HHsearch alignment for GI: 254780709 and conserved domain: pfam06414

>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=97.90  E-value=7.3e-05  Score=54.42  Aligned_cols=103  Identities=20%  Similarity=0.239  Sum_probs=62.4

Q ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC--CCCCCCCCCCHHHHHH
Q ss_conf             36674123113544444247899999998522674267743451245688999997530353--2122358661245422
Q gi|254780709|r  107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD--FVCSEIGSDAAALAYE  184 (321)
Q Consensus       107 ~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~--~~~~~~~~dp~~v~~~  184 (321)
T Consensus         8 ~~~~Pkai~laG~pGAGKS~~~~~~~~~~~--~~~~v~In~D~~r~~~----P~y~~l~~~~~~~~~~~~~~~a~~~~~~   81 (191)
T pfam06414         8 PQERPVAVLLGGQPGAGKTELARALLEELG--GGNVVRIDPDELRTYH----PDYDELQKADPKDASELTQPDASRWVEK   81 (191)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHCC--CCCCEEECCHHHHHHH----HHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             876987999957998888999999987537--8993897135878877----7478655407677899989999999999


Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCHH-HHHHHHH
Q ss_conf             8999965148759986543332115-7789999
Q gi|254780709|r  185 AFKQAQAKKVDVLIIDTAGRLHNNS-ILMAGIG  216 (321)
Q Consensus       185 a~~~a~~~~~DvvliDTAGR~~~~~-~lm~EL~  216 (321)
T Consensus        82 ~~~~a~~~r~n-~iiegT~~~~~~~~~~~~~lk  113 (191)
T pfam06414        82 LIDYAIERGYN-IILEGTLRSPDVARKLARKLK  113 (191)
T ss_pred             HHHHHHHCCCC-EEEECCCCCHHHHHHHHHHHH
T ss_conf             99999975999-898577789799999999999