cols=130  Identities=17%  Similarity=0.266  Sum_probs=68.4

Q ss_pred             CCCCCE-EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             667412-3113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  108 SHRPHV-ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       108 ~~~p~v-il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      +.+|++ |.++|==-+||||.++-|.+.+...+..-+-      +....+++.. -+.-|+.+       |.+..     
T Consensus         8 ~~k~~vni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~------~~~~~D~~~e-Er~rGiTi-------d~~~~-----   68 (409)
T CHL00071          8 RKKPHVNIGTIGHVDHGKTTLTAAITMTLAANGGAKGK------KYDEIDSAPE-EKARGITI-------NTAHV-----   68 (409)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHH------HHHHCCCCHH-HHHCCCEE-------EECEE-----
T ss_conf             89986999999545883999999986453004513343------1553237976-87369448-------80248-----


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCCCEEE--
Q ss_conf             9996514875998654333211577899998998763022234301123102335225--778999876435897699--
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGTTGLI--  262 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~~g~I--  262 (321)
                       ++...++.+.+||++|.-..=.|++.-            ....|-.+||+||..|--  -.+.+.. ...+++.-+|  
T Consensus        69 -~~et~~~~~~~iD~PGH~~fv~nmi~G------------as~aD~alLVV~A~~G~~~QTkEHl~l-~~~lgV~~~IVa  134 (409)
T CHL00071         69 -EYETENRHYAHVDCPGHADYVKNMITG------------AAQMDGAILVVSAADGPMPQTKEHILL-AKQVGVPNIVVF  134 (409)
T ss_pred             -EEECCCEEEEEEECCCHHHHHHHHHHH------------HCCCCCEEEEEECCCCCCCCHHHHHHH-HHHCCCCCEEEE
T ss_conf             -996287599998679678999998752------------301581289998687885004999999-997399936555


Q ss_pred             EECCCCCC
Q ss_conf             96545787
Q gi|254780709|r  263 MTKMDGTA  270 (321)
Q Consensus       263 ~TKlD~ta  270 (321)
                      +||+|.-.
T Consensus       135 vnKmD~v~  142 (409)
T CHL00071        135 LNKEDQVD  142 (409)
T ss_pred             EECCCCCC
T ss_conf             55679854


No 365
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=96.26  E-value=0.018  Score=37.68  Aligned_cols=86  Identities=17%  Similarity=0.197  Sum_probs=47.3

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCCCCCCCHHHHHHHHHHHH
Q ss_conf             1231135444442478999999985226742677434512456889999975303532-122358661245422899996
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      ..++|+||+|+|||..+--||.++....++...+.|=.|--     -...+.-+|.|- |..   .+..-...+++   +
T Consensus         4 ~~~l~~GPsGvGKT~lAk~la~~l~~~~~~~i~~dm~e~~~-----~~~v~~l~g~~~gyvg---~~~~G~l~~~v---~   72 (168)
T pfam07724         4 GSFLFLGPTGVGKTELAKALAELLFGDERALIRIDMSEYME-----EHSVSRLIGAPPGYVG---YEEGGQLTEAV---R   72 (168)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCC-----HHHHHHHCCCCCCCCC---CCCCCCHHHHH---H
T ss_conf             79998898998999999999999679853448855756542-----5699987058998726---24265078999---8


Q ss_pred             HHCCCEEEEECCCCCCCH
Q ss_conf             514875998654333211
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNN  208 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~  208 (321)
                      .+.+-||++|--...|.+
T Consensus        73 ~~p~~VillDEIeKa~~~   90 (168)
T pfam07724        73 RKPYSIVLIDEIEKAHPG   90 (168)
T ss_pred             HCCCCEEEEHHHHHHCHH
T ss_conf             389848986577665899


No 366
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]
Probab=96.25  E-value=0.014  Score=38.52  Aligned_cols=51  Identities=24%  Similarity=0.399  Sum_probs=39.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             4123113544444247899999998522674267743451245688999997
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWA  162 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a  162 (321)
                      ..-|.|=|+-|+||||-+..|+.++..+|.+|.+..=-+. --.-+.++.+.
T Consensus         3 g~fI~iEGiDGaGKTT~~~~L~~~l~~~g~~v~~trEP~~-~~ige~iR~~l   53 (208)
T COG0125           3 GMFIVIEGIDGAGKTTQAELLKERLEERGIKVVLTREPGG-TPIGEKIRELL   53 (208)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC-CHHHHHHHHHH
T ss_conf             6299997888898899999999999982980799868999-86999999997


No 367
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=96.23  E-value=0.0095  Score=39.60  Aligned_cols=58  Identities=21%  Similarity=0.190  Sum_probs=36.5

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-------------CCHHHH---HHHHHHHHHHCCC
Q ss_conf             412311354444424789999999852267426774345-------------124568---8999997530353
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-------------FRSAAI---DQLKIWADRTSAD  168 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-------------fR~aA~---eQL~~~a~~~~v~  168 (321)
                      -.++.++|+|||||||.+-=|+-.++-..-+|.+...|.             +.....   .+++.+..++|+=
T Consensus        33 GE~v~IiG~nGsGKSTL~k~l~Gll~P~~G~V~~~g~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~vG~v  106 (304)
T PRK13651         33 GEFIAIIGQTGSGKTTFIEHLNALLLPDTGTIEWIYFDEKNKEKKKVVEDPVIKLKFRKKLKKIKEIRRRVGVV  106 (304)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCEEEE
T ss_conf             98999987999859999999966999887169994245434554311343022134566666689877337999


No 368
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=96.22  E-value=0.01  Score=39.39  Aligned_cols=131  Identities=19%  Similarity=0.265  Sum_probs=65.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+++|+.||||||-+-.+.    . |.-+     +                 -+|.++    -+...+        ..++
T Consensus         2 il~lG~~~~GKTsll~~~~----~-~~~~-----~-----------------~~pTig----~~~~~i--------~~~~   42 (158)
T cd04151           2 ILILGLDNAGKTTILYRLQ----L-GEVV-----T-----------------TIPTIG----FNVETV--------TYKN   42 (158)
T ss_pred             EEEECCCCCCHHHHHHHHH----C-CCCC-----C-----------------CCCCCC----CCEEEE--------EECC
T ss_conf             9999999998999999997----0-9967-----7-----------------578488----246999--------9898


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHC--------CCCEEEEE
Q ss_conf             87599865433321157789999899876302223430112310233522577899-9876435--------89769996
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVA--------GTTGLIMT  264 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~--------~~~g~I~T  264 (321)
                      +.+-+-||||+-.... +.          ..+.. ..+-.++|+|++-- +.++.+ ..|++.+        |+ =++.+
T Consensus        43 ~~~~iwD~~G~e~~r~-~~----------~~y~~-~~~~ii~VvD~sd~-~~~~~~~~~l~~~l~~~~~~~~pi-liv~N  108 (158)
T cd04151          43 LKFQVWDLGGQTSIRP-YW----------RCYYS-NTDAIIYVVDSTDR-DRLGTAKEELHAMLEEEELKGAVL-LVFAN  108 (158)
T ss_pred             EEEEEEECCCCCCCCH-HH----------HHHCC-CCCEEEEEEECCCH-HHHHHHHHHHHHHHHHHHHCCCCE-EEEEE
T ss_conf             8999996798624462-78----------87466-78899999745787-899999999999983465369819-99997


Q ss_pred             CCCCCCCH-----HHHHHHHHHHCCCEEEEE----CCCCCCC
Q ss_conf             54578706-----999999999769889997----5898132
Q gi|254780709|r  265 KMDGTARG-----GGLIPIVVTHKIPVYFLG----VGEGIND  297 (321)
Q Consensus       265 KlD~ta~~-----G~~ls~~~~~~~Pi~fig----~Ge~i~D  297 (321)
                      |.|-....     -..+......+.++.|+.    +||+|++
T Consensus       109 K~Dl~~~~~~~~i~~~l~l~~~~~~~~~~~~tSA~tG~gV~e  150 (158)
T cd04151         109 KQDMPGALSEAEISEKLGLSELKDRTWSIFKTSAIKGEGLDE  150 (158)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH
T ss_conf             667765779999999985987416996899967878939999


No 369
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.21  E-value=0.021  Score=37.25  Aligned_cols=102  Identities=19%  Similarity=0.262  Sum_probs=56.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -.++.++|+||+||||.+-=|+..+....-+|.+-..|..+.    ..+.+.+.++.  +..-.+..-   -+-++..|-
T Consensus        25 Ge~~~i~G~nGaGKSTLl~~l~gl~~~~~G~i~~~g~~~~~~----~~~~~~~~i~~--v~QLSgGqk---qrv~iA~al   95 (157)
T cd00267          25 GEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDGKDIAKL----PLEELRRRIGY--VPQLSGGQR---QRVALARAL   95 (157)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCC----CHHHHHHCCCC--CCCCCHHHH---HHHHHHHHH
T ss_conf             979999878899989999999588479962899999999979----99999940608--766886999---999999999


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             51487599865433321157789999899876
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVL  222 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~  222 (321)
                      ..+-+++|.|-.-. ..|.....++.++.+-+
T Consensus        96 ~~~p~ililDEPts-gLD~~~~~~l~~~i~~l  126 (157)
T cd00267          96 LLNPDLLLLDEPTS-GLDPASRERLLELLREL  126 (157)
T ss_pred             HCCCCEEEEECCCC-CCCHHHHHHHHHHHHHH
T ss_conf             70999999969876-68999999999999999


No 370
>PRK12735 elongation factor Tu; Reviewed
Probab=96.21  E-value=0.023  Score=36.93  Aligned_cols=130  Identities=15%  Similarity=0.230  Sum_probs=70.8

Q ss_pred             CCCCCE-EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             667412-3113544444247899999998522674267743451245688999997530353212235866124542289
Q gi|254780709|r  108 SHRPHV-ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       108 ~~~p~v-il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      ..+|++ |.++|==-+||||+++.|...+...|..-.-...+      .+++..--+ -|+.+       |.+-..    
T Consensus         8 ~~kp~ini~~~GHVD~GKSTL~g~Lt~~~~~~~~~~~~~~~~------~D~~~eEr~-rGiTi-------d~~~~~----   69 (396)
T PRK12735          8 RTKPHVNVGTIGHVDHGKTTLTAAITTVLAKKGGGEAKAYDQ------IDNAPEEKA-RGITI-------NTSHVE----   69 (396)
T ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCHHH------HCCCHHHHC-CCEEE-------EEEEEE----
T ss_conf             899834999994268858989999861454524643122122------116656743-77379-------856999----


Q ss_pred             HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH--HHHHHHHHHHHCCCCEE-E-
Q ss_conf             9996514875998654333211577899998998763022234301123102335225--77899987643589769-9-
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN--ALRQVEMFHAVAGTTGL-I-  262 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~--~~~~a~~F~~~~~~~g~-I-  262 (321)
                        +...++.+-+||.+|.  .+  .      +++.+.  .....|-.+||+||..|--  ..+.+. ....+++.-+ | 
T Consensus        70 --fet~~~~~~~iD~PGH--e~--f------iknMI~--Ga~~aD~alLVV~A~~G~~~QTrEHl~-l~~~lgv~~~iV~  134 (396)
T PRK12735         70 --YETANRHYAHVDCPGH--AD--Y------VKNMIT--GAAQMDGAILVVSAADGPMPQTREHIL-LARQVGVPYIVVF  134 (396)
T ss_pred             --EECCCEEEEEEECCCH--HH--H------HHHHHH--CCCCCCEEEEEEECCCCCCHHHHHHHH-HHHHHCCCEEEEE
T ss_conf             --9739805999836866--88--7------766641--004256799999868787531699999-9998399858999


Q ss_pred             EECCCCCC
Q ss_conf             96545787
Q gi|254780709|r  263 MTKMDGTA  270 (321)
Q Consensus       263 ~TKlD~ta  270 (321)
                      +||+|-..
T Consensus       135 vnK~D~v~  142 (396)
T PRK12735        135 LNKCDMVD  142 (396)
T ss_pred             EECCCCCC
T ss_conf             98758888


No 371
>KOG2825 consensus
Probab=96.20  E-value=0.0041  Score=42.15  Aligned_cols=41  Identities=27%  Similarity=0.387  Sum_probs=34.3

Q ss_pred             CCCCEEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             674123113-54444424789999999852267426774345
Q gi|254780709|r  109 HRPHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       109 ~~p~vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      .+...|.|| |--||||||+.+-||.++.+.+.+|++|++|.
T Consensus        16 q~slKwifVGGKGGVGKTTcs~sLAvqla~~r~~vLiISTDP   57 (323)
T KOG2825          16 QTSLKWIFVGGKGGVGKTTCSCSLAVQLAKVRESVLIISTDP   57 (323)
T ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             350369997676776765312689999861688647861685


No 372
>COG1160 Predicted GTPases [General function prediction only]
Probab=96.19  E-value=0.13  Score=31.53  Aligned_cols=170  Identities=20%  Similarity=0.303  Sum_probs=84.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             99999987852010012100013667412311354444424789999999852267426774345124568899999753
Q gi|254780709|r   85 LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR  164 (321)
Q Consensus        85 ~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~  164 (321)
                      +..|.+.+.+.|.+.... .......|--+.++|-.-+||.|-+    +.+..+-+ + ++ .|               .
T Consensus       153 i~dLld~v~~~l~~~e~~-~~~~~~~~ikiaiiGrPNvGKSsLi----N~ilgeeR-~-Iv-~~---------------~  209 (444)
T COG1160         153 IGDLLDAVLELLPPDEEE-EEEEETDPIKIAIIGRPNVGKSSLI----NAILGEER-V-IV-SD---------------I  209 (444)
T ss_pred             HHHHHHHHHHHCCCCCCC-CCCCCCCCEEEEEEECCCCCCHHHH----HHHCCCCE-E-EE-CC---------------C
T ss_conf             899999999756774334-4435677508999927878705888----77506825-9-84-59---------------9


Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC---CCCH-----HHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             0353212235866124542289999651487599865433---3211-----5778999989987630222343011231
Q gi|254780709|r  165 TSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGR---LHNN-----SILMAGIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       165 ~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR---~~~~-----~~lm~EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
                      -|.       --|+..+-+      ..++..+++|||||-   ....     -..++-++.|.+         .+-++||
T Consensus       210 aGT-------TRD~I~~~~------e~~~~~~~liDTAGiRrk~ki~e~~E~~Sv~rt~~aI~~---------a~vvllv  267 (444)
T COG1160         210 AGT-------TRDSIDIEF------ERDGRKYVLIDTAGIRRKGKITESVEKYSVARTLKAIER---------ADVVLLV  267 (444)
T ss_pred             CCC-------CCCCEEEEE------EECCEEEEEEECCCCCCCCCCCCCEEEEEEHHHHHHHHH---------CCEEEEE
T ss_conf             986-------220331258------998818999987787746641242688750546767865---------6889999


