BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780709|ref|YP_003065122.1| cell division protein
[Candidatus Liberibacter asiaticus str. psy62]
         (321 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040386|gb|ACT57182.1| cell division protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 321

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/321 (100%), Positives = 321/321 (100%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV
Sbjct: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
           AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN
Sbjct: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA
Sbjct: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT
Sbjct: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP
Sbjct: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300

Query: 301 FVAKDFSAVITGCLDYGEEKI 321
           FVAKDFSAVITGCLDYGEEKI
Sbjct: 301 FVAKDFSAVITGCLDYGEEKI 321


>gi|315121874|ref|YP_004062363.1| cell division protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495276|gb|ADR51875.1| cell division protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 315

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/314 (80%), Positives = 280/314 (89%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           S+S SWI+K  KGFASTSLKLKEGI  +ISS+RLDD VR+ELEDLLIR+DIG+  AQ+IV
Sbjct: 2   SKSFSWIQKKAKGFASTSLKLKEGIAAVISSKRLDDSVRDELEDLLIRADIGLEAAQEIV 61

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            +L+ KRY KDVS+Q VL DVSE I+K+LMP+SK F+ DFSHRPHVILVVGVNG GKTT 
Sbjct: 62  GDLVAKRYNKDVSIQCVLQDVSEKIYKILMPISKSFDLDFSHRPHVILVVGVNGAGKTTA 121

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLSKKMSD+GLK+MLAAGDTFRSAA+DQLKIWADRTS+DFV SEIGSDAAALAYEAF+
Sbjct: 122 IGKLSKKMSDSGLKIMLAAGDTFRSAAVDQLKIWADRTSSDFVGSEIGSDAAALAYEAFR 181

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           QAQAK VDVLIIDTAGRLHNNS LMAGIGKMIRVLKRLDP APHSVLQVLDAT GQNALR
Sbjct: 182 QAQAKNVDVLIIDTAGRLHNNSALMAGIGKMIRVLKRLDPDAPHSVLQVLDATVGQNALR 241

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F +VAGTTGLIMTK+DGTARGG L+ I + HKIPVYFLG GEGINDLEPFVAKDFS
Sbjct: 242 QVELFQSVAGTTGLIMTKLDGTARGGILVSIAIKHKIPVYFLGTGEGINDLEPFVAKDFS 301

Query: 308 AVITGCLDYGEEKI 321
             ITG  DY E+KI
Sbjct: 302 TAITGYFDYNEKKI 315


>gi|86359533|ref|YP_471425.1| cell division protein [Rhizobium etli CFN 42]
 gi|86283635|gb|ABC92698.1| cell division protein [Rhizobium etli CFN 42]
          Length = 522

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 242/313 (77%), Gaps = 1/313 (0%)

Query: 1   MSNQKVASES-LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIG 59
           +  Q +A +  LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+G
Sbjct: 207 IEPQPIAPQPKLSWFQRLRNGLARTSSQLTNQITALFTKRKLDDETLQDLEDLLIQADLG 266

Query: 60  VAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
           V  A ++ + L ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGV
Sbjct: 267 VETALRVTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGV 326

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NG GKTT IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT+++FV +++G+DAA
Sbjct: 327 NGTGKTTTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTNSEFVGTKLGADAA 386

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
            LAY+AF+QA+AKK DVLI+DTAGRL N + LMA + K++RVL RLDP APH+VLQ LDA
Sbjct: 387 GLAYDAFEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGRLDPDAPHTVLQTLDA 446

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
           TTGQNAL QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGE ++DLE
Sbjct: 447 TTGQNALSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEAVDDLE 506

Query: 300 PFVAKDFSAVITG 312
           PF A+DF+  I G
Sbjct: 507 PFEAEDFARAIAG 519


>gi|241206753|ref|YP_002977849.1| signal recognition particle-docking protein FtsY [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860643|gb|ACS58310.1| signal recognition particle-docking protein FtsY [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 533

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/307 (59%), Positives = 238/307 (77%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V    LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+GV  A +
Sbjct: 224 VLQPKLSWFQRLRNGLARTSSQLTGQITALFTKRKLDDETLQDLEDLLIQADLGVETAMR 283

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           + + L ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKT
Sbjct: 284 VTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGTGKT 343

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWADRT+++F+ +++G+DAA LAY+A
Sbjct: 344 TTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWADRTNSEFIGTKLGADAAGLAYDA 403

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           F+QA+AKK DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNA
Sbjct: 404 FEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNA 463

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG+ DLEPF A+D
Sbjct: 464 LSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVEDLEPFEAED 523

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 524 FAHAIAG 530


>gi|190893800|ref|YP_001980342.1| cell division protein [Rhizobium etli CIAT 652]
 gi|190699079|gb|ACE93164.1| cell division protein [Rhizobium etli CIAT 652]
          Length = 520

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 242/310 (78%), Gaps = 1/310 (0%)

Query: 4   QKVASES-LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q +A +  LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+GV  
Sbjct: 208 QPIAPQPKLSWFQRLRNGLARTSSQLTGQITALFTKRKLDDETLQDLEDLLIQADLGVET 267

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
           A ++ + L ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG 
Sbjct: 268 ALRVTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGT 327

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+ K+S AGLKVM+AAGDTFR+AAI+QLKIWA+RT+++FV +++G+DAA LA
Sbjct: 328 GKTTTIGKLAAKLSGAGLKVMVAAGDTFRAAAIEQLKIWAERTNSEFVGTKLGADAAGLA 387

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+AF+QA+AKK DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTG
Sbjct: 388 YDAFEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTG 447

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNAL QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF 
Sbjct: 448 QNALSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLEPFE 507

Query: 303 AKDFSAVITG 312
           A+DF+  I G
Sbjct: 508 AEDFAHAIAG 517


>gi|218661335|ref|ZP_03517265.1| cell division protein [Rhizobium etli IE4771]
          Length = 335

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 241/305 (79%), Gaps = 1/305 (0%)

Query: 4   QKVASES-LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q +A ++ LSW ++L  G A TSL+L   IT + + R+LDD   ++LEDLLI++D+GV  
Sbjct: 31  QPIAPQAKLSWFQRLRNGLARTSLQLTNQITALFTKRKLDDETLQDLEDLLIQADLGVET 90

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
           A ++ + L ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG 
Sbjct: 91  ALRVTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGT 150

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT ++FV +++G+DAA LA
Sbjct: 151 GKTTTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTKSEFVGTKLGADAAGLA 210

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+AF+QA+AKK DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTG
Sbjct: 211 YDAFEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTG 270

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNAL QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF 
Sbjct: 271 QNALSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLEPFE 330

Query: 303 AKDFS 307
           A+DF+
Sbjct: 331 AEDFA 335


>gi|209551317|ref|YP_002283234.1| signal recognition particle-docking protein FtsY [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537073|gb|ACI57008.1| signal recognition particle-docking protein FtsY [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 528

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 238/307 (77%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V    LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+GV  A +
Sbjct: 219 VPQPKLSWFQRLRNGLARTSSQLTGQITALFTKRKLDDETLQDLEDLLIQADLGVETALR 278

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           + + L ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKT
Sbjct: 279 VTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGTGKT 338

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT+++F+ +++G+DAA LAY+A
Sbjct: 339 TTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTNSEFIGTKLGADAAGLAYDA 398

