HHsearch alignment for GI: 254780709 and conserved domain: pfam01583

>pfam01583 APS_kinase Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Probab=97.50  E-value=0.00011  Score=53.32  Aligned_cols=43  Identities=30%  Similarity=0.577  Sum_probs=39.9

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             7412311354444424789999999852267426774345124
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS  152 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~  152 (321)
T Consensus         1 kG~viW~TGLsGsGKTTlA~~l~~~L~~~~~~~~~LDGD~~R~   43 (157)
T pfam01583         1 RGCTVWFTGLSGSGKSTIANALERKLFAQGISVYVLDGDNVRH   43 (157)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHC
T ss_conf             9889998898999999999999999997599779976887750