Q ss_pred             CCCCCCHH--HHHHHHHHHHHCCCCEEEEECCCCCCCHHHHH---------HHHHHHCCCEEEEECC--CCCCCCC
Q ss_conf             02335225--77899987643589769996545787069999---------9999976988999758--9813255
Q gi|254780709|r  237 LDATTGQN--ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLI---------PIVVTHKIPVYFLGVG--EGINDLE  299 (321)
Q Consensus       237 lda~~gq~--~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~l---------s~~~~~~~Pi~fig~G--e~i~Dl~  299 (321)
                      +||+-|-.  -...|..-.+.---.=+++.|-|.-.+--..+         -..+.-..|+.||+.+  ++++.|-
T Consensus       268 iDa~~~~~~qD~~ia~~i~~~g~~~vIvvNKWDl~~~~~~~~~~~k~~i~~~l~~l~~a~i~~iSA~~~~~i~~l~  343 (444)
T COG1160         268 IDATEGISEQDLRIAGLIEEAGRGIVIVVNKWDLVEEDEATMEEFKKKLRRKLPFLDFAPIVFISALTGQGLDKLF  343 (444)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHH
T ss_conf             9888783688999999999758974999975325785166799999999987221367727999704787727889


No 373
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=96.19  E-value=0.0027  Score=43.41  Aligned_cols=41  Identities=29%  Similarity=0.448  Sum_probs=35.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             41231135444442478999999985226742677434512
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      -.++.|+|+||.|||||+-=|.-.++-.+-+|-+..-|.||
T Consensus        50 G~ivgflGaNGAGKSTtLKmLTGll~p~~G~v~V~G~~Pf~   90 (325)
T COG4586          50 GEIVGFLGANGAGKSTTLKMLTGLLLPTSGKVRVNGKDPFR   90 (325)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCH
T ss_conf             86898875888860333989738603688758745868523


No 374
>PRK05707 DNA polymerase III subunit delta'; Validated
Probab=96.18  E-value=0.038  Score=35.38  Aligned_cols=131  Identities=15%  Similarity=0.145  Sum_probs=68.8

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHH--HHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245--4228
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL--AYEA  185 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v--~~~a  185 (321)
                      ..-|+-++|.|+.|+||++.+-.+|.++.-....- .-+|..-+.-   ++-..+..-++-++..+..+....|  +++-
T Consensus        19 ~rl~HA~Lf~G~~G~GK~~lA~~~A~~LlC~~~~~-~~~Cg~C~sC---~~~~~~~HPD~~~i~pe~~~~~I~IdqIR~l   94 (328)
T PRK05707         19 GRHAHAYLLHGPAGIGKRALAERLAAFLLCEAPQG-GGACGSCKGC---QLLAAGSHPDNFVLEPEEADKPIKVDQVREL   94 (328)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCC-CCCCCCCHHH---HHHHCCCCCCEEEEECCCCCCCCCHHHHHHH
T ss_conf             98220464479998679999999999984899999-8999888899---9987589998799842666776979999999


Q ss_pred             HHHHH----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             99996----5148759986543332115778999989987630222343011231023352257789998
Q gi|254780709|r  186 FKQAQ----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM  251 (321)
Q Consensus       186 ~~~a~----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~  251 (321)
                      ++++.    ..++-|++||-|-+|.....         +.+=|..+..|..+++.+=+..-+.....++.
T Consensus        95 ~~~~~~~~~~g~~KV~iI~~Ae~m~~~Aa---------NALLKtLEEPp~~t~fiL~t~~~~~lLpTI~S  155 (328)
T PRK05707         95 VSFVVQTAQLGGRKVVLIEPAEAMNRNAA---------NALLKSLEEPSGQTVLLLISHQPSRLLPTIKS  155 (328)
T ss_pred             HHHHHHCCCCCCCEEEEEEHHHHHCHHHH---------HHHHHHHHCCCCCEEEEEEECCHHHCHHHHHH
T ss_conf             99983176678957999502877389999---------99999850789875999860993448258874


No 375
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.18  E-value=0.0062  Score=40.90  Aligned_cols=58  Identities=16%  Similarity=0.196  Sum_probs=34.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             4123113544444247899999998522674267743451245688999997530353
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~  168 (321)
                      -.++.++|+||+||||.+-=|+-.++-..-+|.+-..+..---.-..++.+..++|.=
T Consensus        20 Ge~vaiiG~sGsGKSTLl~~l~GLl~P~~G~i~~~g~~i~~~~~~~~~~~lr~~vG~V   77 (276)
T PRK13634         20 GSYVAIIGHTGSGKSTLLQHLNGLLKPTKGTVTIGERVITAGKKNKKLKPLRKKVGIV   77 (276)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCHHHHHHHHHCEEEE
T ss_conf             9899999999969999999997499988749999999886888666689987326899


No 376
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=96.17  E-value=0.0032  Score=42.91  Aligned_cols=66  Identities=20%  Similarity=0.243  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC-CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             99999998785201001210001366-7412311354444424789999999852267426774345
Q gi|254780709|r   84 VLYDVSELIHKMLMPLSKPFNWDFSH-RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus        84 i~~~l~~~L~~~L~~~~~~~~~~~~~-~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      ++..++..+.+..+....--+.+++- +-.++.++||||+||||++-=|+-.++-..-+|.+--.|.
T Consensus        19 ~~~~~~~~l~K~yg~~~al~~vsf~i~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~~G~I~v~G~~~   85 (236)
T cd03267          19 LIGSLKSLFKRKYREVEALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVP   85 (236)
T ss_pred             HHHHHHHHEECCCCCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEEC
T ss_conf             8898664524554998986680578848959999999983099999999649488715999999985


No 377
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.17  E-value=0.0076  Score=40.28  Aligned_cols=92  Identities=23%  Similarity=0.241  Sum_probs=48.6

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      +-.++.++||||+||||++-=|+-.++-..-++-+   |..++.-..|-        +.+    .|..-   -+=++..+
T Consensus        24 ~GEiv~ilGpNGaGKSTllk~i~G~l~p~~G~i~~---~g~~~~~~pq~--------~~L----SGGqr---QRv~iAra   85 (177)
T cd03222          24 EGEVIGIVGPNGTGKTTAVKILAGQLIPNGDNDEW---DGITPVYKPQY--------IDL----SGGEL---QRVAIAAA   85 (177)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEE---CCCCEECCCCC--------CCC----CHHHH---HHHHHHHH
T ss_conf             99899998999999999999996886788994666---68612215551--------507----98999---99999999


Q ss_pred             HHHCCCEEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             6514875998654333211577899998998
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIR  220 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~  220 (321)
                      -.++.|++|.|-.= .+.|.....++.++.+
T Consensus        86 l~~~p~lllLDEPt-s~LD~~~r~~i~~~ik  115 (177)
T cd03222          86 LLRNATFYLFDEPS-AYLDIEQRLNAARAIR  115 (177)
T ss_pred             HHCCCCEEEECCCC-CCCCHHHHHHHHHHHH
T ss_conf             82399999974886-5389999999999999


No 378
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=96.17  E-value=0.018  Score=37.59  Aligned_cols=103  Identities=18%  Similarity=0.177  Sum_probs=55.9

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCC----CH-------------------------------HHH
Q ss_conf             12311354444424789999999852-2674267743451----24-------------------------------568
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTF----RS-------------------------------AAI  155 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~Dtf----R~-------------------------------aA~  155 (321)
                      .+.-|+|+||+|||||.-=+...+.- +|+=-....-+++    |+                               -+.
T Consensus        29 ~i~GllG~NGAGKTTtfRmILglle~~~G~I~~~g~~~~~~~~~rIGyLPEERGLy~k~tv~dql~yla~LkGm~~~e~~  108 (300)
T COG4152          29 EIFGLLGPNGAGKTTTFRMILGLLEPTEGEITWNGGPLSQEIKNRIGYLPEERGLYPKMTVEDQLKYLAELKGMPKAEIQ  108 (300)
T ss_pred             EEEEEECCCCCCCCCHHHHHHCCCCCCCCEEEECCCCHHHHHHHHCCCCHHHHCCCCCCCHHHHHHHHHHHCCCCHHHHH
T ss_conf             17876658889732339998645786676689858510055565406581540667567199999999986499689999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH--HHHHCCCEEEEECC--CCCCCHHHHHHH
Q ss_conf             899999753035321223586612454228999--96514875998654--333211577899
Q gi|254780709|r  156 DQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ--AQAKKVDVLIIDTA--GRLHNNSILMAG  214 (321)
Q Consensus       156 eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~--a~~~~~DvvliDTA--GR~~~~~~lm~E  214 (321)
                      .++..|-++.++..+....-.+-+.=-.+-++.  +-.+.-++||.|-.  |=.+.|.++..+
T Consensus       109 ~~~~~wLer~~i~~~~~~kIk~LSKGnqQKIQfisaviHePeLlILDEPFSGLDPVN~elLk~  171 (300)
T COG4152         109 KKLQAWLERLEIVGKKTKKIKELSKGNQQKIQFISAVIHEPELLILDEPFSGLDPVNVELLKD  171 (300)
T ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHH
T ss_conf             999999996065654442477753011678999999852887799668866887232999999


No 379
>PRK00279 adk adenylate kinase; Reviewed
Probab=96.17  E-value=0.016  Score=37.94  Aligned_cols=93  Identities=17%  Similarity=0.278  Sum_probs=50.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHH----HHHHHHHH
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245----42289999
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL----AYEAFKQA  189 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v----~~~a~~~a  189 (321)
                      |+|+|+.||||+|-+.+||..|   |. +-+-+.|.+|.....+- .++.++.--+-.+..  =|..+    +++.+...
T Consensus         3 iillG~PGsGKgTqa~~la~~~---~~-~~is~GdllR~~i~~~s-~~g~~i~~~~~~G~l--Vpd~i~~~lv~~~l~~~   75 (215)
T PRK00279          3 LILLGPPGAGKGTQAKFIAEKY---GI-PHISTGDMLRAAIKAGT-ELGKEAKSYMDAGEL--VPDEIVIGLVKERLAQP   75 (215)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH---CC-EEECHHHHHHHHHHCCC-HHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHCC
T ss_conf             9998999998799999999986---99-17868899999987399-889999999977987--78899999999998365


Q ss_pred             HHHCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             65148759986543332115778999
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSILMAGI  215 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~lm~EL  215 (321)
                      ..  ..-.|+|=--|.......++++
T Consensus        76 ~~--~~G~IlDGfPRt~~Qa~~l~~~   99 (215)
T PRK00279         76 DC--ANGFLLDGFPRTIPQAEALDEM   99 (215)
T ss_pred             CC--CCEEEEECCCCCHHHHHHHHHH
T ss_conf             65--5707986899987999999999


No 380
>PTZ00088 adenylate kinase 1; Provisional
Probab=96.17  E-value=0.0027  Score=43.45  Aligned_cols=40  Identities=33%  Similarity=0.444  Sum_probs=33.1

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH
Q ss_conf             31135444442478999999985226742677434512456889
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ  157 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQ  157 (321)
                      |+|+||.||||+|-+..||.+|.    =+-+.+.|.+|.+....
T Consensus         3 iillGpPGsGKgT~a~~l~~~~~----~~hiStGdllR~~i~~~   42 (225)
T PTZ00088          3 IVLFGAPGVGKGTFAEILSKKEK----LKHINMGNILRDEIKKE   42 (225)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC----CEEECHHHHHHHHHHCC
T ss_conf             99989999987999999999879----90687899999999739


No 381
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.16  E-value=0.0057  Score=41.18  Aligned_cols=41  Identities=20%  Similarity=0.215  Sum_probs=28.9

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             41231135444442478999999985226742677434512
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      -.++.++|+||+||||.+-=|+-.++-..-+|.+-.-|+.+
T Consensus        31 Ge~~aiiG~NGsGKSTLl~~l~Gl~~p~~G~I~i~G~~i~~   71 (273)
T PRK13647         31 GSKTAILGPNGAGKSTLLLHLNGIYTAQRGRVKVMGKVVNE   71 (273)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCC
T ss_conf             98999999999759999999966988886199999999996


No 382
>pfam03215 Rad17 Rad17 cell cycle checkpoint protein.
Probab=96.15  E-value=0.01  Score=39.43  Aligned_cols=107  Identities=17%  Similarity=0.207  Sum_probs=57.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHH---CCCCEE--------------EEEC
Q ss_conf             99999987852010012100013667412311354444424789999999852---267426--------------7743
Q gi|254780709|r   85 LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD---AGLKVM--------------LAAG  147 (321)
Q Consensus        85 ~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~---~g~kV~--------------lva~  147 (321)
                      +..+++.|.+.+.+         ..+..+.++.||.|+|||||+--||.-+.-   +=+.+.              ..-.
T Consensus        28 V~eV~~WL~~~~~~---------~~~~~iLlLtGPaG~GKTTTI~lLAkeLG~ei~EW~NP~~~~~~~~~~q~~d~~g~~   98 (490)
T pfam03215        28 IAEVDHWLKAVFLE---------SNKQLILLLTGPSGCGKSTTVKVLSKELGIEIIEWSNPEYLHNPDNECQKPDFRGDC   98 (490)
T ss_pred             HHHHHHHHHHHHCC---------CCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEEECCCCCCCCCCCHHHCCCCCCCC
T ss_conf             99999999998547---------777318998798998899999999997596899814865456775022101212345


Q ss_pred             CCCCHHHHHHHHHHHH---HHC-------------CCCCCCCCCCCCHHHHHHHHHHHHH-HC-CCEEEEEC
Q ss_conf             4512456889999975---303-------------5321223586612454228999965-14-87599865
Q gi|254780709|r  148 DTFRSAAIDQLKIWAD---RTS-------------ADFVCSEIGSDAAALAYEAFKQAQA-KK-VDVLIIDT  201 (321)
Q Consensus       148 DtfR~aA~eQL~~~a~---~~~-------------v~~~~~~~~~dp~~v~~~a~~~a~~-~~-~DvvliDT  201 (321)
                      .+|.....+|.+.|-.   +.+             |+=+......|+.+ -++++..+-. .+ .-+|+|=|
T Consensus        99 ~~~~~S~~~~F~eFLlr~~ky~sL~~~~~~kriILIEE~Pn~~~~d~~~-fr~~L~~~L~s~~~~PlV~IiS  169 (490)
T pfam03215        99 IVNSLSQMEQFREFLLRGARYGSLQGGGLKKKLILVEELPNQFYSDAEK-FREVIREVLQSIWHLPLIFCLT  169 (490)
T ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHH-HHHHHHHHHHHCCCCCEEEEEE
T ss_conf             7666637777678876223356544578873599996588744236699-9999999997089998799997


No 383
>PRK13409 putative ATPase RIL; Provisional
Probab=96.14  E-value=0.011  Score=39.11  Aligned_cols=28  Identities=46%  Similarity=0.709  Sum_probs=22.4