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           F+QA+A+K DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNA
Sbjct: 399 FEQAKARKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNA 458

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG+ DLEPF A+D
Sbjct: 459 LSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVEDLEPFEAED 518

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 519 FAHAIAG 525


>gi|116254270|ref|YP_770108.1| cell division protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258918|emb|CAK10027.1| putative SRP receptor [Rhizobium leguminosarum bv. viciae 3841]
          Length = 531

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/307 (59%), Positives = 237/307 (77%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V    LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+GV  A +
Sbjct: 222 VLQPKLSWFQRLRNGLARTSSQLTGQITALFTKRKLDDETLQDLEDLLIQADLGVETAMR 281

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           + + L ++RY KDV+ + V   ++  I K+L P+++P   D SH+PHVILVVGVNG GKT
Sbjct: 282 VTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVARPLQLDLSHKPHVILVVGVNGTGKT 341

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWADRT ++F+ +++G+DAA LAY+A
Sbjct: 342 TTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWADRTKSEFIGTKLGADAAGLAYDA 401

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           F+QA+AKK DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNA
Sbjct: 402 FEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNA 461

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG+ DLEPF A+D
Sbjct: 462 LSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVEDLEPFEAED 521

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 522 FAHAIAG 528


>gi|327190191|gb|EGE57296.1| cell division protein [Rhizobium etli CNPAF512]
          Length = 524

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/313 (58%), Positives = 242/313 (77%), Gaps = 1/313 (0%)

Query: 1   MSNQKVASES-LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIG 59
           +  Q +A +  LSW ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+G
Sbjct: 209 VEPQPIAPQPKLSWFQRLRNGLARTSSQLTNQITALFTKRKLDDETLQDLEDLLIQADLG 268

Query: 60  VAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
           V  A ++ + L ++RY KDV+ + V   ++  I K+L P++K    D SH+PHVILVVGV
Sbjct: 269 VETALRVTDTLASERYGKDVTGEDVSRIMASEIAKVLKPVAKSLQLDLSHKPHVILVVGV 328

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NG GKTT IGKL+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT+++FV +++G+DAA
Sbjct: 329 NGTGKTTTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTNSEFVGTKLGADAA 388

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
            LAY+AF+QA+AKK DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDA
Sbjct: 389 GLAYDAFEQAKAKKCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDA 448

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
           TTGQNAL QVE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLE
Sbjct: 449 TTGQNALSQVEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLE 508

Query: 300 PFVAKDFSAVITG 312
           PF A+DF+  I G
Sbjct: 509 PFEAEDFAHAIAG 521


>gi|325294064|ref|YP_004279928.1| cell division particle [Agrobacterium sp. H13-3]
 gi|325061917|gb|ADY65608.1| cell division particle [Agrobacterium sp. H13-3]
          Length = 476

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 236/303 (77%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW ++L  G A TS +L   I+ + + R+LD+   +ELEDLLI+SD+GV  A +I   L
Sbjct: 174 LSWFQRLRAGLARTSSQLTTQISALFTKRKLDEDTLDELEDLLIQSDLGVETAMRITGAL 233

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            ++RY KDVS + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 234 SSERYGKDVSGEDVARIMAGEITKVLKPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 293

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K+S +GLKVMLAAGDTFR+AAI+QLKIWADRT + F+ +++G+DA+ LAY+A++QA+
Sbjct: 294 LASKLSGSGLKVMLAAGDTFRAAAIEQLKIWADRTGSQFIGTKLGADASGLAYDAYEQAR 353

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+K DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNAL QVE
Sbjct: 354 AQKSDVLIIDTAGRLQNKTELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALNQVE 413

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG +GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF A+DF+  I
Sbjct: 414 IFRNVAGVSGLIMTKLDGTARGGILVAIAAKHKLPVYFIGVGEGVDDLEPFEAEDFAKAI 473

Query: 311 TGC 313
            G 
Sbjct: 474 AGV 476


>gi|227823743|ref|YP_002827716.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           fredii NGR234]
 gi|227342745|gb|ACP26963.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           fredii NGR234]
          Length = 532

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/303 (60%), Positives = 234/303 (77%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW ++L  G A TS +L   I  + + R+LD+   E+LEDLLI++D+GV  A +I + L
Sbjct: 227 LSWYQRLRHGLARTSSQLTGQIASLFTKRKLDEATLEDLEDLLIQADLGVETAMRITDTL 286

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            ++RY KDV+ + V   ++  I K+L P+++P   D S +PHVILVVGVNG GKTT IGK
Sbjct: 287 ASERYGKDVTGEDVSRIMAGEIAKVLAPVARPLELDLSQKPHVILVVGVNGTGKTTTIGK 346

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT +D V S++G+DAA LAYEAF+ A+
Sbjct: 347 LAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTKSDIVASKLGADAAGLAYEAFQLAR 406

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
            KK DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNAL+QVE
Sbjct: 407 EKKSDVLIIDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALQQVE 466

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG +GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEGI+DLEPF AKDF+  I
Sbjct: 467 IFRNVAGVSGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGIDDLEPFEAKDFAEAI 526

Query: 311 TGC 313
            G 
Sbjct: 527 AGV 529


>gi|15889947|ref|NP_355628.1| cell division particle [Agrobacterium tumefaciens str. C58]
 gi|15157906|gb|AAK88413.1| cell division particle [Agrobacterium tumefaciens str. C58]
          Length = 478

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/303 (59%), Positives = 236/303 (77%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           L+W ++L  G A TS +L   I+ + + R+LD+   +ELEDLLI+SD+GV  A +I   L
Sbjct: 176 LTWFQRLRAGLARTSSQLTTQISALFTKRKLDEDTLDELEDLLIQSDLGVETAMRITGAL 235

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            ++RY KDVS + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 236 SSERYGKDVSGEDVARIMAGEITKVLKPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 295

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K+S +GLKVMLAAGDTFR+AAI+QLKIWADRT ++F+ +++G+DAA LAY+A++QA+
Sbjct: 296 LAAKLSGSGLKVMLAAGDTFRAAAIEQLKIWADRTGSEFIGTKLGADAAGLAYDAYEQAR 355

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+K DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNA+ QVE
Sbjct: 356 AQKSDVLIIDTAGRLQNKTELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNAMNQVE 415

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG +GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG+ DLEPF A+DF+  I
Sbjct: 416 IFRNVAGVSGLIMTKLDGTARGGILVAIAAKHKLPVYFIGVGEGVEDLEPFEAEDFAKAI 475

Query: 311 TGC 313
            G 
Sbjct: 476 AGV 478


>gi|15966990|ref|NP_387343.1| putative cell division protein [Sinorhizobium meliloti 1021]
 gi|307302458|ref|ZP_07582215.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           meliloti BL225C]
 gi|307316212|ref|ZP_07595656.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           meliloti AK83]
 gi|15076263|emb|CAC47816.1| Putative cell division protein [Sinorhizobium meliloti 1021]
 gi|306898052|gb|EFN28794.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           meliloti AK83]
 gi|306903128|gb|EFN33718.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           meliloti BL225C]
          Length = 548

