HHsearch alignment for GI: 254780709 and conserved domain: pfam00625

>pfam00625 Guanylate_kin Guanylate kinase.
Probab=95.78  E-value=0.019  Score=37.52  Aligned_cols=87  Identities=17%  Similarity=0.196  Sum_probs=43.5

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH----------HHHHHHHH---HHHHCCC-CCCCCCCCC
Q ss_conf             123113544444247899999998522674267743451245----------68899999---7530353-212235866
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA----------AIDQLKIW---ADRTSAD-FVCSEIGSD  177 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~a----------A~eQL~~~---a~~~~v~-~~~~~~~~d  177 (321)
T Consensus         2 klivl~GPSG~GK~tl~~~L~~~~~~~~~~~vs~TTR~~R~~E~~G~dY~Fvs~~~F~~~i~~~~FlE~~~~~g~~YGt~   81 (182)
T pfam00625         2 RPIVLSGPSGVGKSHIKKALLDEYPEKFGYSVSHTTRPPRPGEVDGKDYHFVSKEEMENDISANEFLEHAEFNGNYYGTS   81 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEC
T ss_conf             86999898999999999999984866734457655479998787896579965899999875437776264079725640


Q ss_pred             CHHHHHHHHHHHHHHCCCEEE-EECCC
Q ss_conf             124542289999651487599-86543
Q gi|254780709|r  178 AAALAYEAFKQAQAKKVDVLI-IDTAG  203 (321)
Q Consensus       178 p~~v~~~a~~~a~~~~~Dvvl-iDTAG  203 (321)
T Consensus        82 -----~~~I~~~~~~g~~vvl~id~~g  103 (182)
T pfam00625        82 -----KEAIEQIAESGKICILDVDIQG  103 (182)
T ss_pred             -----HHHHHHHHHCCCEEEEEECHHH
T ss_conf             -----2777999867996999972899