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHH-HCC
Q ss_conf             1231135444442478999999985-226
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMS-DAG  139 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~-~~g  139 (321)
                      .++.++|+||+||||.+-=||-.++ ..|
T Consensus       366 EiigIvG~NGaGKTTLlKiLaG~lkPd~G  394 (590)
T PRK13409        366 EVIGIVGPNGIGKTTFVKLLAGVLKPDEG  394 (590)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             48999888888789999998288778874


No 384
>pfam00270 DEAD DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.
Probab=96.14  E-value=0.057  Score=34.14  Aligned_cols=51  Identities=18%  Similarity=0.077  Sum_probs=29.5

Q ss_pred             EECCCCCCCCHHHHHHHHH-HHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             3113544444247899999-998522-674267743451245688999997530
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLS-KKMSDA-GLKVMLAAGDTFRSAAIDQLKIWADRT  165 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA-~~~~~~-g~kV~lva~DtfR~aA~eQL~~~a~~~  165 (321)
                      +++++|+|+|||.+..--+ +.+.++ +....++-+ ..|+=+.+|.+.+-+..
T Consensus        17 ~iv~~pTGsGKT~~~~~~~l~~~~~~~~~~~~v~l~-Pt~aL~~q~~~~~~~~~   69 (167)
T pfam00270        17 VLVQAPTGSGKTLAFLLPALQALLKNPDGPQALVLA-PTRELAEQIYEELKKLG   69 (167)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHHHHH
T ss_conf             899889997589999999999987477898799990-60888889998864321


No 385
>PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional
Probab=96.12  E-value=0.0069  Score=40.58  Aligned_cols=100  Identities=18%  Similarity=0.163  Sum_probs=53.4

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---------------------CCHHHHHHHHHHHHHHCCC
Q ss_conf             7412311354444424789999999852267426774345---------------------1245688999997530353
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT---------------------FRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt---------------------fR~aA~eQL~~~a~~~~v~  168 (321)
                      +-.++.|+||||+|||||+-=|+-.++-..-+|.+-.-|.                     ..--+.|+|..++...|++
T Consensus        30 ~Gei~gllGpNGAGKTTli~~l~Gl~~p~sG~v~i~G~~i~~~~~~~r~~iG~~pq~~~l~~~ltv~e~l~~~~~~~g~~  109 (304)
T PRK13537         30 PGECFGLLGPNGAGKTTTLKMLLGLTHPDAGTISLCGEPVPSRARHARQRVGVVPQFDNLDPDFTVRENLLVFGRYFGLS  109 (304)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHCEEEEECCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             99599999998972999999997795689768999999887562888735599917765688989999999999972999


Q ss_pred             CCCC-------------C-CCCCCHHHH----H--HHHHHHHHHCCCEEEEE--CCCCCCCHH
Q ss_conf             2122-------------3-586612454----2--28999965148759986--543332115
Q gi|254780709|r  169 FVCS-------------E-IGSDAAALA----Y--EAFKQAQAKKVDVLIID--TAGRLHNNS  209 (321)
Q Consensus       169 ~~~~-------------~-~~~dp~~v~----~--~a~~~a~~~~~DvvliD--TAGR~~~~~  209 (321)
                      --..             . ....++.-.    +  =++..|-.++-++++.|  |+|=.+...
T Consensus       110 ~~~~~~~~~~ll~~~~L~~~~~~~~~~lSgG~kqrl~ia~al~~~P~lliLDEPT~GLDp~~r  172 (304)
T PRK13537        110 AAAARALVPPLLEFAKLENKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTTGLDPQAR  172 (304)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHH
T ss_conf             999999999999977995685673667999999999999998379999999388667899999


No 386
>PRK07429 phosphoribulokinase; Provisional
Probab=96.12  E-value=0.0078  Score=40.21  Aligned_cols=110  Identities=25%  Similarity=0.344  Sum_probs=70.8

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH----------------HH------HHHHHHHH--
Q ss_conf             3667412311354444424789999999852267426774345124----------------56------88999997--
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS----------------AA------IDQLKIWA--  162 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~----------------aA------~eQL~~~a--  162 (321)
                      -+++|.+|-+.|-.||||||-+-+|+..|..  .+|.+++.|.|--                .|      .+||+.+.  
T Consensus         4 m~~rP~IIGIAGgSGSGKTTv~r~I~~~fg~--~~VtvI~~DdYhk~dr~~r~~~~~t~lhP~And~dLl~e~L~~Lk~G   81 (331)
T PRK07429          4 MPDRPVIIGVAGDSGCGKSTFLRRLADLFGE--ELVTVICLDDYHSLDRKQRKEIGITALDPRANNFDLMYEQLKALKTG   81 (331)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHCC--CCEEEEECCCCCCCCHHHHHHCCCCCCCCCHHCHHHHHHHHHHHHCC
T ss_conf             9999989998578877899999999998388--87799947867778878898718987896400599999999999859


Q ss_pred             HHHCCCCCCCCCCC-C------CHHH-HHHHHHHH----HHHCCCE-EEEECCC--------------CCCCHHHHHHHH
Q ss_conf             53035321223586-6------1245-42289999----6514875-9986543--------------332115778999
Q gi|254780709|r  163 DRTSADFVCSEIGS-D------AAAL-AYEAFKQA----QAKKVDV-LIIDTAG--------------RLHNNSILMAGI  215 (321)
Q Consensus       163 ~~~~v~~~~~~~~~-d------p~~v-~~~a~~~a----~~~~~Dv-vliDTAG--------------R~~~~~~lm~EL  215 (321)
                      +.+..|+|....+. +      |..| ..+++--+    ..+-+|+ |.+||.-              |-+.-+.-++++
T Consensus        82 k~I~~PvYdh~tg~~~~~~~I~P~~vIIvEGLh~L~~~~lR~l~DlKIFVD~d~diR~~rRI~RDv~ERG~s~E~Vl~qi  161 (331)
T PRK07429         82 QPILKPIYNHETGKIDPPEYIKPNKIVVVEGLHPLYDERVRDLYDFKVYLDPPDEVKIAWKIKRDMAERGHTYEDVLAEI  161 (331)
T ss_pred             CCCCCCCCCCCCCCCCCCEEECCCCEEEEECCHHCCCHHHHHHCCEEEEECCCHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             97256523564787788666068867999161212879899754937996487889999988877866189999999999


Q ss_pred             HHH
Q ss_conf             989
Q gi|254780709|r  216 GKM  218 (321)
Q Consensus       216 ~ki  218 (321)
                      .+-
T Consensus       162 ~~R  164 (331)
T PRK07429        162 EKR  164 (331)
T ss_pred             HHC
T ss_conf             851


No 387
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=96.12  E-value=0.024  Score=36.82  Aligned_cols=41  Identities=22%  Similarity=0.412  Sum_probs=30.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             41231135444442478999999985226742677434512
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      -.++.++|+||+||||.+-=++.++....-+|.+-.-|...
T Consensus        25 Ge~~~liG~nGsGKTTLl~~i~G~~~~~~G~I~~~g~~i~~   65 (180)
T cd03214          25 GEIVGILGPNGAGKSTLLKTLAGLLKPSSGEILLDGKDLAS   65 (180)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCC
T ss_conf             97999998999889999999957989987289999999896


No 388
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=96.12  E-value=0.08  Score=33.13  Aligned_cols=139  Identities=20%  Similarity=0.321  Sum_probs=69.9

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      -|+++|..|||||+-+-.+...--...                     +..-++++++...       +-.      ..+
T Consensus         2 Ki~vvG~~~vGKTsli~~~~~~~f~~~---------------------~~~Tig~d~~~~~-------~~~------~~~   47 (159)
T cd00154           2 KIVLIGDSGVGKTSLLLRFVDGKFDEN---------------------YKSTIGVDFKSKT-------IEI------DGK   47 (159)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCCC---------------------CCCCCCEEEEEEE-------EEE------CCE
T ss_conf             899999699689999999970999998---------------------4886664799999-------999------999


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH----HHHCC--CC-EEEEEC
Q ss_conf             487599865433321157789999899876302223430112310233522577899987----64358--97-699965
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF----HAVAG--TT-GLIMTK  265 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F----~~~~~--~~-g~I~TK  265 (321)
                      .+.+-|.||||--        +...+.+.   +. ...+-.++|.|.+. .++++.++.+    .+..+  +. -+|-+|
T Consensus        48 ~~~l~iwDt~G~e--------~~~~l~~~---~~-~~~d~~ilv~d~~~-~~Sf~~~~~~~~~i~~~~~~~~~iilvgnK  114 (159)
T cd00154          48 TVKLQIWDTAGQE--------RFRSITPS---YY-RGAHGAILVYDITN-RESFENLDKWLKELKEYAPENIPIILVGNK  114 (159)
T ss_pred             EEEEEEEECCCCH--------HHHHHHHH---HH-HHCCEEEEECCCCC-HHHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             9999999789826--------57788999---97-54127567244898-899999999999999868988826999974


Q ss_pred             CCCC-C---CHHHHHHHHHHHCCCEEEEEC--CCCCCCC
Q ss_conf             4578-7---069999999997698899975--8981325
Q gi|254780709|r  266 MDGT-A---RGGGLIPIVVTHKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       266 lD~t-a---~~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl  298 (321)
                      .|-. .   ..--+...+...+.|...++.  |++|+++
T Consensus       115 ~DL~~~~~v~~~~~~~~a~~~~~~~~e~SAk~~~~i~~~  153 (159)
T cd00154         115 IDLEDQRQVSTEEAQQFAKENGLLFFETSAKTGENVEEL  153 (159)
T ss_pred             CCCHHCCCCCHHHHHHHHHHCCCEEEEECCCCCCCHHHH
T ss_conf             563011689999999999986997999876888198999


No 389
>TIGR00606 rad50 rad50; InterPro: IPR004584   Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining. It is a component of an exonuclease complex with MRE11 homologs. The Saccharomyces cerevisiae Rad50/MRE11 complex possesses single-stranded endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides an ATP-dependent control of MRE11 by unwinding and repositioning DNA ends into the MRE11 active site. This family is distantly related to the SbcC family of bacterial proteins.    When the N- and C-terminal globular regions of Rad50 from Pyrococcus furiosus P58301 from SWISSPROT are co-expressed in Escherichia coli, they spontaneously associate to form a stable complex that possesses ATP-binding and weak ATP-hydrolysing activities. The structure formed is known as the Rad50 catalytic domain (Rad50cd1). In the presence of ATP, two Rad50cd1 molecules interact via their ATP-binding and highly conserved 'signature' motifs to form a dimer. As ATP is buried deep within this dimer interface, the two Rad50cd1 molecules may have to completely disengage after ATP hydrolysis to allow the release of ADP before binding of a new ATP molecule. ATP binding is also accompanied by a 30 rotation of two distinct domains within each Rad50cd1 part of the dimer. This rotation and dimerisation creates a positively charged surface which, potentially, could provide a DNA-binding site capable of accommodating two DNA molecules.   The Mre11-docking site within Rad50 has been mapped to two 40-residue heptad-repeat sequences that lie adjacent to the N- and C-terminal ATPase segments. A distinct region within this domain forms a conserved hydrophobic patch that is believed to be the actual Mre11-binding site and lies immediately adjacent to the putative DNA-binding site of Rad50. As Rad50 dimerises in the presence of ATP and forms a stoichiometric complex with Mre11 (one Mre11 subunit binding to one Rad50 subunit), it is possible that the MR complex forms a closely coordinated DNA-binding unit that has the potential to act on two DNA molecules simultaneously. Within this unit, ATP-dependent control of nuclease action might be achieved via Rad50 unwinding or repositioning DNA ends into the active-site of Mre11 . ; GO: 0005524 ATP binding, 0006281 DNA repair, 0030870 Mre11 complex.
Probab=96.10  E-value=0.002  Score=44.33  Aligned_cols=20  Identities=55%  Similarity=0.758  Sum_probs=10.8

Q ss_pred             ECCCCCCCCHHHHHHHHHHH
Q ss_conf             11354444424789999999
Q gi|254780709|r  115 LVVGVNGVGKTTVIGKLSKK  134 (321)
Q Consensus       115 l~vG~nG~GKTTT~aKLA~~  134 (321)
                      +++||||+||||+|-=|-+.
T Consensus        32 ~l~GPNG~GKTT~IE~L~y~   51 (1328)
T TIGR00606        32 LLVGPNGAGKTTIIEALKYV   51 (1328)
T ss_pred             EEECCCCCCHHHHHHHHHHH
T ss_conf             01277887525898754332


No 390
>PTZ00336 elongation factor 1-alpha; Provisional
Probab=96.10  E-value=0.033  Score=35.85  Aligned_cols=132  Identities=22%  Similarity=0.293  Sum_probs=69.9

Q ss_pred             CCCCCE-EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---------CCCCC-C
Q ss_conf             667412-311354444424789999999852267426774345124568899999753035321---------22358-6
Q gi|254780709|r  108 SHRPHV-ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---------CSEIG-S  176 (321)
Q Consensus       108 ~~~p~v-il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---------~~~~~-~  176 (321)
                      .++|++ |.++|-=-.||||.++-|.+.+..-         |   ....++++.-+...|-.-+         ..+.. .
T Consensus         3 ~~K~~lni~~~GhVD~GKSTL~G~Ll~~~~~v---------~---~~~l~~~~~~~~~~g~~s~~~a~~~D~~~~Er~rG   70 (449)
T PTZ00336          3 KDKVHMNLVVVGHVDAGKSTATGHLIYKCGGI---------D---KRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERG   70 (449)
T ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHCCCC---------C---HHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHCCC
T ss_conf             98864399999277896888899999874884---------7---89999999999871875143254512772232287


Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC----------HHHH
Q ss_conf             612454228999965148759986543332115778999989987630222343011231023352----------2577
Q gi|254780709|r  177 DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG----------QNAL  246 (321)
Q Consensus       177 dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g----------q~~~  246 (321)
                      -...+++.   ++...+.-+.+||+.|.-..=.|++.-.            +..|-.+||+||..|          |- .
T Consensus        71 iTid~~~~---~f~t~~~~~~iiD~PGH~~fi~nmi~Ga------------s~aD~aiLVVdA~~G~~e~g~~~~gQT-r  134 (449)
T PTZ00336         71 ITIDIALW---KFESPKSVFTIIDAPGHRDFIKNMITGT------------SQADAAILMIDSTHGGFEAGISKDGQT-R  134 (449)
T ss_pred             EEEEEEEE---EEECCCEEEEEEECCCHHHHHHHHHHHH------------CCCCEEEEEEECCCCCEECCCCCCCCC-H
T ss_conf             58986799---9974984899986894688899999765------------006767999987877410355667753-9


Q ss_pred             HHHHHHHHHCCCCEEE--EECCCC
Q ss_conf             8999876435897699--965457
Q gi|254780709|r  247 RQVEMFHAVAGTTGLI--MTKMDG  268 (321)
Q Consensus       247 ~~a~~F~~~~~~~g~I--~TKlD~  268 (321)
                      +.+.. ...+++..+|  ++|||.
T Consensus       135 eHl~i-~~~Lgv~~iiV~vNKmD~  157 (449)
T PTZ00336        135 EHALL-AFTLGVKQMVVCCNKMDD  157 (449)
T ss_pred             HHHHH-HHHCCCCEEEEEEECCCC
T ss_conf             99999-986699779999862015