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/303 (59%), Positives = 236/303 (77%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           L+W ++L  G A TS +L   I  + + R+LD+   ++LEDLLI++D+GV  A +I + L
Sbjct: 243 LNWYQRLRLGLARTSSQLTGQIASLFTKRKLDEATLQDLEDLLIQADLGVETAMRITDTL 302

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            ++RY KDVS + V   ++  I K+L P+++P   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 303 ASERYGKDVSGEDVSRIMAGEITKVLAPVARPLELDLSHKPHVILVVGVNGTGKTTTIGK 362

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT ++ V S++G+DAA LAYEAF++A+
Sbjct: 363 LAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTKSEIVSSKLGADAAGLAYEAFQRAR 422

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
            +K DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNAL+QVE
Sbjct: 423 EQKADVLIIDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALQQVE 482

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG +GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEGI+DLEPF AK+F+  I
Sbjct: 483 IFRNVAGVSGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGIDDLEPFEAKEFAEAI 542

Query: 311 TGC 313
            G 
Sbjct: 543 AGV 545


>gi|150398285|ref|YP_001328752.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           medicae WSM419]
 gi|150029800|gb|ABR61917.1| signal recognition particle-docking protein FtsY [Sinorhizobium
           medicae WSM419]
          Length = 520

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/308 (58%), Positives = 237/308 (76%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
            A   L+W ++L  G A TS +L   I  + + R+LD+   ++LEDLLI++D+GV  A +
Sbjct: 210 AAQPKLNWYQRLRLGLARTSSQLTGQIASLFTKRKLDEATLQDLEDLLIQADLGVETAMR 269

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           I + L ++RY KDVS + V   ++  I K+L P++KP   D +H+PHVILVVGVNG GKT
Sbjct: 270 ITDALASERYGKDVSGEDVSRIMAGEITKVLAPVAKPLELDLNHKPHVILVVGVNGTGKT 329

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K+S AGLKVM+AAGDTFR+AAI+QLKIWA+RT ++ V S++G+DAA LAYEA
Sbjct: 330 TTIGKLAAKLSGAGLKVMMAAGDTFRAAAIEQLKIWAERTRSEIVSSKLGADAAGLAYEA 389

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           F++A+ +K DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNA
Sbjct: 390 FQRAREQKADVLIIDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNA 449

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L+QVE+F  VAG +GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF AKD
Sbjct: 450 LQQVEIFRNVAGVSGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLEPFEAKD 509

Query: 306 FSAVITGC 313
           F+  I G 
Sbjct: 510 FAEAIAGV 517


>gi|222087518|ref|YP_002546055.1| cell division protein [Agrobacterium radiobacter K84]
 gi|221724966|gb|ACM28122.1| cell division protein [Agrobacterium radiobacter K84]
          Length = 505

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 237/305 (77%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           + LSW ++L  G A TS +L   I  + + R+LDD   ++LEDLLI++D+GV  A ++ +
Sbjct: 195 QKLSWFQRLRAGLARTSSQLTGQIAALFTKRKLDDQTLQDLEDLLIQADLGVETAMRVTD 254

Query: 69  ELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
            L ++RY KDV+ + V   +++ I K+L P++KP   D SH+PHVIL+VGVNG GKTT I
Sbjct: 255 TLASERYGKDVTGEDVSRIMAQEIAKVLKPVAKPLQLDLSHKPHVILIVGVNGTGKTTTI 314

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+ K+S AGLKVM+AAGDTFR+AAI+QLKIWADRT ++F+ +++G+DAA LA++AF+Q
Sbjct: 315 GKLAAKLSGAGLKVMVAAGDTFRAAAIEQLKIWADRTKSEFIGTKLGADAAGLAFDAFQQ 374

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A K DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNAL Q
Sbjct: 375 AKANKSDVLIIDTAGRLQNKTELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALNQ 434

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
           VE+F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF A++F+ 
Sbjct: 435 VEIFRNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLEPFEAEEFAQ 494

Query: 309 VITGC 313
            I G 
Sbjct: 495 AIAGI 499


>gi|218507763|ref|ZP_03505641.1| cell division protein [Rhizobium etli Brasil 5]
          Length = 303

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/300 (60%), Positives = 236/300 (78%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++L  G A TS +L   IT + + R+LDD   ++LEDLLI++D+GV  A ++ + L +
Sbjct: 1   WFQRLRNGLARTSSQLTGQITALFTKRKLDDETLQDLEDLLIQADLGVETALRVTDTLAS 60

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
           +RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGKL+
Sbjct: 61  ERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGTGKTTTIGKLA 120

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            K+S AGLKVM+AAGDTFR+AAI+QLKIWA+RT+++FV +++G+DAA LAY+AF+QA+AK
Sbjct: 121 AKLSGAGLKVMVAAGDTFRAAAIEQLKIWAERTNSEFVGTKLGADAAGLAYDAFEQAKAK 180

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
           K DVLI+DTAGRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNAL QVE+F
Sbjct: 181 KCDVLIVDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALSQVEIF 240

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF A+DF+  I G
Sbjct: 241 RNVAGVNGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLEPFEAEDFAHAIAG 300


>gi|307943541|ref|ZP_07658885.1| signal recognition particle-docking protein FtsY [Roseibium sp.
           TrichSKD4]
 gi|307773171|gb|EFO32388.1| signal recognition particle-docking protein FtsY [Roseibium sp.
           TrichSKD4]
          Length = 371

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 232/313 (74%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +++   A   LSW +KL KG + +S  L +GI+ I + R+LD  + EELED+LI++D+GV
Sbjct: 58  VADSSEAEPKLSWFQKLKKGLSRSSSALTDGISSIFTKRKLDASMLEELEDILIQADLGV 117

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
             A  I + L   RY K+++   V   +SE + K+L P+++P N +   +PHV+L+VGVN
Sbjct: 118 DTAMAITDRLSDGRYDKEIAPDEVRAILSEEVEKVLAPVAQPLNLETGKKPHVVLMVGVN 177

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKLS+K++  G KVMLAAGDTFR+AA++QLKIW +RT A+ +  + G+DAA 
Sbjct: 178 GTGKTTTIGKLSQKLAAEGKKVMLAAGDTFRAAAVEQLKIWGERTGAEVIARDTGADAAG 237

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA++A K+A AK VDVL+IDTAGRL N + LM  + K+IRV+K+ DP APH+VL  LDAT
Sbjct: 238 LAFDAMKEAMAKDVDVLLIDTAGRLQNKAELMDELEKVIRVIKKHDPEAPHTVLLTLDAT 297

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNAL QVE+F  VAG TGL+MTK+DGTARGG L+ I   H++PV+F+GVGEG++DLEP
Sbjct: 298 TGQNALNQVEIFGKVAGVTGLVMTKLDGTARGGILVAIAAKHQMPVHFIGVGEGVDDLEP 357

Query: 301 FVAKDFSAVITGC 313
           F AKDF++ I G 
Sbjct: 358 FSAKDFASAIAGL 370


>gi|239833060|ref|ZP_04681389.1| signal recognition particle-docking protein FtsY [Ochrobactrum
           intermedium LMG 3301]
 gi|239825327|gb|EEQ96895.1| signal recognition particle-docking protein FtsY [Ochrobactrum
           intermedium LMG 3301]
          Length = 490

 Score =  355 bits (910), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 223/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G   +S  L E I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 187 LSWFERLRRGLLRSSNSLSESIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 246

