HHsearch alignment for GI: 254780709 and conserved domain: smart00382

>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=98.58  E-value=5.5e-07  Score=69.36  Aligned_cols=97  Identities=27%  Similarity=0.291  Sum_probs=70.0

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
T Consensus         2 ~~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~   75 (148)
T smart00382        2 GEVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLL------LIIVGGKKASGSGELRLRLALALAR   75 (148)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             9789999999702999999999872668996899875998988898765------3000112210519999999999998


Q ss_pred             HHCCCEEEEECCCCCCCHHHHHH
Q ss_conf             51487599865433321157789
Q gi|254780709|r  191 AKKVDVLIIDTAGRLHNNSILMA  213 (321)
Q Consensus       191 ~~~~DvvliDTAGR~~~~~~lm~  213 (321)
T Consensus        76 ~~~~~viiiDei~~~~~~~~~~~   98 (148)
T smart00382       76 KLKPDVLILDEITSLLDAEQEAL   98 (148)
T ss_pred             HCCCCEEEEECCHHHCCCCCHHH
T ss_conf             44998999827502147620799