No 391
>PRK05636 replicative DNA helicase; Provisional
Probab=96.09  E-value=0.052  Score=34.42  Aligned_cols=39  Identities=21%  Similarity=0.290  Sum_probs=31.8

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECC
Q ss_conf             741231135444442478999999985-226742677434
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGD  148 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~D  148 (321)
                      +...|.+.|-+|+|||+-+--+|.... ++|+.|++.+..
T Consensus       266 ~G~LiIiAARPsmGKTalAlnia~n~A~~~g~~v~~fSLE  305 (507)
T PRK05636        266 GGQMIIVAARPGVGKSTIALDFMRSASIKNNKASVIFSLE  305 (507)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             3567999737878668999999999998769937997156


No 392
>TIGR00450 thdF tRNA modification GTPase TrmE; InterPro: IPR004520   The GTP-binding domain of all TrmE/ThdF orthologues is found in the C-terminal portion of the molecule. The N-terminal half can be removed without affecting the GTP-binding/hydrolysis function of the GTP-binding domain. The last four amino acids of all orthologues of ThdF/TrmE are highly conserved, being either CIGK or CLGK. This matches the Caax (where 'a' represents an aliphatic amino acid, and 'x' represents any amino acid) motif for isoprenylation that anchors small GTP-binding proteins to cell membranes in eukaryotic cells. However, protein isoprenylation has never been shown to occur in bacteria. Interestingly, biochemical experiments have shown that the Escherichia coli TrmE protein peripherally associates with the membrane fraction .    Although the biochemical properties of TrmE have been investigated for the E. coli and Thermotoga maritima proteins, nothing is known about the relationship of this protein to tRNA modification. Orthologues of TrmE are present in eukaryotes and bacteria, but are not present in archaea. In Saccharomyces cerevisiae, Mss1p is a nuclear-encoded mitochondrial protein that is the yeast orthologue of TrmE. Mss1p interacts with the 15S rRNA of the yeast mitochondria, which is equivalent to the 16S rRNA of bacteria. Subsequent analysis of the S. cerevisiae MTO1 gene suggests that MSS1 and MTO1 act together in a pathway involved in optimizing mitochondrial protein synthesis.    TrmE may play a role in tRNA processing and may be directly or indirectly involved in regulating ribosome function.; GO: 0003924 GTPase activity, 0005525 GTP binding, 0006400 tRNA modification, 0005622 intracellular.
Probab=96.08  E-value=0.07  Score=33.51  Aligned_cols=179  Identities=20%  Similarity=0.249  Sum_probs=97.3

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC--CCCC-CCCCCCCCEEECCCCCCC
Q ss_conf             9999999997388989999999999987512789989999999998785201001--2100-013667412311354444
Q gi|254780709|r   46 REELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLS--KPFN-WDFSHRPHVILVVGVNGV  122 (321)
Q Consensus        46 leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~L~~~~--~~~~-~~~~~~p~vil~vG~nG~  122 (321)
                      .+.+-..|-+..|.++..++..+-    -..+..+..+.+....+.+.+++....  +... +..-+.|.-+.+||-+=+
T Consensus       161 ~~~~l~ll~~~ev~iDY~~~~~e~----d~~~~~~~~~~~~~~~~~L~~i~~~~~aq~~~~vl~~l~~g~k~ai~G~~Nv  236 (473)
T TIGR00450       161 RKSLLQLLAQVEVNIDYEEDDDEL----DQLELVSLNQKLEKIIAELKDILNSANAQRSKKVLEKLKDGFKLAIVGKPNV  236 (473)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCC----CHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             999988888743102675457753----1120001789999999999999987641003458998408947999647887


Q ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEEEC
Q ss_conf             424789999999852267426774345124568899999753035321223586612454228999-9651487599865
Q gi|254780709|r  123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ-AQAKKVDVLIIDT  201 (321)
Q Consensus       123 GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~-a~~~~~DvvliDT  201 (321)
                      ||..=    =+-+.++.|.                           +++.-.|+     -+|.++. +..+|+-+=|+||
T Consensus       237 GKSSL----LNa~l~~DrA---------------------------iVS~~kGt-----TRD~vE~~~~L~G~~~~~lDT  280 (473)
T TIGR00450       237 GKSSL----LNALLKQDRA---------------------------IVSDIKGT-----TRDVVEGDFELNGILVKLLDT  280 (473)
T ss_pred             CHHHH----HHHHHHCCCE---------------------------EEECCCCC-----CCCEEEEEEEECCEEEEEEEC
T ss_conf             57899----9987622870---------------------------55276688-----320442057774678998514


Q ss_pred             CC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-HHH-HHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             43-3321157789999899876302223430112310233522-577-89998764358976999654578
Q gi|254780709|r  202 AG-RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-NAL-RQVEMFHAVAGTTGLIMTKMDGT  269 (321)
Q Consensus       202 AG-R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-~~~-~~a~~F~~~~~~~g~I~TKlD~t  269 (321)
                      || |-|.|.----=++|=.+.++     ..+.+++|+|+..+. ..- ++...+++.=.--=+++-|-|=.
T Consensus       281 AGiR~~~~~~E~~GiekS~~~i~-----~A~LVi~~~D~~~~~~~ddf~li~~~~k~~k~~~~V~NK~DL~  346 (473)
T TIGR00450       281 AGIREHADKVERLGIEKSFKAIK-----QADLVIYVLDASQPLTKDDFELIITLNKKKKPLILVLNKIDLA  346 (473)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHH-----HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             67510200466776899899986-----0573478887478988105899999732179779997350165


No 393
>TIGR00958 3a01208 antigen peptide transporter 2; InterPro: IPR005293   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Proteins of this family are involved in the transport of antigens from the cytoplasm to a membrane-bound compartment for association with MHC class I molecules.; GO: 0005215 transporter activity, 0006810 transport.
Probab=96.08  E-value=0.0043  Score=42.03  Aligned_cols=37  Identities=32%  Similarity=0.451  Sum_probs=30.4

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             1231135444442478999999985226742677434
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD  148 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D  148 (321)
                      .++.+|||||+||.|-+|=|-|+|.=.+=.|+|=.-+
T Consensus       560 ~vvALVGPsGsGKStvaaLL~n~Y~Pt~G~vLlDg~P  596 (770)
T TIGR00958       560 EVVALVGPSGSGKSTVAALLQNLYQPTGGQVLLDGVP  596 (770)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCC
T ss_conf             2599865899839999999985578986568776846


No 394
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=96.08  E-value=0.13  Score=31.71  Aligned_cols=142  Identities=20%  Similarity=0.300  Sum_probs=73.6

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -..+.+||++||||.||.|-+-.|-.+ +..--+++..       +-.+-.-+.-++-|-.-+-|-|-.+ +.-|++-.-
T Consensus       127 RGLviiVGaTGSGKSTtmAaMi~yRN~-~s~gHIiTIE-------DPIEfih~h~~CIvTQREvGvDTes-w~~AlkNtl  197 (375)
T COG5008         127 RGLVIIVGATGSGKSTTMAAMIGYRNK-NSTGHIITIE-------DPIEFIHKHKRCIVTQREVGVDTES-WEVALKNTL  197 (375)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHCCCCC-CCCCCEEEEC-------CHHHHHHCCCCEEEEEEEECCCHHH-HHHHHHHHH
T ss_conf             745999877888840168998601346-8877358823-------8199874156415873341446188-999999877


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH-----------CCCC
Q ss_conf             51487599865433321157789999899876302223430112310233522577899987643-----------5897
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV-----------AGTT  259 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~-----------~~~~  259 (321)
                      .+--|||+|--- |   +.+-|+--      +..  ...-|.++.++-|.+-+.|++.+-.|...           +++.
T Consensus       198 RQaPDvI~IGEv-R---sretMeyA------i~f--AeTGHLcmaTLHAN~anQaleRIinffP~Err~Qll~DlsLNLk  265 (375)
T COG5008         198 RQAPDVILIGEV-R---SRETMEYA------IQF--AETGHLCMATLHANNANQALERIINFFPEERREQLLIDLSLNLK  265 (375)
T ss_pred             HCCCCEEEEEEC-C---CHHHHHHH------HHH--HHCCCEEEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             518986999730-4---37679999------988--73286589985057715789999863968776436777554578


Q ss_pred             EEEEE----CCCCCCCHH
Q ss_conf             69996----545787069
Q gi|254780709|r  260 GLIMT----KMDGTARGG  273 (321)
Q Consensus       260 g~I~T----KlD~ta~~G  273 (321)
                      |+|--    +-|+..|-+
T Consensus       266 giIaQrL~p~~~gkgR~~  283 (375)
T COG5008         266 GIIAQRLVPRKDGKGRTA  283 (375)
T ss_pred             HHHHHHHCCCCCCCCCEE
T ss_conf             998876133899986415


No 395
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374    This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly, and is closely related to GspE (IPR013369 from INTERPRO) of type II secretion systems (also referred to as the main terminal branch of the general secretion pathway). Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0009297 pilus biogenesis.
Probab=96.08  E-value=0.0026  Score=43.54  Aligned_cols=75  Identities=21%  Similarity=0.435  Sum_probs=44.9

Q ss_pred             CCCC-EEECCCCCCCCHHHHHHHHHHHHHHCCC-CEEEEECC---CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             6741-2311354444424789999999852267-42677434---51245688999997530353212235866124542
Q gi|254780709|r  109 HRPH-VILVVGVNGVGKTTVIGKLSKKMSDAGL-KVMLAAGD---TFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY  183 (321)
Q Consensus       109 ~~p~-vil~vG~nG~GKTTT~aKLA~~~~~~g~-kV~lva~D---tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~  183 (321)
                      ++|+ -||+.||||||||.|+===   |---|+ .|=+-||=   =|+-..|.|-+++ .+.|..|            | 
T Consensus       323 ~kPqGMvLVTGPTGSGKTVSLYTa---LniLN~~~~NISTAEDPVEINLpGINQVnvN-pK~GLTF------------A-  385 (577)
T TIGR02538       323 HKPQGMVLVTGPTGSGKTVSLYTA---LNILNTEEVNISTAEDPVEINLPGINQVNVN-PKIGLTF------------A-  385 (577)
T ss_pred             HCCCCCEEEECCCCCCHHHHHHHH---HCCCCCCCCCCCCCCCCEEEEECCCCEECCC-CCCCCCH------------H-
T ss_conf             079972886266598416878763---1125776745011447724640771512046-6788787------------9-


Q ss_pred             HHHHHHHHHCCCEEEEE
Q ss_conf             28999965148759986
Q gi|254780709|r  184 EAFKQAQAKKVDVLIID  200 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliD  200 (321)
                      .|+..|-.++=|+|.|=
T Consensus       386 aALrSFLRQDPDIIMVG  402 (577)
T TIGR02538       386 AALRSFLRQDPDIIMVG  402 (577)
T ss_pred             HHHHHHCCCCCCEEEEE
T ss_conf             99986406899889870


No 396
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=96.07  E-value=0.0062  Score=40.89  Aligned_cols=42  Identities=24%  Similarity=0.553  Sum_probs=34.7

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             66741231135444442478999999985226742677434512456
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
                      +..|++|++.||-|+||||-...||..+.     .-++-+|.|-+.+
T Consensus         5 ~~~~~iiVVMGVsGsGKSTig~~LA~~l~-----~~fiegDdfHp~~   46 (177)
T PRK11545          5 NHDHHIYVLMGVSGSGKSAVASAVAHQLH-----AAFLDGDFLHPRC   46 (177)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHC-----CCEECCCCCCCHH
T ss_conf             78875999984798999999999999819-----9855365558999


No 397
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.06  E-value=0.0047  Score=41.73  Aligned_cols=165  Identities=14%  Similarity=0.096  Sum_probs=78.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
                      -.++.++|+|||||||++-=|+..+....-+|.+-.-|.-    -..++.+.++++. +|..+...-+...+++-+.+..
T Consensus        33 Ge~~aiiG~sGsGKSTL~~~l~Gl~~~~~G~I~~~G~~i~----~~~~~~~r~~ig~-VfQ~p~~~l~~~tV~e~i~~g~  107 (277)
T PRK13642         33 GEWVSIIGQNGSGKSTTARLIDGLFEEFEGIVKIDGERLT----AENVWNLRRKIGM-VFQNPDNQFVGATVEDDVAFGM  107 (277)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECC----CCCHHHHHCCCEE-EEECCCCCCCCCCHHHHHHHHH
T ss_conf             9899999999968999999996389988848999999998----5788888517689-9989763257550888898777


Q ss_pred             HH-CC--------------CEEEEECCCCCCCHHHH-HHHHHHHHHHHHCCCCCCCCEEEEECCC-CCCHHHHHHHH---
Q ss_conf             51-48--------------75998654333211577-8999989987630222343011231023-35225778999---
Q gi|254780709|r  191 AK-KV--------------DVLIIDTAGRLHNNSIL-MAGIGKMIRVLKRLDPHAPHSVLQVLDA-TTGQNALRQVE---  250 (321)
Q Consensus       191 ~~-~~--------------DvvliDTAGR~~~~~~l-m~EL~ki~~v~~~~~~~~p~~~~lVlda-~~gq~~~~~a~---  250 (321)
                      .+ ++              .+=+.|-+.|.+..-.- +.+...|.+++-    ..| + +|++|= |+|.|...+.+   
T Consensus       108 ~~~~~~~~e~~~~v~~~l~~~~l~~~~~~~P~~LSGGqrQRvaIA~aLa----~~P-~-ililDEPTs~LD~~~~~~i~~  181 (277)
T PRK13642        108 ENQGIPREEMIKRVDEALLAVNMLDFKTREPARLSGGQKQRVAVAGIIA----LRP-E-IIILDESTSMLDPTGRSEIMR  181 (277)
T ss_pred             HHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHH----CCC-C-EEEEECCCCCCCHHHHHHHHH
T ss_conf             6669999999999999998779965655791228999999999999996----699-9-999958876589899999999


Q ss_pred             ---HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             ---8764358976999654578706999999999769889997589813
Q gi|254780709|r  251 ---MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGIN  296 (321)
Q Consensus       251 ---~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~  296 (321)
                         ..++..+++-+++|- |        ++.+.. ---|..+-.|+-+.
T Consensus       182 ll~~L~~~~~~Tii~iTH-d--------l~~~~~-aDrv~vm~~G~Iv~  220 (277)
T PRK13642        182 VIHEIKDKYHLTVLSITH-D--------LDEAAS-SDRILVMRAGEIIK  220 (277)
T ss_pred             HHHHHHHHCCCEEEEEEE-C--------HHHHHH-CCEEEEEECCEEEE
T ss_conf             999999816989999945-8--------899971-99899998999999