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDV+ + V   +   I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 247 ASGRYGKDVTGEEVRTIMGAEIEKVLGPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 306

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 307 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 366

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 367 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 426

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  +AG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEG++DLEPF AKDF+  I
Sbjct: 427 IFKNIAGVNGLVMTKLDGTARGGILVAISAKHKLPIYFIGVGEGVDDLEPFAAKDFARAI 486

Query: 311 TGC 313
            G 
Sbjct: 487 AGV 489


>gi|153008260|ref|YP_001369475.1| signal recognition particle-docking protein FtsY [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560148|gb|ABS13646.1| signal recognition particle-docking protein FtsY [Ochrobactrum
           anthropi ATCC 49188]
          Length = 494

 Score =  355 bits (910), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 223/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G   +S  L E I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 191 LSWFERLRRGLLRSSNSLSESIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 250

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDV+ + V   +   I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 251 ASGRYGKDVTGEEVRTIMGAEIEKVLGPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 310

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 311 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 370

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 371 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 430

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  +AG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEG++DLEPF AKDF+  I
Sbjct: 431 IFKNIAGVNGLVMTKLDGTARGGILVAISAKHKLPIYFIGVGEGVDDLEPFAAKDFARAI 490

Query: 311 TGC 313
            G 
Sbjct: 491 AGV 493


>gi|256059908|ref|ZP_05450094.1| GTP-binding signal recognition particle [Brucella neotomae 5K33]
 gi|261323880|ref|ZP_05963077.1| signal recognition particle-docking protein FtsY [Brucella neotomae
           5K33]
 gi|261299860|gb|EEY03357.1| signal recognition particle-docking protein FtsY [Brucella neotomae
           5K33]
          Length = 465

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 172/303 (56%), Positives = 224/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L   I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 162 LSWFERLRRGLARSSSSLSNSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 221

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 222 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 281

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 282 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 341

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 342 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 401

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 402 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 461

Query: 311 TGC 313
            G 
Sbjct: 462 AGV 464


>gi|148560595|ref|YP_001259756.1| cell division protein FtsY [Brucella ovis ATCC 25840]
 gi|163843957|ref|YP_001628361.1| signal recognition particle-docking protein FtsY [Brucella suis
           ATCC 23445]
 gi|189025002|ref|YP_001935770.1| cell division protein FtsY [Brucella abortus S19]
 gi|237816295|ref|ZP_04595288.1| signal recognition particle-docking protein FtsY [Brucella abortus
           str. 2308 A]
 gi|254690075|ref|ZP_05153329.1| GTP-binding signal recognition particle [Brucella abortus bv. 6
           str. 870]
 gi|254694563|ref|ZP_05156391.1| GTP-binding signal recognition particle [Brucella abortus bv. 3
           str. Tulya]
 gi|254696188|ref|ZP_05158016.1| GTP-binding signal recognition particle [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254700575|ref|ZP_05162403.1| GTP-binding signal recognition particle [Brucella suis bv. 5 str.
           513]
 gi|254704945|ref|ZP_05166773.1| GTP-binding signal recognition particle [Brucella suis bv. 3 str.
           686]
 gi|254707541|ref|ZP_05169369.1| GTP-binding signal recognition particle [Brucella pinnipedialis
           M163/99/10]
 gi|254713651|ref|ZP_05175462.1| GTP-binding signal recognition particle [Brucella ceti M644/93/1]
 gi|254715995|ref|ZP_05177806.1| GTP-binding signal recognition particle [Brucella ceti M13/05/1]
 gi|254731106|ref|ZP_05189684.1| GTP-binding signal recognition particle [Brucella abortus bv. 4
           str. 292]
 gi|256030448|ref|ZP_05444062.1| GTP-binding signal recognition particle [Brucella pinnipedialis
           M292/94/1]
 gi|256158432|ref|ZP_05456330.1| GTP-binding signal recognition particle [Brucella ceti M490/95/1]
 gi|256253852|ref|ZP_05459388.1| GTP-binding signal recognition particle [Brucella ceti B1/94]
 gi|256258328|ref|ZP_05463864.1| GTP-binding signal recognition particle [Brucella abortus bv. 9
           str. C68]
 gi|260755613|ref|ZP_05867961.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 6 str. 870]
 gi|260884639|ref|ZP_05896253.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 9 str. C68]
 gi|261214887|ref|ZP_05929168.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 3 str. Tulya]
 gi|261217763|ref|ZP_05932044.1| signal recognition particle-docking protein FtsY [Brucella ceti
           M13/05/1]
 gi|261220990|ref|ZP_05935271.1| signal recognition particle-docking protein FtsY [Brucella ceti
           B1/94]
 gi|261316421|ref|ZP_05955618.1| signal recognition particle-docking protein FtsY [Brucella
           pinnipedialis B2/94]
 gi|261755645|ref|ZP_05999354.1| signal recognition particle-docking protein FtsY [Brucella suis bv.
           3 str. 686]
 gi|265987492|ref|ZP_06100049.1| signal recognition particle-docking protein FtsY [Brucella
           pinnipedialis M292/94/1]
 gi|265996949|ref|ZP_06109506.1| signal recognition particle-docking protein FtsY [Brucella ceti
           M490/95/1]
 gi|294851176|ref|ZP_06791849.1| signal recognition particle receptor [Brucella sp. NVSL 07-0026]
 gi|148371852|gb|ABQ61831.1| cell division protein FtsY [Brucella ovis ATCC 25840]
 gi|163674680|gb|ABY38791.1| signal recognition particle-docking protein FtsY [Brucella suis
           ATCC 23445]
 gi|189020574|gb|ACD73296.1| cell division protein FtsY [Brucella abortus S19]
 gi|237788362|gb|EEP62577.1| signal recognition particle-docking protein FtsY [Brucella abortus
           str. 2308 A]
 gi|260675721|gb|EEX62542.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 6 str. 870]
 gi|260874167|gb|EEX81236.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 9 str. C68]
 gi|260916494|gb|EEX83355.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 3 str. Tulya]
 gi|260919574|gb|EEX86227.1| signal recognition particle-docking protein FtsY [Brucella ceti
           B1/94]
 gi|260922852|gb|EEX89420.1| signal recognition particle-docking protein FtsY [Brucella ceti
           M13/05/1]
 gi|261295644|gb|EEX99140.1| signal recognition particle-docking protein FtsY [Brucella
           pinnipedialis B2/94]
 gi|261745398|gb|EEY33324.1| signal recognition particle-docking protein FtsY [Brucella suis bv.
           3 str. 686]
 gi|262551417|gb|EEZ07407.1| signal recognition particle-docking protein FtsY [Brucella ceti
           M490/95/1]
 gi|264659689|gb|EEZ29950.1| signal recognition particle-docking protein FtsY [Brucella
           pinnipedialis M292/94/1]
 gi|294819765|gb|EFG36764.1| signal recognition particle receptor [Brucella sp. NVSL 07-0026]
          Length = 465

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 172/303 (56%), Positives = 225/303 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 162 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 221

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 222 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 281

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 282 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 341

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 342 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 401

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 402 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 461

