BLAST/PSIBLAST alignment of GI: 254780709 and GI: 241206753 at iteration 1
>gi|241206753|ref|YP_002977849.1| signal recognition particle-docking protein FtsY [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 533
>gi|240860643|gb|ACS58310.1| signal recognition particle-docking protein FtsY [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 533
 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/307 (59%), Positives = 238/307 (77%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V    LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+GV  A +
Sbjct: 224 VLQPKLSWFQRLRNGLARTSSQLTGQITALFTKRKLDDETLQDLEDLLIQADLGVETAMR 283

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           + + L ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKT
Sbjct: 284 VTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGTGKT 343

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWADRT+++F+ +++G+DAA LAY+A
Sbjct: 344 TTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWADRTNSEFIGTKLGADAAGLAYDA 403

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           F+QA+AKK DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNA
Sbjct: 404 FEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNA 463

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG+ DLEPF A+D
Sbjct: 464 LSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVEDLEPFEAED 523

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 524 FAHAIAG 530