No 398
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=96.06  E-value=0.0074  Score=40.37  Aligned_cols=137  Identities=22%  Similarity=0.278  Sum_probs=73.0

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH---HCCCCE------EEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             741231135444442478999999985---226742------67743451245688999997530353212235866124
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS---DAGLKV------MLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA  180 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~---~~g~kV------~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~  180 (321)
                      +-+-|.++|-.|+||||.+=+|-++-.   +.| +|      .-.++|.-   ..||=      =|+-+.        ++
T Consensus         9 ~~RniaIi~H~dAGKTTLtE~lL~~~GaI~~~G-~V~~~~~~~~~~sD~~---~~E~~------RgiSI~--------ss   70 (526)
T PRK00741          9 KRRTFAIISHPDAGKTTLTEKLLLFGGAIQEAG-TVKGRKSGRHATSDWM---EMEKQ------RGISVT--------SS   70 (526)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCC-EEECCCCCCCCCCCCC---HHHHH------CCCEEE--------CC
T ss_conf             117799993789898999999997467524484-6631467886467885---88997------596486--------15


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHHHH
Q ss_conf             5422899996514875998654333211577899998998763022234301123102335225-----77899987643
Q gi|254780709|r  181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFHAV  255 (321)
Q Consensus       181 v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~~~  255 (321)
                      ++     .+.-+++-+=||||.|  |.|-  ..|.   .+.+..     -+-.++|+||..|=.     ..++++.    
T Consensus        71 v~-----~~e~~~~~iNliDTPG--h~DF--~~e~---~raL~a-----~D~Av~Vida~~GVe~qTe~~w~~~~~----  129 (526)
T PRK00741         71 VM-----QFPYRDCLINLLDTPG--HEDF--SEDT---YRTLTA-----VDSALMVIDAAKGVEPQTRKLMEVCRL----  129 (526)
T ss_pred             EE-----EEEECCEEEEEEECCC--CHHH--HHHH---HHHHHH-----HCEEEEEEECCCCCCHHHHHHHHHHHH----
T ss_conf             17-----7867898999990989--4677--8999---999987-----375999997775523336899999886----


Q ss_pred             CCCCEE-EEECCCC-CCCHHHHH-HHHHHHCCC
Q ss_conf             589769-9965457-87069999-999997698
Q gi|254780709|r  256 AGTTGL-IMTKMDG-TARGGGLI-PIVVTHKIP  285 (321)
Q Consensus       256 ~~~~g~-I~TKlD~-ta~~G~~l-s~~~~~~~P  285 (321)
                      -++--+ .+.|||- .+..-.+| ++...+++.
T Consensus       130 ~~iP~i~FINKmDR~~ad~~~~l~ei~~~lg~~  162 (526)
T PRK00741        130 RDTPIFTFINKLDRDGREPLELLDEIEEVLGIA  162 (526)
T ss_pred             CCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             399889999656767898789887788874787


No 399
>KOG1533 consensus
Probab=96.06  E-value=0.0058  Score=41.13  Aligned_cols=113  Identities=18%  Similarity=0.200  Sum_probs=59.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH-HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH--
Q ss_conf             412311354444424789999999852267426774345124568-89999975303532122358661245422899--
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI-DQLKIWADRTSADFVCSEIGSDAAALAYEAFK--  187 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~-eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~--  187 (321)
                      |+--+++||.||||||-|+-.-.++...|++|.+|..|.---+-- +---.-.+.+.+.-+....+--|---+.-+++  
T Consensus         2 ~fgqvVIGPPgSGKsTYc~g~~~fls~~gr~~~vVNLDPaNd~~~Y~~~v~I~elit~edvm~~~~LGPNg~l~yc~E~l   81 (290)
T KOG1533           2 PFGQVVIGPPGSGKSTYCNGMSQFLSAIGRPVAVVNLDPANDNLPYECAVDIRELITVEDVMEELGLGPNGALKYCMEYL   81 (290)
T ss_pred             CCCEEEECCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             75068876999985311320999999748962799568765678887765199971399999985879961279999999


Q ss_pred             -----HH----HHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             -----99----65148759986543332115778999989987630
Q gi|254780709|r  188 -----QA----QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKR  224 (321)
Q Consensus       188 -----~a----~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~  224 (321)
                           .+    +......+|+|-.|..---.+. +.|.+|.+-+.+
T Consensus        82 ~~~idwl~~~l~~~~~~Y~lFDcPGQVELft~h-~~l~~I~~~Lek  126 (290)
T KOG1533          82 EANIDWLLEKLKPLTDHYVLFDCPGQVELFTHH-DSLNKIFRKLEK  126 (290)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCEEEEECC-CHHHHHHHHHHH
T ss_conf             854499999745234748999579827987425-609999999997


No 400
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=96.06  E-value=0.016  Score=38.10  Aligned_cols=83  Identities=24%  Similarity=0.330  Sum_probs=50.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHH-----CCCCEEEEECCCCCHHHHHHHH--HHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             311354444424789999999852-----2674267743451245688999--997530353212235866124542289
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSD-----AGLKVMLAAGDTFRSAAIDQLK--IWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~-----~g~kV~lva~DtfR~aA~eQL~--~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      .+++||.|+||||-+--||..+..     .++||.+|-.-.-=+|+.--.-  ..|.|++|        .||.-=+ +++
T Consensus       140 tLiigpP~~GKTTlLRdiaR~~s~g~~~~l~kkv~IiDersEIag~~~gvpq~~~g~R~dV--------ld~cpk~-~gm  210 (308)
T COG3854         140 TLIIGPPQVGKTTLLRDIARLLSDGINQFLPKKVGIIDERSEIAGCLNGVPQHGRGRRMDV--------LDPCPKA-EGM  210 (308)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHCCCCCCCHHHHHHHHHH--------CCCCHHH-HHH
T ss_conf             6996599887077999999986315112677328997150043034358860323221010--------4656178-889


Q ss_pred             HHH-HHHCCCEEEEECCCCC
Q ss_conf             999-6514875998654333
Q gi|254780709|r  187 KQA-QAKKVDVLIIDTAGRL  205 (321)
Q Consensus       187 ~~a-~~~~~DvvliDTAGR~  205 (321)
                      ..| ++.--+|++||--||.
T Consensus       211 mmaIrsm~PEViIvDEIGt~  230 (308)
T COG3854         211 MMAIRSMSPEVIIVDEIGTE  230 (308)
T ss_pred             HHHHHHCCCCEEEEECCCCH
T ss_conf             99999549957998343647


No 401
>PRK02496 adk adenylate kinase; Provisional
Probab=96.05  E-value=0.019  Score=37.43  Aligned_cols=95  Identities=17%  Similarity=0.217  Sum_probs=52.5

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH-
Q ss_conf             3113544444247899999998522674267743451245688999997530353212235866124542289999651-
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK-  192 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~-  192 (321)
                      |+|+||.||||+|-+.+||..|.    =+-+.+.|.+|...-.+= .+|..+.--+-.+.  -=|-.++..-+...-.+ 
T Consensus         4 iillG~PGSGKgTqa~~L~~~~~----~~his~GdllR~~~~~~s-~lg~~i~~~i~~G~--lvpd~iv~~li~~~l~~~   76 (185)
T PRK02496          4 LIFLGPPGAGKGTQAVVLAEHLQ----IPHISTGDILRQAITEQT-PLGIKAQGYVDSGE--LVPDQLVLGLVQERLQQP   76 (185)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC----CEEECHHHHHHHHHHCCC-HHHHHHHHHHHCCC--CCCCHHHHHHHHHHHHCC
T ss_conf             99979999998999999999969----977888899999987499-88999999998799--677288999999998484


Q ss_pred             -CCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             -48759986543332115778999
Q gi|254780709|r  193 -KVDVLIIDTAGRLHNNSILMAGI  215 (321)
Q Consensus       193 -~~DvvliDTAGR~~~~~~lm~EL  215 (321)
                       ...-.|+|=--|.......++++
T Consensus        77 ~~~~g~ilDGfPR~~~Qa~~l~~~  100 (185)
T PRK02496         77 DAANGWILDGFPRNVTQAAFLDEL  100 (185)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             533877886898857889999999


No 402
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]
Probab=96.05  E-value=0.0059  Score=41.06  Aligned_cols=95  Identities=19%  Similarity=0.189  Sum_probs=56.1

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
                      .-.|.-+.|+||+||||++-=||-.+.-..-+|.+-.+|+.|-.     ..+-+++||-+....--.+  --+.+-+.|+
T Consensus        27 ~Gei~GlLG~NGAGKTT~LRmiatlL~P~~G~v~idg~d~~~~p-----~~vrr~IGVl~~e~glY~R--lT~rEnl~~F   99 (245)
T COG4555          27 EGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTIDGVDTVRDP-----SFVRRKIGVLFGERGLYAR--LTARENLKYF   99 (245)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCCH-----HHHHHHCCEECCCCCHHHH--HHHHHHHHHH
T ss_conf             66499987689887123799999832588864998400210171-----8775202131377670355--3089999999


Q ss_pred             HHHCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             65148759986543332115778999
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSILMAGI  215 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~lm~EL  215 (321)
                      - +-+|+-=.++.-|.   .+||++|
T Consensus       100 a-~L~~l~~~~~kari---~~l~k~l  121 (245)
T COG4555         100 A-RLNGLSRKEIKARI---AELSKRL  121 (245)
T ss_pred             H-HHHHHHHHHHHHHH---HHHHHHH
T ss_conf             9-99624026789999---9999886


No 403
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=96.04  E-value=0.0062  Score=40.89  Aligned_cols=35  Identities=29%  Similarity=0.519  Sum_probs=29.2

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             7412311354444424789999999852267426774345
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      +|.+|+++||||||||.-+-.||..+     ..-+|.||.
T Consensus         3 ~~~ii~i~GpTasGKs~la~~la~~~-----~~eIIsaDS   37 (304)
T PRK00091          3 KPKLIVLVGPTASGKTALAIELAKRL-----NGEIISVDS   37 (304)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHC-----CCEEEEECH
T ss_conf             99779998988658999999999987-----998994126


No 404
>pfam04548 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to be involved in plant resistance to bacteria.
Probab=96.03  E-value=0.017  Score=37.87  Aligned_cols=118  Identities=24%  Similarity=0.287  Sum_probs=62.9

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH--HHHH
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899--9965
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK--QAQA  191 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~--~a~~  191 (321)
                      |+++|-+|+||+.|.--+                                 +|-++|.+.....|  |-. ..+  ....
T Consensus         3 ivLlGktG~GKSstgNtI---------------------------------LG~~~F~s~~~~~~--vT~-~c~~~~~~~   46 (200)
T pfam04548         3 IVLVGKTGNGKSATGNSI---------------------------------LGRKAFESKLRAQG--VTK-TCQLVSRTW   46 (200)
T ss_pred             EEEECCCCCCHHHHHHHH---------------------------------CCCCCCCCCCCCCC--CCE-EEEEEEEEE
T ss_conf             999799998436557661---------------------------------79753357898888--741-368999998


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC--CH--HHHH-HHHHHHHHC-CCCEEEEEC
Q ss_conf             14875998654333211577899998998763022234301123102335--22--5778-999876435-897699965
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT--GQ--NALR-QVEMFHAVA-GTTGLIMTK  265 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~--gq--~~~~-~a~~F~~~~-~~~g~I~TK  265 (321)
                      .+..+.+|||.|-...+...-.-.+.|.+.+....| -||-.+||++...  -+  ++++ +-+.|.+.+ .-+=|+||.
T Consensus        47 ~gr~v~ViDTPgl~~~~~~~~~~~~ei~~~~~l~~p-GpHa~LLVi~~~rfT~ee~~~v~~i~~~FGe~~~~~tIVLFT~  125 (200)
T pfam04548        47 DGRIINVIDTPGLFDLSVSNDFISKEIIRCLLLAEP-GPHAVLLVLSLGRFTEEEEQALRTLQELFGSKILDYMIVVFTR  125 (200)
T ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCC-CCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHEEEEEEC
T ss_conf             996899997866357677869999999999985589-9857999986688888999999999999757868009999978


Q ss_pred             CCC
Q ss_conf             457
Q gi|254780709|r  266 MDG  268 (321)
Q Consensus       266 lD~  268 (321)
                      -|.
T Consensus       126 ~D~  128 (200)
T pfam04548       126 KDD  128 (200)
T ss_pred             HHH
T ss_conf             021


No 405
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=96.03  E-value=0.041  Score=35.13  Aligned_cols=26  Identities=23%  Similarity=0.447  Sum_probs=22.1

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS  136 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~  136 (321)
                      -.++.++||||+||||++-=||-.+.
T Consensus        29 Ge~~~llGpsG~GKSTllr~i~Gl~~   54 (369)
T PRK11000         29 GEFVVFVGPSGCGKSTLLRMIAGLED   54 (369)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             98999999997369999999977999


No 406
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=96.02  E-value=0.067  Score=33.67  Aligned_cols=136  Identities=21%  Similarity=0.342  Sum_probs=64.2

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCC--CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             9999999998785201001210001--36674123113544444247899999998522674267743451245688999
Q gi|254780709|r   82 QRVLYDVSELIHKMLMPLSKPFNWD--FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLK  159 (321)
Q Consensus        82 ~~i~~~l~~~L~~~L~~~~~~~~~~--~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~  159 (321)
                      ++....+++.+.-   |+..|-.+.  .-.+|.=||+.||.|+|||..+--+|+..   |....-+       .+-+=+.
T Consensus       138 ~~~k~el~E~vel---Pl~~pe~f~~~Gi~pPkGvLLyGPPGtGKTllAkAvA~e~---~~~fi~v-------~~s~l~s  204 (390)
T PRK03992        138 DEQIREVREAVEL---PLKNPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHET---NATFIRV-------VGSELVQ  204 (390)
T ss_pred             HHHHHHHHHHHHH---HHHCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEE-------EHHHHHH
T ss_conf             9999999999999---8659899997699999727868989997899999999874---8887996-------6799752


Q ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECC---C--CCCC--------HHHHHHHHHHHHHHHHCCC
Q ss_conf             9975303532122358661245422899996514875998654---3--3321--------1577899998998763022
Q gi|254780709|r  160 IWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTA---G--RLHN--------NSILMAGIGKMIRVLKRLD  226 (321)
Q Consensus       160 ~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTA---G--R~~~--------~~~lm~EL~ki~~v~~~~~  226 (321)
                      .|             -.+....+++..+.|+.+.--+|+||-.   |  |...        +.-+|+=|..|       +
T Consensus       205 k~-------------vGesek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~em-------D  264 (390)
T PRK03992        205 KF-------------IGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAEM-------D  264 (390)
T ss_pred             CC-------------CCHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHC-------C
T ss_conf             45-------------417999999999999970990897143256633567788862088999999999974-------4