Query: 311 TGC 313
            G 
Sbjct: 462 AGV 464


>gi|306842917|ref|ZP_07475553.1| signal recognition particle-docking protein FtsY [Brucella sp. BO2]
 gi|306286940|gb|EFM58460.1| signal recognition particle-docking protein FtsY [Brucella sp. BO2]
          Length = 470

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 225/303 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 167 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 226

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 227 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 286

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 287 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 346

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 347 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 406

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEG++DLEPF AKDF+  I
Sbjct: 407 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGVDDLEPFAAKDFARAI 466

Query: 311 TGC 313
            G 
Sbjct: 467 AGV 469


>gi|23502784|ref|NP_698911.1| signal recognition particle-docking protein FtsY [Brucella suis
           1330]
 gi|62290788|ref|YP_222581.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 1 str. 9-941]
 gi|82700699|ref|YP_415273.1| GTP-binding signal recognition particle [Brucella melitensis biovar
           Abortus 2308]
 gi|254708922|ref|ZP_05170733.1| cell division protein FtsY [Brucella pinnipedialis B2/94]
 gi|256370336|ref|YP_003107847.1| signal recognition particle-docking protein FtsY [Brucella microti
           CCM 4915]
 gi|260546052|ref|ZP_05821792.1| cell division protein FtsY [Brucella abortus NCTC 8038]
 gi|260758838|ref|ZP_05871186.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 4 str. 292]
 gi|260760562|ref|ZP_05872905.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|261315022|ref|ZP_05954219.1| signal recognition particle-docking protein FtsY [Brucella
           pinnipedialis M163/99/10]
 gi|261321389|ref|ZP_05960586.1| signal recognition particle-docking protein FtsY [Brucella ceti
           M644/93/1]
 gi|261751083|ref|ZP_05994792.1| signal recognition particle-docking protein FtsY [Brucella suis bv.
           5 str. 513]
 gi|297247175|ref|ZP_06930893.1| signal recognition particle receptor [Brucella abortus bv. 5 str.
           B3196]
 gi|23348805|gb|AAN30826.1| signal recognition particle-docking protein FtsY [Brucella suis
           1330]
 gi|62196920|gb|AAX75220.1| FtsY, signal recognition particle-docking protein [Brucella abortus
           bv. 1 str. 9-941]
 gi|82616800|emb|CAJ11890.1| GTP-binding signal recognition particle (SRP54)
           G-domain:ATP/GTP-binding site motif A (P-loop):AAA
           ATPase:Cell division trans [Brucella melitensis biovar
           Abortus 2308]
 gi|256000499|gb|ACU48898.1| signal recognition particle-docking protein FtsY [Brucella microti
           CCM 4915]
 gi|260096159|gb|EEW80035.1| cell division protein FtsY [Brucella abortus NCTC 8038]
 gi|260669156|gb|EEX56096.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 4 str. 292]
 gi|260670994|gb|EEX57815.1| signal recognition particle-docking protein FtsY [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|261294079|gb|EEX97575.1| signal recognition particle-docking protein FtsY [Brucella ceti
           M644/93/1]
 gi|261304048|gb|EEY07545.1| signal recognition particle-docking protein FtsY [Brucella
           pinnipedialis M163/99/10]
 gi|261740836|gb|EEY28762.1| signal recognition particle-docking protein FtsY [Brucella suis bv.
           5 str. 513]
 gi|297174344|gb|EFH33691.1| signal recognition particle receptor [Brucella abortus bv. 5 str.
           B3196]
          Length = 463

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 172/303 (56%), Positives = 225/303 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 160 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 219

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 220 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 279

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 280 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 339

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 340 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 399

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 400 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 459

Query: 311 TGC 313
            G 
Sbjct: 460 AGV 462


>gi|110635717|ref|YP_675925.1| signal recognition particle-docking protein FtsY [Mesorhizobium sp.
           BNC1]
 gi|110286701|gb|ABG64760.1| signal recognition particle-docking protein FtsY [Chelativorans sp.
           BNC1]
          Length = 500

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 166/302 (54%), Positives = 223/302 (73%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
            W ++L +G   +S +L++ I  I   R+LD+   ++LED+L+R+D+G+  A ++ + L 
Sbjct: 198 PWFQRLREGLYRSSRELRDNIAGIFLKRKLDEDTLQDLEDVLLRADLGLETAMRVTDALS 257

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY KD++   V   ++E I K+L P++ P   D SH+PHVILVVGVNG GKTT IGKL
Sbjct: 258 VGRYGKDITGAEVQAVMAEEIEKVLKPVALPLELDLSHKPHVILVVGVNGTGKTTTIGKL 317

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K++  GL VMLAAGDTFR+AAI+QLKIW +RT +  + S +G+DAA LAYEA+++A+A
Sbjct: 318 AAKLAQGGLNVMLAAGDTFRAAAIEQLKIWGERTGSAVISSRLGADAAGLAYEAYEKAKA 377

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVLIIDTAGRL N + LMA + K++RVL + DP APH+VLQ LDATTGQNAL QVE+
Sbjct: 378 AGSDVLIIDTAGRLQNKAELMAELEKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVEI 437

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG +GL+MTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF A DF+  I 
Sbjct: 438 FRNVAGVSGLVMTKLDGTARGGILVAIAAKHKLPVYFIGVGEGVDDLEPFSASDFAKAIA 497

Query: 312 GC 313
           G 
Sbjct: 498 GV 499


>gi|161619852|ref|YP_001593739.1| signal recognition particle-docking protein FtsY [Brucella canis
           ATCC 23365]
 gi|260567579|ref|ZP_05838049.1| cell division protein FtsY [Brucella suis bv. 4 str. 40]
 gi|161336663|gb|ABX62968.1| signal recognition particle-docking protein FtsY [Brucella canis
           ATCC 23365]
 gi|260157097|gb|EEW92177.1| cell division protein FtsY [Brucella suis bv. 4 str. 40]
          Length = 465

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 172/303 (56%), Positives = 226/303 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I+ I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 162 LSWFERLRRGLARSSSSLSDSISGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 221

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 222 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 281

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 282 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSSVVSSKLGADAAGLAYDAWEKAK 341

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 342 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 401

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 402 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 461

Query: 311 TGC 313
            G 
Sbjct: 462 AGV 464


>gi|225853372|ref|YP_002733605.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis ATCC 23457]
 gi|256112266|ref|ZP_05453187.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis bv. 3 str. Ether]
 gi|256263146|ref|ZP_05465678.1| cell division protein FtsY [Brucella melitensis bv. 2 str. 63/9]
 gi|225641737|gb|ACO01651.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis ATCC 23457]
 gi|263093049|gb|EEZ17199.1| cell division protein FtsY [Brucella melitensis bv. 2 str. 63/9]
 gi|326409935|gb|ADZ67000.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis M28]
 gi|326539648|gb|ADZ87863.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis M5-90]
          Length = 465

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 224/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 162 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 221

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDV  + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 222 ASGRYGKDVPGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 281

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 282 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 341

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 342 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 401

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 402 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 461

