HHsearch alignment for GI: 254780709 and conserved domain: pfam00071

>pfam00071 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Probab=96.53  E-value=0.024  Score=36.80  Aligned_cols=138  Identities=20%  Similarity=0.287  Sum_probs=72.7

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
T Consensus         2 i~vvG~~~vGKTsli~r~~~~~f~~~----------~~~-----------t~~~~~~~~~-------~~~------~~~~   47 (162)
T pfam00071         2 LVLVGDGGVGKSSLLIRFTQNKFPEE----------YIP-----------TIGVDFYTKT-------IEV------DGKT   47 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCC----------CCC-----------CCEEEEEEEE-------EEE------CCEE
T ss_conf             89999799779999999961999987----------477-----------4135567899-------999------9999


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----HCC--C-CEEEEECC
Q ss_conf             8759986543332115778999989987630222343011231023352257789998764----358--9-76999654
Q gi|254780709|r  194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA----VAG--T-TGLIMTKM  266 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~----~~~--~-~g~I~TKl  266 (321)
T Consensus        48 ~~~~i~Dt~G~e~~-~~----~~~--~~~~-----~ad~~iivfd~~~-~~S~~~i~~~~~~i~~~~~~~~piilvgnK~  114 (162)
T pfam00071        48 VKLQIWDTAGQERF-RA----LRP--LYYR-----GAQGFLLVYDITS-RDSFENVKKWLEEILRHADDNVPIVLVGNKC  114 (162)
T ss_pred             EEEEEEECCCCHHH-HH----HHH--HHHC-----CCCCCEEECCCCC-HHHHHHHHHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             99999978987204-67----889--9862-----5765504234898-8999999999999998579886288997524


Q ss_pred             CC-CCC---HHHHHHHHHHHCCCEEEEEC--CCCCCCC
Q ss_conf             57-870---69999999997698899975--8981325
Q gi|254780709|r  267 DG-TAR---GGGLIPIVVTHKIPVYFLGV--GEGINDL  298 (321)
Q Consensus       267 D~-ta~---~G~~ls~~~~~~~Pi~fig~--Ge~i~Dl  298 (321)
T Consensus       115 Dl~~~~~i~~~e~~~~a~~~~~~y~e~Sak~g~gI~~~  152 (162)
T pfam00071       115 DLEDQRVVSTEEGEALAKELGLPFMETSAKTNENVEEA  152 (162)
T ss_pred             CHHHCCCCCHHHHHHHHHHHCCEEEEECCCCCCCHHHH
T ss_conf             74651889999999999980997999737888299999