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             234301123102335225778999
Q gi|254780709|r  227 PHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       227 ~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
                      ...+....+|+=||.--+.++-|-
T Consensus       265 G~~~~~~V~VIaATNrpd~LDpAl  288 (390)
T PRK03992        265 GFDPRGNVKIIAATNRPDILDPAL  288 (390)
T ss_pred             CCCCCCCEEEEEECCCCHHCCHHH
T ss_conf             877778827996069810059777


No 407
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=96.02  E-value=0.013  Score=38.68  Aligned_cols=57  Identities=16%  Similarity=0.225  Sum_probs=38.6

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             7412311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      +-.++.++||||+||||.+-=|+-+++-..-+|.+-.-|..... -.|++.+.+.++.
T Consensus        30 ~Ge~~~iiG~sGsGKSTLl~~i~Gl~~p~~G~I~~~g~~i~~~~-~~~~~~~~~~ig~   86 (228)
T cd03257          30 KGETLGLVGESGSGKSTLARAILGLLKPTSGSIIFDGKDLLKLS-RRLRKIRRKEIQM   86 (228)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCC-HHHHHHHCCCEEE
T ss_conf             99899999999986999999997289878866998996467799-9999972463799


No 408
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).
Probab=96.01  E-value=0.0086  Score=39.92  Aligned_cols=35  Identities=34%  Similarity=0.643  Sum_probs=30.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             23113544444247899999998522674267743
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAG  147 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~  147 (321)
                      .|.+-|+-||||||.+.+|+.+++.+|.+|.+..-
T Consensus         2 ~IviEG~dGsGKsT~~~~L~~~L~~~g~~v~~~~e   36 (200)
T cd01672           2 FIVFEGIDGAGKTTLIELLAERLEARGYEVVLTRE   36 (200)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             89998998999999999999999977993899869


No 409
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]
Probab=96.00  E-value=0.0037  Score=42.45  Aligned_cols=117  Identities=26%  Similarity=0.265  Sum_probs=56.3

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCCCC----CCCCCCCHHHHH
Q ss_conf             67412311354444424789999999852267426774345124-5688999997530353212----235866124542
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS-AAIDQLKIWADRTSADFVC----SEIGSDAAALAY  183 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~-aA~eQL~~~a~~~~v~~~~----~~~~~dp~~v~~  183 (321)
                      .-++-+||.||.|+||||+.-=+|.-+--.+. +-.-.|..-+. =+++    .+  .-++++-    +..|=|-..=..
T Consensus        36 ri~hAYlfsG~RGvGKTt~Ari~AkalNC~~~-~~~ePC~~C~~Ck~I~----~g--~~~DviEiDaASn~gVddiR~i~  108 (515)
T COG2812          36 RIAHAYLFSGPRGVGKTTIARILAKALNCENG-PTAEPCGKCISCKEIN----EG--SLIDVIEIDAASNTGVDDIREII  108 (515)
T ss_pred             CCHHHHHHCCCCCCCCHHHHHHHHHHHCCCCC-CCCCCCHHHHHHHHHH----CC--CCCCCHHHHHHHCCCHHHHHHHH
T ss_conf             42333651377776710499999999568898-7777225316668651----48--86410113644454867999999


Q ss_pred             HHHHHHHH-HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             28999965-148759986543332115778999989987630222343011231023352
Q gi|254780709|r  184 EAFKQAQA-KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG  242 (321)
Q Consensus       184 ~a~~~a~~-~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g  242 (321)
                      +.+.|+-. .+|-|.|||.+-.+.+         ...+.+=|..+..|..+.+++ |||-
T Consensus       109 e~v~y~P~~~ryKVyiIDEvHMLS~---------~afNALLKTLEEPP~hV~FIl-ATTe  158 (515)
T COG2812         109 EKVNYAPSEGRYKVYIIDEVHMLSK---------QAFNALLKTLEEPPSHVKFIL-ATTE  158 (515)
T ss_pred             HHHCCCCCCCCCEEEEEECHHHHHH---------HHHHHHHCCCCCCCCCEEEEE-ECCC
T ss_conf             8724688666641899831876437---------888887511136866748998-5388


No 410
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.00  E-value=0.0078  Score=40.21  Aligned_cols=53  Identities=17%  Similarity=0.239  Sum_probs=34.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             412311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      -.++.++|+||+||||.+-=|+..++-..-+|.+-.-|+-+.    -.+.+..++|+
T Consensus        36 Ge~vaivG~nGsGKSTLlk~l~Gll~p~~G~I~v~G~~i~~~----~~~~~~~~ig~   88 (273)
T PRK13632         36 GEYVAILGHNGSGKSTISKILTGLLKPQSGEIKIFGITISKE----NLKYLRKKIGI   88 (273)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCC----CHHHHHHHEEE
T ss_conf             989999999998699999999738778887599999999968----98998743569


No 411
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=95.98  E-value=0.1  Score=32.38  Aligned_cols=153  Identities=18%  Similarity=0.236  Sum_probs=73.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---------CCCCC-CCCHHHHH
Q ss_conf             311354444424789999999852267426774345124568899999753035321---------22358-66124542
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---------CSEIG-SDAAALAY  183 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---------~~~~~-~dp~~v~~  183 (321)
                      ++.+|=--.||||.++.|.+....-            .....++++..+...+-+-+         ..+.. .--..+++
T Consensus         2 ~vv~GHVD~GKSTL~g~LL~~~g~i------------~~~~~~~~~~~~~~~~~~~~~~a~~lD~~~~ErerGiTId~~~   69 (208)
T cd04166           2 FLTCGSVDDGKSTLIGRLLYDSKSI------------FEDQLAALESKSCGTGGEPLDLALLVDGLQAEREQGITIDVAY   69 (208)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCC------------CHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCCEEEEE
T ss_conf             6999748898889999999982996------------7899999998875416763000343468687882697941058


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH---HHHHHCCCCE
Q ss_conf             2899996514875998654333211577899998998763022234301123102335225778999---8764358976
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE---MFHAVAGTTG  260 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~---~F~~~~~~~g  260 (321)
                         .++..++..+.||||.|.    .+.+.++.   +-+.     ..+-.+||+||.-|..  .|.+   ..-..+++..
T Consensus        70 ---~~f~~~~~~~~iiDtPGH----~dfi~nmi---~gas-----~aD~ailVVda~~G~~--~QT~eh~~~~~~lgi~~  132 (208)
T cd04166          70 ---RYFSTPKRKFIIADTPGH----EQYTRNMV---TGAS-----TADLAILLVDARKGVL--EQTRRHSYILSLLGIRH  132 (208)
T ss_pred             ---EEEEECCCEEEEEECCCC----HHHHHHHH---HHHH-----HCCEEEEEEECCCCCC--HHHHHHHHHHHHCCCCE
T ss_conf             ---999819926999878962----88999999---9986-----3774799997588872--78999999999749983


Q ss_pred             EE--EECCCCCC----CHHHHH----HHHHHHC-CCEEEEEC----CCCC
Q ss_conf             99--96545787----069999----9999976-98899975----8981
Q gi|254780709|r  261 LI--MTKMDGTA----RGGGLI----PIVVTHK-IPVYFLGV----GEGI  295 (321)
Q Consensus       261 ~I--~TKlD~ta----~~G~~l----s~~~~~~-~Pi~fig~----Ge~i  295 (321)
                      +|  +.|||.-.    +.-.+.    ......+ .++.||-.    |+++
T Consensus       133 iIv~vNKmD~v~~~e~~f~~i~~~~~~~l~~~~~~~~~~IPiSa~~GdNi  182 (208)
T cd04166         133 VVVAVNKMDLVDYSEEVFEEIVADYLAFAAKLGIEDITFIPISALDGDNV  182 (208)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCC
T ss_conf             99999885768999899999999999999974998871998126778887


No 412
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=95.97  E-value=0.02  Score=37.40  Aligned_cols=114  Identities=22%  Similarity=0.232  Sum_probs=58.9

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321223586612454228999965
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA  191 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~  191 (321)
                      .-|+++|+-|+||||-+-+|......++..+.++.                     ++        |.... ..    ..
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~~~~~~~~t~~~---------------------~~--------~~~~~-~~----~~   51 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDEFPEGYPPTIGN---------------------LD--------PAKTI-EP----YR   51 (219)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCEEE---------------------CC--------CCCEE-EC----CC
T ss_conf             79999999999889999999647676556761454---------------------04--------32036-22----66


Q ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHC----C-CC--EEEEE
Q ss_conf             14875998654333211577899998998763022234301123102335225778999876435----8-97--69996
Q gi|254780709|r  192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVA----G-TT--GLIMT  264 (321)
Q Consensus       192 ~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~----~-~~--g~I~T  264 (321)
                      ..+++.++||||.-.        +.   .+...+ ...++-.++|.|.+......+..+...+.+    + -.  =++..
T Consensus        52 ~~~~~~~~Dt~gq~~--------~~---~~~~~y-~~~~~~~l~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~iilv~n  119 (219)
T COG1100          52 RNIKLQLWDTAGQEE--------YR---SLRPEY-YRGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVPILLVGN  119 (219)
T ss_pred             CCEEEEEEECCCHHH--------HH---HHHHHC-CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             600267676798699--------99---988750-438978999997620565788999999999874668867999697


Q ss_pred             CCCCCCC
Q ss_conf             5457870
Q gi|254780709|r  265 KMDGTAR  271 (321)
Q Consensus       265 KlD~ta~  271 (321)
                      |.|-...
T Consensus       120 K~Dl~~~  126 (219)
T COG1100         120 KIDLFDE  126 (219)
T ss_pred             CCCCCCC
T ss_conf             6105543


No 413
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=95.97  E-value=0.038  Score=35.36  Aligned_cols=110  Identities=19%  Similarity=0.248  Sum_probs=58.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+|+|+.|+||||-+.+|.    . +...-                      -+|.++..            ++..+.++
T Consensus         2 ililGLd~aGKTTil~~l~----~-~~~~~----------------------~~PT~G~~------------~~~~~~~~   42 (167)
T cd04161           2 LLTVGLDNAGKTTLVSALQ----G-EIPKK----------------------VAPTVGFT------------PTKLRLDK   42 (167)
T ss_pred             EEEEEECCCCHHHHHHHHC----C-CCCCC----------------------CCCCCCCC------------EEEEEECC
T ss_conf             8999008998899999982----8-99876----------------------50877731------------79999899


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
Q ss_conf             87599865433321157789999899876302223430112310233522577899987643589769996545787069
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGG  273 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G  273 (321)
                      +.+.+.|..|....           +..-+.+.. ..+-+++|+|++--+..-+....|++.+.                
T Consensus        43 ~~l~~~DlgG~~~~-----------R~lW~~Y~~-~~~gIIfVVDssD~~rl~eak~~L~~lL~----------------   94 (167)
T cd04161          43 YEVCIFDLGGGANF-----------RGIWVNYYA-EAHGLVFVVDSSDDDRVQEVKEILRELLQ----------------   94 (167)
T ss_pred             EEEEEEECCCCHHH-----------HHHHHHHCC-CCCEEEEEEECCCHHHHHHHHHHHHHHHC----------------
T ss_conf             99999989987788-----------899998734-77657999855758899999999999965----------------


Q ss_pred             HHHHHHHHHCCCEEEEECCCC
Q ss_conf             999999997698899975898
Q gi|254780709|r  274 GLIPIVVTHKIPVYFLGVGEG  294 (321)
Q Consensus       274 ~~ls~~~~~~~Pi~fig~Ge~  294 (321)
                          -....++||..++.=|.
T Consensus        95 ----~~~l~~~PiLIlaNKqD  111 (167)
T cd04161          95 ----HPRVSGKPILVLANKQD  111 (167)
T ss_pred             ----CHHHCCCEEEEEEECCC
T ss_conf             ----88778995999988657


No 414
>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491   This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome.    ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins. They include the proteasome in Eukaryotes, Archaea, and Actinomycetales and the HslVU (ClpQY, ClpXP) complex in other eubacteria. Genes homologous to eubacterial HslV, IPR001353 from INTERPRO, (ClpQ,) and HslU (ClpY, ClpX) have also been demonstrated in to be present in the genome of trypanosomatid protozoa. They are expressed as precursors, with a propeptide that is removed to produce the active protease. The protease is probably located in the kinetoplast (mitochondrion). Phylogenetic analysis shows that HslV and HslU from trypanosomatids form a single clad with other eubacterial homologs . ; GO: 0005515 protein binding, 0005524 ATP binding, 0009377 HslUV protease activity, 0016887 ATPase activity, 0005737 cytoplasm, 0009376 HslUV protease complex.
Probab=95.96  E-value=0.015  Score=38.29  Aligned_cols=67  Identities=24%  Similarity=0.365  Sum_probs=33.2

Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHH-HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             99999999875127899899999-9999878520100121000136674123113544444247899999998
Q gi|254780709|r   64 QKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKM  135 (321)
Q Consensus        64 ~~Iie~ik~~~~~~~i~~~~i~~-~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~  135 (321)
                      ++|+++|=+...+++-- ...+. .|+.-++.+..  ...+..  --.|.-|+|+||||||||=-+-.||+..
T Consensus         4 reiV~~LD~yIiGQ~~A-Kk~VAiALrNRyrR~~L--~~~L~~--EV~PKNILMiGpTGVGKTEIARRlAKL~   71 (463)
T TIGR00390         4 REIVAELDKYIIGQDEA-KKAVAIALRNRYRRSQL--EEELKD--EVTPKNILMIGPTGVGKTEIARRLAKLA   71 (463)
T ss_pred             HHHHHHHCCCCCCHHHH-HHHHHHHHHHHHHHHCC--CCCCCC--CCCCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             35887514422063667-88999998866776128--711135--6587430432788985447999999984


No 415
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=95.96  E-value=0.11  Score=32.24  Aligned_cols=39  Identities=18%  Similarity=0.266  Sum_probs=28.4

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             123113544444247899999998522674267743451
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTF  150 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dtf  150 (321)
                      ..+.++|+||+||||.+-=|+..+.-..-+|.+-..|..
T Consensus        31 e~v~ivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~   69 (221)
T cd03244          31 EKVGIVGRTGSGKSSLLLALFRLVELSSGSILIDGVDIS   69 (221)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECC
T ss_conf             899999999998999999996797189848999999966


No 416
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=95.95  E-value=0.059  Score=34.02  Aligned_cols=34  Identities=18%  Similarity=0.338  Sum_probs=24.6

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             4123113544444247899999998522674267
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVML  144 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~l  144 (321)
                      -.++.++||||+||||.+-=||-.++-..-+|.+
T Consensus        28 GE~~~llGpSGsGKSTLlr~iaGL~~p~sG~I~~   61 (352)
T PRK10851         28 GQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRF   61 (352)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             9899999999846999999997699999569999


No 417
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.94  E-value=0.0085  Score=39.93  Aligned_cols=39  Identities=28%  Similarity=0.396  Sum_probs=29.7