Query: 311 TGC 313
            G 
Sbjct: 462 AGV 464


>gi|225628133|ref|ZP_03786168.1| signal recognition particle-docking protein FtsY [Brucella ceti
           str. Cudo]
 gi|260169358|ref|ZP_05756169.1| signal recognition particle-docking protein FtsY [Brucella sp.
           F5/99]
 gi|261758876|ref|ZP_06002585.1| cell division protein FtsY [Brucella sp. F5/99]
 gi|225616958|gb|EEH14005.1| signal recognition particle-docking protein FtsY [Brucella ceti
           str. Cudo]
 gi|261738860|gb|EEY26856.1| cell division protein FtsY [Brucella sp. F5/99]
          Length = 465

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 225/303 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 162 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 221

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 222 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 281

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 282 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 341

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QV+
Sbjct: 342 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVD 401

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 402 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 461

Query: 311 TGC 313
            G 
Sbjct: 462 AGV 464


>gi|254504835|ref|ZP_05116986.1| signal recognition particle-docking protein FtsY, putative
           [Labrenzia alexandrii DFL-11]
 gi|222440906|gb|EEE47585.1| signal recognition particle-docking protein FtsY, putative
           [Labrenzia alexandrii DFL-11]
          Length = 465

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 226/307 (73%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V  E LSW ++L KG + +S  L +GI+ I + R+LD  + EELED+LI++D+GV  A  
Sbjct: 157 VEEEKLSWFQRLKKGLSRSSSALTDGISSIFTKRKLDAAMLEELEDILIQADLGVDTAMA 216

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           I E L   RY K++S + V   +SE + K+L  +++P + +   +PHV+L+VGVNG GKT
Sbjct: 217 ITERLSDGRYDKEISPEEVREILSEEVEKVLASVAEPLDLNSGKKPHVVLMVGVNGTGKT 276

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKLSKK+ + G  VMLAAGDTFR+AA++QLKIW +RT A+ +  + G+DAA LA++A
Sbjct: 277 TTIGKLSKKLREEGKTVMLAAGDTFRAAAVEQLKIWGERTGAEVIARDTGADAAGLAFDA 336

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            K+A  K+VDVL+IDTAGRL N + LM  + K+IRV+K+ DP APH+ L  LDATTGQNA
Sbjct: 337 MKEATEKQVDVLLIDTAGRLQNKAELMDELEKVIRVIKKHDPDAPHTCLLTLDATTGQNA 396

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QVE+F  VAG TGL+MTK+DGTARGG L+ I   H +PV+F+GVGEG+ DLEPF AKD
Sbjct: 397 LNQVEIFGKVAGVTGLVMTKLDGTARGGILVAIAAKHGLPVHFIGVGEGVEDLEPFSAKD 456

Query: 306 FSAVITG 312
           FS+ I G
Sbjct: 457 FSSAIAG 463


>gi|265993697|ref|ZP_06106254.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis bv. 3 str. Ether]
 gi|262764678|gb|EEZ10599.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis bv. 3 str. Ether]
          Length = 463

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 224/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 160 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 219

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDV  + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 220 ASGRYGKDVPGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 279

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 280 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 339

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 340 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 399

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 400 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 459

Query: 311 TGC 313
            G 
Sbjct: 460 AGV 462


>gi|254717993|ref|ZP_05179804.1| cell division protein FtsY [Brucella sp. 83/13]
 gi|265982939|ref|ZP_06095674.1| signal recognition particle-docking protein FtsY [Brucella sp.
           83/13]
 gi|306839772|ref|ZP_07472573.1| signal recognition particle-docking protein FtsY [Brucella sp. NF
           2653]
 gi|264661531|gb|EEZ31792.1| signal recognition particle-docking protein FtsY [Brucella sp.
           83/13]
 gi|306405127|gb|EFM61405.1| signal recognition particle-docking protein FtsY [Brucella sp. NF
           2653]
          Length = 475

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 224/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 172 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 231

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 232 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 291

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+ +++A+
Sbjct: 292 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDTWEKAK 351

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 352 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 411

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEG++DLEPF AKDF+  I
Sbjct: 412 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGVDDLEPFAAKDFARAI 471

Query: 311 TGC 313
            G 
Sbjct: 472 AGV 474


>gi|13473652|ref|NP_105220.1| cell division protein FtsY [Mesorhizobium loti MAFF303099]
 gi|14024402|dbj|BAB51006.1| mlr4320 [Mesorhizobium loti MAFF303099]
          Length = 313

 Score =  351 bits (901), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 165/302 (54%), Positives = 223/302 (73%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW +++  G A +S +L   I  + + R+LD+   ++LED+LIR+D+G+  A +I + L 
Sbjct: 11  SWFQRMRDGLARSSRELTGNIAGVFTKRKLDEDTLQDLEDVLIRADLGMETALRITDALA 70

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY KDVS   V   ++  + K+L P+++P   D SH+PHVILVVGVNG GKTT IGKL
Sbjct: 71  ASRYGKDVSDTDVRTVMAAEVEKVLTPVARPLELDLSHKPHVILVVGVNGTGKTTTIGKL 130

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K++D GL VMLAAGDTFR+AAI+QLKIW +RT +  + S++G+DAA LAY+AF++A+ 
Sbjct: 131 AAKLTDGGLSVMLAAGDTFRAAAIEQLKIWGERTKSPVIASKLGADAAGLAYDAFEKAKE 190

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ +DATTGQNAL QVE+
Sbjct: 191 AGSDVLIIDTAGRLQNKTELMAELEKIVRVLGKLDPEAPHTVLQTVDATTGQNALNQVEI 250

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  +AG  GL+MTK+DGTARGG L+ I   HK+PVYF+GVGE ++DLEPF A +F+  I 
Sbjct: 251 FRNIAGVNGLVMTKLDGTARGGILVAIAAKHKLPVYFIGVGEQVDDLEPFSASEFARAIA 310

Query: 312 GC 313
           G 
Sbjct: 311 GV 312


>gi|306843384|ref|ZP_07475985.1| signal recognition particle-docking protein FtsY [Brucella sp. BO1]
 gi|306276075|gb|EFM57775.1| signal recognition particle-docking protein FtsY [Brucella sp. BO1]
          Length = 469

 Score =  351 bits (900), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 225/303 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 166 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 225

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            + RY KDVS + V   +S  I K+L P++KP   + SH+PHVILVVGVNG GKTT IGK
Sbjct: 226 ASGRYGKDVSGEEVRAIMSAEIEKVLAPVAKPLELNLSHKPHVILVVGVNGTGKTTTIGK 285

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 286 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 345

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 346 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 405

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEG++DLEPF AKDF+  I
Sbjct: 406 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGVDDLEPFAAKDFARAI 465

Query: 311 TGC 313
            G 
Sbjct: 466 AGV 468


>gi|118591327|ref|ZP_01548725.1| GTP-binding signal recognition particle (SRP54)
           G-domain:ATP/GTP-binding site motif A (P-loop):AAA
           [Stappia aggregata IAM 12614]
 gi|118435999|gb|EAV42642.1| GTP-binding signal recognition particle (SRP54)
           G-domain:ATP/GTP-binding site motif A (P-loop):AAA
           [Stappia aggregata IAM 12614]
          Length = 474

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 165/302 (54%), Positives = 225/302 (74%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW ++L  G + +S  L EGI+ I + R+LD  + EELED+LI++D+GV  A  I + L
Sbjct: 171 LSWFQRLKNGLSRSSASLTEGISSIFTKRKLDASMLEELEDILIQADLGVDTAMAITDRL 230

