HHsearch alignment for GI: 254780709 and conserved domain: pfam05970

>pfam05970 DUF889 PIF1 helicase. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated.
Probab=97.04  E-value=0.0041  Score=42.16  Aligned_cols=117  Identities=18%  Similarity=0.158  Sum_probs=67.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             5444442478999999985226742677434512456889-999975303532122358661245422899996514875
Q gi|254780709|r  118 GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ-LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDV  196 (321)
Q Consensus       118 G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQ-L~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~Dv  196 (321)
T Consensus         1 G~AGTGKS~ll~~i~~~l~~~~~~v~v-tA~TGiAA~~i~gG~TiHs~~gi~~~~~~~--~~~~~~~~~~~~~~~~~~~v   77 (418)
T pfam05970         1 GYGGTGKTFLWNALSARIRSRGKIVLN-VASSGIAALLLPGGRTAHSRFGIPLDIDED--STCKIKRGSKLAELLKKASL   77 (418)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEE-ECCHHHHHHCCCCCEEHHHCCCCCCCCCCC--CCEEECCCHHHHHHHHHCCE
T ss_conf             979887999999999999768988999-896899985169987398526989887742--01121337788998740879


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCC---CEEEEECCC
Q ss_conf             9986543332115778999989987630222343---011231023
Q gi|254780709|r  197 LIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP---HSVLQVLDA  239 (321)
Q Consensus       197 vliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p---~~~~lVlda  239 (321)
T Consensus        78 LIIDEiSMv--~~~lfd~id~~lr~i~~~~~~~PFGGiqvIl~GDf  121 (418)
T pfam05970        78 IIWDEAPMT--HRHCFEALDRTLRDILKNTDDKPFGGKTVVLGGDF  121 (418)
T ss_pred             EEEECCCCC--CHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCH
T ss_conf             998541135--78999999999999871278767797479982447