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             412311354444424789999999852267426774345
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT  149 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt  149 (321)
                      -.++.++||||+||||++-=|+-+++-..-+|.+-..|.
T Consensus        26 Gei~gllGpNGAGKSTll~~i~Gl~~p~~G~i~i~G~~~   64 (220)
T cd03265          26 GEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHDV   64 (220)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEC
T ss_conf             839999999987199999999769788962899999998


No 418
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=95.93  E-value=0.055  Score=34.25  Aligned_cols=39  Identities=26%  Similarity=0.455  Sum_probs=31.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             41231135444442478999999985226742677434512456
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
                      +.-|+++||-|+||||-...||.++.     .-++-+|.|-+.+
T Consensus         3 ~~a~VVmGVsGsGKSTvg~~LA~~L~-----~~fiegDd~Hp~~   41 (176)
T PRK09825          3 GESYILMGVSGSGKSLIGSKIAALFS-----AKFIDGDDLHPAK   41 (176)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHC-----CCEECCCCCCCHH
T ss_conf             85799982898998999999999959-----8776234437898


No 419
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.93  E-value=0.006  Score=40.98  Aligned_cols=41  Identities=22%  Similarity=0.369  Sum_probs=30.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             41231135444442478999999985226742677434512
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
                      -.++.++||||+||||.+-=++-.++-..-+|.+-.-|..+
T Consensus        30 Ge~~aliG~NGaGKSTLl~~i~Gll~p~~G~I~i~G~~i~~   70 (277)
T PRK13652         30 KQRIAVIGPNGAGKSTLFKHFNGILKPTSGSVLIRGEPITK   70 (277)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCC
T ss_conf             98999999999479999999966999984699999999998


No 420
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=95.92  E-value=0.03  Score=36.05  Aligned_cols=57  Identities=16%  Similarity=0.177  Sum_probs=39.5

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             412311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
                      -.++.++||+|+||||.+-=++-.++-..-++.+-.-|.......+.-+.+.+.++.
T Consensus        30 Ge~~~iiG~sGsGKTTll~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~rr~~Ig~   86 (218)
T cd03255          30 GEFVAIVGPSGSGKSTLLNILGGLDRPTSGEVRVDGTDISKLSEKELAAFRRRHIGF   86 (218)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCCEEE
T ss_conf             989999999998699999999669999964999999998879989999986504789


No 421
>PRK13808 adenylate kinase; Provisional
Probab=95.92  E-value=0.13  Score=31.72  Aligned_cols=143  Identities=19%  Similarity=0.267  Sum_probs=82.0

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+|.||.|+||.|-+..|+..|.-    +-|-++|-+|.+--.         +-|+         ...+.   .+.    
T Consensus         3 IIlLGPPGsGKGTQA~~L~~~~gi----~hISTGDmLR~aI~~---------~T~L---------G~kaK---~im----   53 (297)
T PRK13808          3 LILLGPPGAGKGTQAQRLVQQYGI----VQLSTGDMLRAAVAA---------GTPV---------GLKAK---DIM----   53 (297)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCC----CEECHHHHHHHHHHC---------CCHH---------HHHHH---HHH----
T ss_conf             999789999858999999998698----867586999999975---------9987---------99999---999----


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH-----CCCCEEEEECCCC
Q ss_conf             87599865433321157789999899876302223430112310233522577899987643-----5897699965457
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV-----AGTTGLIMTKMDG  268 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~-----~~~~g~I~TKlD~  268 (321)
                             -.|.+--|+ ++-+|-  ..-+.    ..+...=++||+--  .-+.||+.+...     +.++.||--+.|+
T Consensus        54 -------~~G~LVPDe-IVi~lI--~erL~----~~d~~~GfILDGFP--RTv~QAEaLD~~L~~~g~~LD~VIel~Vdd  117 (297)
T PRK13808         54 -------ASGGLVPDE-VVVGII--SDRIE----QPDAANGFILDGFP--RTVPQAEALDALLKDKQLKLDAVVELRVNE  117 (297)
T ss_pred             -------HCCCCCCHH-HHHHHH--HHHHC----CCCCCCCEEEECCC--CCHHHHHHHHHHHHHCCCCCCEEEEEECCH
T ss_conf             -------766988889-999999--99966----85667898722899--998999999999981899978689976788


Q ss_pred             CCCHHHHHHHHHHHCCCEEEEECCCCC--CCCCCCCHHHHHHHHC
Q ss_conf             870699999999976988999758981--3255577899999872
Q gi|254780709|r  269 TARGGGLIPIVVTHKIPVYFLGVGEGI--NDLEPFVAKDFSAVIT  311 (321)
Q Consensus       269 ta~~G~~ls~~~~~~~Pi~fig~Ge~i--~Dl~~f~~~~~~~~ll  311 (321)
                      .+=..-+..=..++.      ..||.+  ||    ||+.|..||.
T Consensus       118 ~~Lv~RI~~R~~e~~------a~Ge~~R~DD----n~E~~~kRL~  152 (297)
T PRK13808        118 GALLARVETRVAEMR------ARGEEVRADD----TPEVLAKRLA  152 (297)
T ss_pred             HHHHHHHHHHHHHHH------HCCCCCCCCC----CHHHHHHHHH
T ss_conf             999999998888776------1488788899----9999999999


No 422
>PRK01172 ski2-like helicase; Provisional
Probab=95.91  E-value=0.11  Score=32.01  Aligned_cols=123  Identities=18%  Similarity=0.212  Sum_probs=72.2

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHH--HHCCCC--CCCCCCCCCH-----HHHH
Q ss_conf             31135444442478999999985-226742677434512456889999975--303532--1223586612-----4542
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWAD--RTSADF--VCSEIGSDAA-----ALAY  183 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~--~~~v~~--~~~~~~~dp~-----~v~~  183 (321)
                      ++++=|||+||| -+|-+|.+-. .+|+|++.++  .||+=|-|-...|.+  ..|+.+  +.+....+|.     .|+-
T Consensus        40 llvsaPTgsGKT-lvAe~ai~~~l~~~~k~iyi~--P~kAL~~EK~~~~~~~~~~g~~v~~~tGd~~~~~~~~~~~~I~V  116 (674)
T PRK01172         40 VIVSVPTAAGKT-LIAYSAIYETFLAGLKSIYIV--PLRSLAMEKYEELSRLRSLGMRVKISIGDYDDPPDFIKRYDVVI  116 (674)
T ss_pred             EEEECCCCCCHH-HHHHHHHHHHHHHCCCEEEEC--CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEE
T ss_conf             999789998699-999999999998589799987--78999999999999887379827788538889801025589999


Q ss_pred             HHHHHHH---------HHCCCEEEEECCC------CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             2899996---------5148759986543------332115778999989987630222343011231023352257789
Q gi|254780709|r  184 EAFKQAQ---------AKKVDVLIIDTAG------RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       184 ~a~~~a~---------~~~~DvvliDTAG------R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~  248 (321)
                      -+.+++.         .++..+|+||-.-      |-.+=+.++.   ++.. +      .|+--+.-++||.+ |.-+.
T Consensus       117 ~T~Ek~~sl~~~~~~~l~~v~~vViDEiH~i~d~~RG~~lE~~l~---kl~~-l------~~~~qiIgLSATi~-N~~~l  185 (674)
T PRK01172        117 LTSEKADSLIHHDPYIINDVGLIVADEIHIIGDEDRGPTLETVLS---SARY-V------NPDARILALSATVS-NANEL  185 (674)
T ss_pred             ECHHHHHHHHHCCCHHHCCCCEEEEECCEECCCCCCHHHHHHHHH---HHHH-C------CCCEEEEEECCCCC-CHHHH
T ss_conf             878999999864950221369899826525068772499999999---9985-3------86607997157868-99999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780709|r  249 VE  250 (321)
Q Consensus       249 a~  250 (321)
                      |+
T Consensus       186 a~  187 (674)
T PRK01172        186 AQ  187 (674)
T ss_pred             HH
T ss_conf             98


No 423
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=95.91  E-value=0.056  Score=34.20  Aligned_cols=34  Identities=24%  Similarity=0.365  Sum_probs=25.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             4123113544444247899999998522674267
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVML  144 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~l  144 (321)
                      -.++.++|+||+||||.+-=|+-.++-..-++.+
T Consensus        38 GEiv~LiG~nGaGKSTLlr~i~Gl~~p~~G~I~~   71 (257)
T PRK11247         38 GQFVAVVGRSGCGKSTLLRLLAGLETPTAGDLLA   71 (257)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             9899999899888999999996589888870898


No 424
>pfam00406 ADK Adenylate kinase.
Probab=95.90  E-value=0.018  Score=37.65  Aligned_cols=93  Identities=15%  Similarity=0.162  Sum_probs=50.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH--HC
Q ss_conf             1354444424789999999852267426774345124568899999753035321223586612454228999965--14
Q gi|254780709|r  116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA--KK  193 (321)
Q Consensus       116 ~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~--~~  193 (321)
                      |+|+.||||+|-+.+||..|.    -+-+-+.|.+|..+-.+- .+++++.--+-.+  .--|..++.+-+..+-.  ..
T Consensus         1 i~G~PGsGKgTqa~~La~~~~----~~~is~GdllR~~~~~~s-~~g~~i~~~i~~G--~lvpd~i~~~l~~~~l~~~~~   73 (186)
T pfam00406         1 LLGPPGAGKGTQAERIVQKYG----IVHLSTGDLLRAEVKSGT-ELGKEAKEYMDKG--ELVPDEVVVGLVKERLEQNDC   73 (186)
T ss_pred             CCCCCCCCHHHHHHHHHHHHC----CEEECHHHHHHHHHHCCC-HHHHHHHHHHHCC--CCCCHHHHHHHHHHHHCCCCC
T ss_conf             918898985999999999859----906769999999986288-7999999999869--954309999999999707455


Q ss_pred             CCEEEEECCCCCCCHHHHHHHH
Q ss_conf             8759986543332115778999
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGI  215 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL  215 (321)
                      ..-+++|=--|.......++++
T Consensus        74 ~~g~iLDGfPRt~~Qa~~l~~~   95 (186)
T pfam00406        74 KNGFLLDGFPRTVPQAEALEEM   95 (186)
T ss_pred             CCCEEEECCCCCHHHHHHHHHH
T ss_conf             4866873798989999999999


No 425
>TIGR02237 recomb_radB DNA repair and recombination protein RadB; InterPro: IPR011939    This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO) and DMC1 (IPR011940 from INTERPRO), and archaeal RadA (IPR011938 from INTERPRO) ,, .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0008094 DNA-dependent ATPase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=95.89  E-value=0.04  Score=35.25  Aligned_cols=88  Identities=18%  Similarity=0.221  Sum_probs=54.1

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCHHHHHHHHHHHHHHCCC---------CCCCCCCCCCHHHH
Q ss_conf             2311354444424789999999852267426774345-1245688999997530353---------21223586612454
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-FRSAAIDQLKIWADRTSAD---------FVCSEIGSDAAALA  182 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-fR~aA~eQL~~~a~~~~v~---------~~~~~~~~dp~~v~  182 (321)
                      |-=+=||.|+||||-|=++|-.-..+|++|+.|-+-= |=+   |-+++.++-.+.+         +|....=.+=..+.
T Consensus        14 iTQiYGp~G~GKTn~c~~~a~~a~~~Gk~v~YiDTEGGLS~---ER~~q~~~~~~~D~e~~~~~~iv~~~~~f~eQ~~ai   90 (223)
T TIGR02237        14 ITQIYGPPGSGKTNICLILAVNAARQGKKVVYIDTEGGLSP---ERFKQIAEDRALDPERVLSNVIVFEVFDFDEQEVAI   90 (223)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH---HHHHHHHHCCCCCHHHHHCCEEEECCCCHHHHHHHH
T ss_conf             88987589986789999999999861895899962898328---999998630588988884153552353567899999


Q ss_pred             HHHHHHHHHH--CCCEEEEECCC
Q ss_conf             2289999651--48759986543
Q gi|254780709|r  183 YEAFKQAQAK--KVDVLIIDTAG  203 (321)
Q Consensus       183 ~~a~~~a~~~--~~DvvliDTAG  203 (321)
                      .++..-+..+  .+++|++|..-
T Consensus        91 ~~~~~~~~~~G~~~~LvVvDs~t  113 (223)
T TIGR02237        91 QKTSKLIDRDGDKADLVVVDSFT  113 (223)
T ss_pred             HHHHHHHHCCCCEEEEEEEECCH
T ss_conf             99999986068833148881533


No 426
>pfam00931 NB-ARC NB-ARC domain.
Probab=95.87  E-value=0.1  Score=32.37  Aligned_cols=89  Identities=24%  Similarity=0.243  Sum_probs=44.1

Q ss_pred             CCCCEEECCCCCCCCHHHHHHHHHH-HHH-HCCCC-EEEE-ECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             6741231135444442478999999-985-22674-2677-434512456889999975303532122358661245422
Q gi|254780709|r  109 HRPHVILVVGVNGVGKTTVIGKLSK-KMS-DAGLK-VMLA-AGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE  184 (321)
Q Consensus       109 ~~p~vil~vG~nG~GKTTT~aKLA~-~~~-~~g~k-V~lv-a~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~  184 (321)
                      +...||.++|.-|+|||| +||..+ ... +.... ++.+ ....|-  -.+-++...++++.+..... ..+....+. 
T Consensus        17 ~~~~vI~I~G~gGiGKTt-LA~~v~~~~~i~~~F~~~~wv~vs~~~~--~~~i~~~i~~~l~~~~~~~~-~~~~~~l~~-   91 (285)
T pfam00931        17 ENLGVVGIVGMGGVGKTT-LAKQIYNDDSVGGHFDSVAWVVVSKTYT--EFRLQKDILQELGLDDSDWV-EKNESELAV-   91 (285)
T ss_pred             CCCEEEEEECCCCCCHHH-HHHHHHCCHHHHHCCCEEEEEEECCCCC--HHHHHHHHHHHHCCCCCCCC-CCCHHHHHH-
T ss_conf             895399988999563999-9999971655650598389999797666--89999999998566654555-578999999-


Q ss_pred             HHHH-HHHHCCCEEEEECCC
Q ss_conf             8999-965148759986543
Q gi|254780709|r  185 AFKQ-AQAKKVDVLIIDTAG  203 (321)
Q Consensus       185 a~~~-a~~~~~DvvliDTAG  203 (321)
                      -+.. .+.+.| +|++|=.-
T Consensus        92 ~l~~~L~~kr~-LiVLDDVw  110 (285)
T pfam00931        92 KIKEALLRKRF-LLVLDDVW  110 (285)
T ss_pred             HHHHHHCCCCE-EEEECCCC
T ss_conf             99999727966-99963888