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              RY K++S + V   ++E + K+L P+++P + D   +PHV+L+VGVNG GKTT IGK
Sbjct: 231 SDGRYNKEISPEEVRAILAEEVEKVLAPVARPLDLDTGKKPHVVLMVGVNGTGKTTTIGK 290

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           LS+K+   G  VMLAAGDTFR+AA++QLKIW +RT A+ +  + G+DAA LAY+A K+A+
Sbjct: 291 LSQKLRSEGKTVMLAAGDTFRAAAVEQLKIWGERTGAEVIARDTGADAAGLAYDAMKEAK 350

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDVL++DTAGRL N + LM  + K+IRV+K+ DP APH+VL  LDATTGQNAL QVE
Sbjct: 351 AKGVDVLLVDTAGRLQNKAELMDELEKVIRVIKKHDPEAPHTVLLTLDATTGQNALNQVE 410

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG TGL+MTK+DGTARGG L+ I   H +PV+F+GVGEG+ DLEPF A++F++ I
Sbjct: 411 IFGKVAGVTGLVMTKLDGTARGGILVAIAAKHAMPVHFIGVGEGVADLEPFSAREFASAI 470

Query: 311 TG 312
            G
Sbjct: 471 AG 472


>gi|319780718|ref|YP_004140194.1| signal recognition particle-docking protein FtsY [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166606|gb|ADV10144.1| signal recognition particle-docking protein FtsY [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 601

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 221/302 (73%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW +++  G A +S +L   I  + + R+LD+   ++LED+LIR+D+G+  A ++ + L 
Sbjct: 299 SWFQRMKDGLARSSKELTGNIAGVFTKRKLDEETLQDLEDVLIRADLGMETALRVTDALA 358

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY KDVS   V   ++  + K+L  ++ P   D SH+PHVILVVGVNG GKTT IGKL
Sbjct: 359 ASRYGKDVSDTEVRAIMAAEVEKVLTHVAMPLELDLSHKPHVILVVGVNGTGKTTTIGKL 418

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K++D GL VMLAAGDTFR+AAI+QLKIW +RT +  + S++G+DAA LAY+AF++A+ 
Sbjct: 419 AAKLTDGGLSVMLAAGDTFRAAAIEQLKIWGERTKSPVIASKLGADAAGLAYDAFERAKE 478

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ +DATTGQNAL QVE+
Sbjct: 479 AGSDVLIIDTAGRLQNKTELMAELEKIVRVLGKLDPEAPHTVLQTVDATTGQNALNQVEI 538

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG  GL+MTK+DGTARGG L+ I   HK+PVYF+GVGE ++DLEPF A +F+  I 
Sbjct: 539 FRNVAGVNGLVMTKLDGTARGGILVAIAAKHKLPVYFIGVGEQVDDLEPFSASEFARAIA 598

Query: 312 GC 313
           G 
Sbjct: 599 GV 600


>gi|256045538|ref|ZP_05448421.1| signal recognition particle receptor FTSY [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260562848|ref|ZP_05833334.1| cell division protein FtsY [Brucella melitensis bv. 1 str. 16M]
 gi|260152864|gb|EEW87956.1| cell division protein FtsY [Brucella melitensis bv. 1 str. 16M]
          Length = 465

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 223/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 162 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 221

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +  Y KDV  + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 222 ASGHYGKDVPGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 281

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 282 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 341

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 342 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 401

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 402 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 461

Query: 311 TGC 313
            G 
Sbjct: 462 AGV 464


>gi|265991964|ref|ZP_06104521.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263003030|gb|EEZ15323.1| signal recognition particle-docking protein FtsY [Brucella
           melitensis bv. 1 str. Rev.1]
          Length = 463

 Score =  349 bits (895), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 223/303 (73%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+  A ++ + L
Sbjct: 160 LSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGLETAMRVTDAL 219

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +  Y KDV  + V   +S  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 220 ASGHYGKDVPGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGK 279

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA LAY+A+++A+
Sbjct: 280 LAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAGLAYDAWEKAK 339

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDATTGQNAL QVE
Sbjct: 340 EAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDATTGQNALNQVE 399

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEPF AKDF+  I
Sbjct: 400 IFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEPFAAKDFARAI 459

Query: 311 TGC 313
            G 
Sbjct: 460 AGV 462


>gi|260469862|ref|ZP_05814009.1| signal recognition particle-docking protein FtsY [Mesorhizobium
           opportunistum WSM2075]
 gi|259028368|gb|EEW29697.1| signal recognition particle-docking protein FtsY [Mesorhizobium
           opportunistum WSM2075]
          Length = 326

 Score =  348 bits (893), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 223/302 (73%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW +++  G A +S +L   I  + + R+LD+   ++LED+LIR+D+G+  A ++ + L 
Sbjct: 24  SWFQRMRDGLARSSRELTGNIAGVFTKRKLDEDTLQDLEDVLIRADLGMETALRVTDALA 83

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           + RY KDVS   V   ++  + K+L  ++ P   D SH+PHVILVVGVNG GKTT IGKL
Sbjct: 84  SSRYGKDVSDTEVRAIMAAEVEKVLTHVAMPLELDLSHKPHVILVVGVNGTGKTTTIGKL 143

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K++D GL VMLAAGDTFR+AAI+QLKIW +RT++  + S++G+DAA LAY+AF++A+ 
Sbjct: 144 AAKLTDGGLSVMLAAGDTFRAAAIEQLKIWGERTNSPVIASKLGADAAGLAYDAFERAKE 203

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVLIIDTAGRL N + LMA + K++RVL +LDP APH+VLQ +DATTGQNAL QVE+
Sbjct: 204 AGSDVLIIDTAGRLQNKTELMAELEKIVRVLGKLDPEAPHTVLQTVDATTGQNALNQVEI 263

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG  GL+MTK+DGTARGG L+ I   HK+PVYF+GVGE ++DLEPF A +F+  I 
Sbjct: 264 FRNVAGVNGLVMTKLDGTARGGILVAIAAKHKLPVYFIGVGEQVDDLEPFSASEFARAIA 323

Query: 312 GC 313
           G 
Sbjct: 324 GV 325


>gi|17986415|ref|NP_539049.1| signal recognition particle receptor FTSY [Brucella melitensis bv.
           1 str. 16M]
 gi|17982009|gb|AAL51313.1| signal recognition particle receptor ftsy [Brucella melitensis bv.
           1 str. 16M]
          Length = 314

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 171/313 (54%), Positives = 225/313 (71%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           M  +      LSW  +L +G A +S  L + I  I + R+LDD   ++LED+LI++D+G+
Sbjct: 1   MPAEVAPEPKLSWFERLRRGLARSSSSLSDSIGGIFTKRKLDDDTLQDLEDVLIQADLGL 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
             A ++ + L +  Y KDV  + V   +S  I K+L P++KP   D SH+PHVILVVGVN
Sbjct: 61  ETAMRVTDALASGHYGKDVPGEEVRAIMSAEIEKVLAPVAKPLELDLSHKPHVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT +  V S++G+DAA 
Sbjct: 121 GTGKTTTIGKLAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGERTGSPVVSSKLGADAAG 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LAY+A+++A+    DVLIIDTAGRL N + LM  + K++RVL + DP APH+VLQ LDAT
Sbjct: 181 LAYDAWEKAKEAGSDVLIIDTAGRLQNKAELMDELAKIVRVLGKHDPEAPHTVLQTLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNAL QVE+F  VAG  GL+MTK+DGTARGG L+ I   HK+P+YF+GVGEGI+DLEP
Sbjct: 241 TGQNALNQVEIFKNVAGVNGLVMTKLDGTARGGILVAISARHKLPIYFIGVGEGIDDLEP 300

