HHsearch alignment for GI: 254780709 and conserved domain: pfam09848

>pfam09848 DUF2075 Uncharacterized conserved protein (DUF2075). This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.
Probab=95.59  E-value=0.043  Score=35.03  Aligned_cols=90  Identities=26%  Similarity=0.310  Sum_probs=51.2

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHH--CCC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             12311354444424789999999852--267-426774345124568899999753035321223586612454228999
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSD--AGL-KVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ  188 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~--~g~-kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~  188 (321)
T Consensus         2 ~v~~V~G~pGtGKTvv~l~l~~~l~~~~~~~~~~~l~~N~~~~~~l~~~l~~---~~~~~~~--~~~~~~~~fi-~~~~-   74 (348)
T pfam09848         2 AVFLVTGGPGTGKTVVALNLFAELSDSDLGRTAVFLSGNHPLVLVLYEALAG---DLKVRKK--KLFRKPTSFI-NNLH-   74 (348)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHH---HCCHHHC--CCCCCCHHHH-CCCC-
T ss_conf             7999977799389999999999986440268208995786699999999860---4120010--2000725231-6523-


Q ss_pred             HHHHCCCEEEEECCCCCCCH
Q ss_conf             96514875998654333211
Q gi|254780709|r  189 AQAKKVDVLIIDTAGRLHNN  208 (321)
Q Consensus       189 a~~~~~DvvliDTAGR~~~~  208 (321)
T Consensus        75 ~~~~~~dvvivDEAhRl~~k   94 (348)
T pfam09848        75 KAPPHEDVVIVDEAHRLWTK   94 (348)
T ss_pred             CCCCCCCEEEEEHHHHHHHC
T ss_conf             57986778998317866543