No 427
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=95.87  E-value=0.0051  Score=41.47  Aligned_cols=48  Identities=21%  Similarity=0.267  Sum_probs=36.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH
Q ss_conf             412311354444424789999999852267426774345124568899
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL  158 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL  158 (321)
                      -.++.++||||+||||++-=++-.++-..-+|.+-..|.-+....+..
T Consensus        26 Gei~~llGpNGAGKSTll~~i~Gl~~p~~G~I~~~g~di~~~~~~~r~   73 (232)
T cd03218          26 GEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLDGQDITKLPMHKRA   73 (232)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHH
T ss_conf             959999999996199999999779999862999999999999999999


No 428
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=95.87  E-value=0.041  Score=35.11  Aligned_cols=139  Identities=22%  Similarity=0.330  Sum_probs=73.9

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
                      -|+++|..|||||+-+-++.+---.....+                     .++++++...       +-.      ..+
T Consensus         2 KivvvG~~~vGKTsli~r~~~~~f~~~~~~---------------------ti~~~~~~~~-------~~~------~~~   47 (161)
T cd01863           2 KILLIGDSGVGKSSLLLRFTDDTFDPDLAA---------------------TIGVDFKVKT-------LTV------DGK   47 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCCCCCC---------------------CCCCCCEEEE-------EEE------CCE
T ss_conf             899999799579999999963999998487---------------------3133423899-------999------999


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHC-------CCC-EEEEE
Q ss_conf             4875998654333211577899998998763022234301123102335225778999876435-------897-69996
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVA-------GTT-GLIMT  264 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~-------~~~-g~I~T  264 (321)
                      .+.+-|.||+|.-......-..+            ...+-.++|.|.+.. ++++.++.+.+.+       ++- -+|-+
T Consensus        48 ~~~l~iwDt~g~~~~~~~~~~~~------------~~a~~~ilvfd~~~~-~Sf~~i~~~~~~i~~~~~~~~~~~ilVgn  114 (161)
T cd01863          48 KVKLAIWDTAGQERFRTLTSSYY------------RGAQGVILVYDVTRR-DTFTNLETWLNELETYSTNNDIVKMLVGN  114 (161)
T ss_pred             EEEEEEEECCCCCCCCCCHHHHH------------HHCCEEEEEEECCCH-HHHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             99999999999842353422441------------321534899767826-56999999999999856888873788731


Q ss_pred             CCCCCCC---HHHHHHHHHHHCCCEEEEEC--CCCCCCC
Q ss_conf             5457870---69999999997698899975--8981325
Q gi|254780709|r  265 KMDGTAR---GGGLIPIVVTHKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       265 KlD~ta~---~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl  298 (321)
                      |.|-..+   .=.+...+...+.|...++.  |++|+++
T Consensus       115 K~D~~~~~v~~~~~~~~a~~~~~~y~e~Sak~g~nV~~~  153 (161)
T cd01863         115 KIDKENREVTREEGLKFARKHNMLFIETSAKTRDGVQQA  153 (161)
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCHHHH
T ss_conf             044000689999999999986999999715868159999


No 429
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=95.86  E-value=0.083  Score=33.00  Aligned_cols=124  Identities=22%  Similarity=0.267  Sum_probs=69.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHH---HCCCC--EEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             231135444442478999999985---22674--2677434512456889999975303532122358661245422899
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMS---DAGLK--VMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~---~~g~k--V~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
                      -|.++|--+.||||-+-.|..+-.   ..+..  ...-..|+.   ..||-|...-...           |.++.+..  
T Consensus         2 NvaiigHvdhGKTTL~d~Ll~~t~~~~~~~~~~~~~~~~~D~~---~~E~eRgiTI~s~-----------~~sl~~~~--   65 (213)
T cd04167           2 NVAIAGHLHHGKTSLLDMLIEQTHDLTPSGKDGWKPLRYTDIR---KDEQERGISIKSS-----------PISLVLPD--   65 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCC---HHHHHHCCCEECC-----------EEEEEEEC--
T ss_conf             5999827898989999999997344555404442113575164---6654203558614-----------59999825--


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH-----HHHHHHHHHHHHCCCCEEE
Q ss_conf             99651487599865433321157789999899876302223430112310233522-----5778999876435897699
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ-----NALRQVEMFHAVAGTTGLI  262 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq-----~~~~~a~~F~~~~~~~g~I  262 (321)
                       .+.+.|-+-||||.|.    .+-+.|...-.++        -+-.+||+||.-|-     ..+.+|..  ..++ -=++
T Consensus        66 -~~~k~~~inlIDTPGH----~dF~~ev~~al~~--------~DgailVVDa~eGv~~qT~~~l~~a~~--~~l~-~ilv  129 (213)
T cd04167          66 -SKGKSYLFNIIDTPGH----VNFMDEVAAALRL--------SDGVVLVVDVVEGVTSNTERLIRHAIL--EGLP-IVLV  129 (213)
T ss_pred             -CCCCEEEEEEEECCCC----HHHHHHHHHHHHH--------CCEEEEEEECCCCCCHHHHHHHHHHHH--CCCC-EEEE
T ss_conf             -6675057877889872----4179999988863--------776799998788875779999999998--6999-8999


Q ss_pred             EECCCC
Q ss_conf             965457
Q gi|254780709|r  263 MTKMDG  268 (321)
Q Consensus       263 ~TKlD~  268 (321)
                      +.|+|-
T Consensus       130 iNKiDR  135 (213)
T cd04167         130 INKIDR  135 (213)
T ss_pred             EECCCC
T ss_conf             988234


No 430
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=95.84  E-value=0.012  Score=38.93  Aligned_cols=134  Identities=16%  Similarity=0.168  Sum_probs=65.4

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
                      |+++|..||||||-+-++..    .....     +            +---+|..+..         +        ...+
T Consensus         2 I~llG~~~~GKTsll~~~~~----~~f~~-----~------------~~pTig~~~~~---------i--------~~~~   43 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIAG----GQFSE-----D------------TIPTVGFNMRK---------V--------TKGN   43 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHC----CCCCC-----C------------CCCCCCEEEEE---------E--------EECC
T ss_conf             89999999869999999975----99988-----6------------16732505899---------9--------9899


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH-HHHHHC---CCC----EEEEEC
Q ss_conf             875998654333211577899998998763022234301123102335225778999-876435---897----699965
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE-MFHAVA---GTT----GLIMTK  265 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~-~F~~~~---~~~----g~I~TK  265 (321)
                      +.+-+-||||.-     .++.|.      ..+.. .-+-.++|.|++-- +.++.++ .+++.+   ...    =++.+|
T Consensus        44 ~~l~iwDt~G~e-----~~~~l~------~~y~~-~~~~ii~V~D~sd~-~s~~~~~~~l~~~~~~~~~~~~piliv~NK  110 (159)
T cd04159          44 VTLKVWDLGGQP-----RFRSMW------ERYCR-GVNAIVYVVDAADR-TALEAAKNELHDLLEKPSLEGIPLLVLGNK  110 (159)
T ss_pred             EEEEEEECCCHH-----HHHHHH------HHHHC-CCCEEEECCCCCCH-HHHHHHHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             999999798358-----779999------98746-86368751577878-899999999999985443489828988835


Q ss_pred             CCCCCCH-----HHHHHHHHHHCCCEEEE--E--CCCCCCCC
Q ss_conf             4578706-----99999999976988999--7--58981325
Q gi|254780709|r  266 MDGTARG-----GGLIPIVVTHKIPVYFL--G--VGEGINDL  298 (321)
Q Consensus       266 lD~ta~~-----G~~ls~~~~~~~Pi~fi--g--~Ge~i~Dl  298 (321)
                      .|-..+.     =..+......+.++.|+  +  +|++|++.
T Consensus       111 ~Dl~~~~~~~~i~~~~~~~~~~~~~~~~~~~SAktg~gI~e~  152 (159)
T cd04159         111 NDLPGALSVDELIEQMNLKSITDREVSCYSISCKEKTNIDIV  152 (159)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH
T ss_conf             676434789999999999987349987999979689698999


No 431
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=95.84  E-value=0.015  Score=38.31  Aligned_cols=33  Identities=42%  Similarity=0.552  Sum_probs=29.0

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             366741231135444442478999999985226
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAG  139 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g  139 (321)
                      ...+|.++.++||.|+||||-+--|..+|.++.
T Consensus        35 ~epPP~vVavvGPpgvGKtTLiksLvk~ytk~~   67 (225)
T cd01882          35 EEPPPLVVAVVGPPGVGKTTLIKSLVKNYTKQN   67 (225)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             899996999989899778899999999985443


No 432
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487   ClpX is a member of the HSP (heat-shock protein) 100 family. Gel filtration and electron microscopy showed that ClpX subunits associate to form a six-membered ring that is stabilized by binding of ATP or nonhydrolyzable analogs of ATP . It functions as an ATP-depedent  molecular chaperone and is the regulatory subunit of the ClpXP protease .   ClpXP is involved in DNA damage repair, stationary-phase gene expression, and ssrA-mediated protein quality control. To date more than 50 proteins include transcription factors, metabolic enzymes, and proteins involved in the starvation and oxidative stress responses have been identified as substrates .    The N-terminal domain of ClpX is a C4-type zinc binding domain (ZBD) involved in substrate recognition. ZBD forms a very stable dimer that is essential for promoting the degradation of some typical ClpXP substrates such as lO and MuA .  ; GO: 0005515 protein binding, 0005524 ATP binding, 0016887 ATPase activity, 0015031 protein transport.
Probab=95.83  E-value=0.0049  Score=41.60  Aligned_cols=66  Identities=26%  Similarity=0.427  Sum_probs=42.2

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC---------CCCCCCCCHHHH
Q ss_conf             12311354444424789999999852267426774345124568899999753035321---------223586612454
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV---------CSEIGSDAAALA  182 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~---------~~~~~~dp~~v~  182 (321)
                      +-|++|||||||||=-+                              +|+|++++|||-         +++-|.|.--|.
T Consensus       153 SNILLiGPTGSGKTLLA------------------------------qTLA~~L~VPfAiADATtLTEAGYVGEDVENIL  202 (452)
T TIGR00382       153 SNILLIGPTGSGKTLLA------------------------------QTLARILNVPFAIADATTLTEAGYVGEDVENIL  202 (452)
T ss_pred             CCEEEECCCCCCHHHHH------------------------------HHHHHHCCCCEEECCHHHHHCCCCCCCCHHHHH
T ss_conf             66245468885268999------------------------------999987388742111110200664242288999


Q ss_pred             HHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             228999965----14875998654333211577899998998
Q gi|254780709|r  183 YEAFKQAQA----KKVDVLIIDTAGRLHNNSILMAGIGKMIR  220 (321)
Q Consensus       183 ~~a~~~a~~----~~~DvvliDTAGR~~~~~~lm~EL~ki~~  220 (321)
                      .+=++.|--    -+.-+|.||             |+.||.|
T Consensus       203 ~~Llq~ad~DV~kA~kGIiYID-------------EIDKIaR  231 (452)
T TIGR00382       203 LKLLQAADYDVEKAQKGIIYID-------------EIDKIAR  231 (452)
T ss_pred             HHHHHHCCCCHHHHCCCEEEEE-------------CCCCHHH
T ss_conf             9998741455245278508984-------------2231012


No 433
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=95.82  E-value=0.2  Score=30.38  Aligned_cols=86  Identities=19%  Similarity=0.246  Sum_probs=38.2

Q ss_pred             EECCCCCCCCHHHHHHH-HHHHHHHC--CCC-EEEEECCCCCHHHH---HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             31135444442478999-99998522--674-26774345124568---8999997530353212235866124542289
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGK-LSKKMSDA--GLK-VMLAAGDTFRSAAI---DQLKIWADRTSADFVCSEIGSDAAALAYEAF  186 (321)
Q Consensus       114 il~vG~nG~GKTTT~aK-LA~~~~~~--g~k-V~lva~DtfR~aA~---eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~  186 (321)
                      ++...++|+|||.+-.= +..++...  ... -++|-+-| |.-|.   ++.+.++...++.+.....|.+...   + .
T Consensus        39 vi~~a~TGSGKTlay~lpil~~l~~~~~~~~~~alil~PT-rELa~Qi~~~~~~l~~~~~i~~~~~~gg~~~~~---~-~  113 (203)
T cd00268          39 VIGQAQTGSGKTAAFLIPILEKLDPSPKKDGPQALILAPT-RELALQIAEVARKLGKHTNLKVVVIYGGTSIDK---Q-I  113 (203)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECC-HHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHH---H-H
T ss_conf             8997579972228888699999861667689669999687-999999999999850579838999838988799---9-9


Q ss_pred             HHHHHHCCCEEEEECCCCCC
Q ss_conf             99965148759986543332
Q gi|254780709|r  187 KQAQAKKVDVLIIDTAGRLH  206 (321)
Q Consensus       187 ~~a~~~~~DvvliDTAGR~~  206 (321)
                      .. ..++.| |+|=|.||+.
T Consensus       114 ~~-l~~~~~-IlI~TPgrl~  131 (203)
T cd00268         114 RK-LKRGPH-IVVATPGRLL  131 (203)
T ss_pred             HH-HHCCCE-EEEECCHHHH
T ss_conf             99-853875-9996818999


No 434
>pfam00625 Guanylate_kin Guanylate kinase.
Probab=95.78  E-value=0.019  Score=37.52  Aligned_cols=87  Identities=17%  Similarity=0.196  Sum_probs=43.5

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH----------HHHHHHHH---HHHHCCC-CCCCCCCCC
Q ss_conf             123113544444247899999998522674267743451245----------68899999---7530353-212235866
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA----------AIDQLKIW---ADRTSAD-FVCSEIGSD  177 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~a----------A~eQL~~~---a~~~~v~-~~~~~~~~d  177 (321)
                      .+|.++||.||||||-+.+|...+...=..+.-.++=.=|++          .-++.+.+   ++=+.-. +....+|..
T Consensus         2 klivl~GPSG~GK~tl~~~L~~~~~~~~~~~vs~TTR~~R~~E~~G~dY~Fvs~~~F~~~i~~~~FlE~~~~~g~~YGt~   81 (182)
T pfam00625         2 RPIVLSGPSGVGKSHIKKALLDEYPEKFGYSVSHTTRPPRPGEVDGKDYHFVSKEEMENDISANEFLEHAEFNGNYYGTS   81 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEC
T ss_conf             86999898999999999999984866734457655479998787896579965899999875437776264079725640


Q ss_pred             CHHHHHHHHHHHHHHCCCEEE-EECCC
Q ss_conf             124542289999651487599-86543
Q gi|254780709|r  178 AAALAYEAFKQAQAKKVDVLI-IDTAG  203 (321)
Q Consensus       178 p~~v~~~a~~~a~~~~~Dvvl-iDTAG  203 (321)
                           .++++.+..++.++|+ +|+.|
T Consensus        82 -----~~~I~~~~~~g~~vvl~id~~g  103 (182)
T pfam00625        82 -----KEAIEQIAESGKICILDVDIQG  103 (182)
T ss_pred             -----HHHHHHHHHCCCEEEEEECHHH
T ss_conf             -----2777999867996999972899


No 435
>KOG0734 consensus
Probab=95.7