Query: 301 FVAKDFSAVITGC 313
           F AKDF+  I G 
Sbjct: 301 FAAKDFARAIAGV 313


>gi|328541784|ref|YP_004301893.1| Cell division transporter substrate-binding protein FtsY (Signal
           recognition particle receptor) [polymorphum gilvum
           SL003B-26A1]
 gi|326411536|gb|ADZ68599.1| Cell division transporter substrate-binding protein FtsY (Signal
           recognition particle receptor) [Polymorphum gilvum
           SL003B-26A1]
          Length = 419

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 227/311 (72%)

Query: 2   SNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVA 61
           +    A+  LSW  +L +G + +S  L EGI+ I + RRLD  + +ELED+LI++D+GV 
Sbjct: 107 APDPAAAPRLSWFGRLKQGLSRSSSALTEGISSIFTKRRLDAAMLDELEDVLIQADLGVD 166

Query: 62  VAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
            A  I E L   R+ K++S + V   ++E + K+L P+++P + D  HRPHV+L+VGVNG
Sbjct: 167 TATAITERLSVGRFDKEISAEEVRAVLAEEVEKVLAPVARPLDLDGEHRPHVVLMVGVNG 226

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKLS K++  G  VMLAAGDTFR+AA++QLKIW  RT A+ V  + G+DAA L
Sbjct: 227 TGKTTTIGKLSSKLAAEGRTVMLAAGDTFRAAAVEQLKIWGSRTGAEVVARDTGADAAGL 286

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
           A++A + A+ K VDVL++DTAGRL N + LMA + K+IRVL+++DP APH+VL  LDATT
Sbjct: 287 AFDALQAARDKGVDVLLVDTAGRLQNKAELMAELEKVIRVLRKIDPAAPHTVLLTLDATT 346

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNAL QVE+F   AG TGL+MTK+DGTARGG L+ I   + +PV+F+GVGEG++DLEPF
Sbjct: 347 GQNALSQVEIFGRTAGVTGLVMTKLDGTARGGILVAIAAKYGLPVHFIGVGEGVDDLEPF 406

Query: 302 VAKDFSAVITG 312
            AKD++  I G
Sbjct: 407 SAKDYARAIAG 417


>gi|222150095|ref|YP_002551052.1| cell division particle [Agrobacterium vitis S4]
 gi|221737077|gb|ACM38040.1| cell division particle [Agrobacterium vitis S4]
          Length = 454

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 232/301 (77%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW ++L  G   TS +L   I+ + + R+LD+   EELEDLLI++D+GV  A ++   L 
Sbjct: 149 SWFQRLKAGLFRTSSQLTGQISALFTKRKLDEETLEELEDLLIQADLGVETAMRVTGTLS 208

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           ++RY KDV+ + V   ++  I K+L P++KP   D +H+PHVILVVGVNG GKTT IGKL
Sbjct: 209 SERYGKDVTGEDVTRIMAAEIVKVLKPVAKPLALDLNHKPHVILVVGVNGTGKTTTIGKL 268

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K+S +GLKVMLAAGDTFR+AAI+QLKIWADRT + F+ +++G+DAA LAY+AF++A+A
Sbjct: 269 AAKLSGSGLKVMLAAGDTFRAAAIEQLKIWADRTGSTFIGTKLGADAAGLAYDAFEKAKA 328

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +K DVLIIDTAGRL N + LM  + K++RVL +LDP APH+VLQ LDATTGQNA+ QVE+
Sbjct: 329 EKSDVLIIDTAGRLQNKTELMDELEKIVRVLSKLDPDAPHTVLQTLDATTGQNAMNQVEI 388

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG  GLIMTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF A+DF+  I 
Sbjct: 389 FRNVAGVNGLIMTKLDGTARGGILVAIAAKHKLPVYFIGVGEGVDDLEPFEAEDFARAIA 448

Query: 312 G 312
           G
Sbjct: 449 G 449


>gi|114705326|ref|ZP_01438234.1| GTP-binding signal recognition particle (SRP54)
           G-domain:ATP/GTP-binding site motif A (P-loop):AAA
           [Fulvimarina pelagi HTCC2506]
 gi|114540111|gb|EAU43231.1| GTP-binding signal recognition particle (SRP54)
           G-domain:ATP/GTP-binding site motif A (P-loop):AAA
           [Fulvimarina pelagi HTCC2506]
          Length = 403

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 222/307 (72%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           A+  L W+++L +    +S  L   IT I + RRLDD V ++ ED+LI++D+GV  A +I
Sbjct: 87  AAPKLPWLQRLREALGRSSSNLTGSITSIFTKRRLDDDVLQDFEDVLIQADLGVETAMRI 146

Query: 67  VEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126
            + L   RY K++S   V   ++E I K L P+++P   D    PHVILVVGVNG GKTT
Sbjct: 147 TDRLSEGRYGKEISGSEVKRVLAEEIEKTLDPVAQPLELDLDKVPHVILVVGVNGTGKTT 206

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+ K++ AG+ V LAAGDTFR+AA++QLKIW +RT+++ V  +IG+DAA LA++A+
Sbjct: 207 TIGKLAAKLTRAGISVTLAAGDTFRAAAVEQLKIWGERTNSEVVARQIGADAAGLAFDAY 266

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
             A   K DVLIIDTAGRL N + LMA + K+IRVL++ DP +PH+VLQ LDATTGQNA+
Sbjct: 267 DVAVKNKSDVLIIDTAGRLQNKAELMAELEKIIRVLQKRDPDSPHTVLQTLDATTGQNAM 326

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            QV++F  VAG  GL+MTK+DGTARGG L+ I   HK+PVYF+GVGEGI+DLEPF AKDF
Sbjct: 327 NQVDIFRNVAGVNGLVMTKLDGTARGGILVAIGSKHKLPVYFVGVGEGIDDLEPFKAKDF 386

Query: 307 SAVITGC 313
           +  I G 
Sbjct: 387 ANAIAGI 393


>gi|163869370|ref|YP_001610626.1| cell division protein [Bartonella tribocorum CIP 105476]
 gi|161019073|emb|CAK02631.1| cell division protein [Bartonella tribocorum CIP 105476]
          Length = 390

 Score =  342 bits (878), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 162/312 (51%), Positives = 222/312 (71%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +    V  +  +W  +L KG + +S +L   I+D+   R+LD+   +ELED+LI++D+GV
Sbjct: 76  LPEPSVEQKKTAWFGRLRKGLSLSSQRLSGSISDLFLKRKLDEETLQELEDILIQADLGV 135

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
             A +I   L + RY KD+S   +   V++ I K+L P++ P   D SH+PHVIL+VGVN
Sbjct: 136 ETATRITNTLASSRYGKDLSSDDIHTIVADEIKKVLEPVAMPLELDLSHKPHVILLVGVN 195

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K+++ GL VMLAAGDTFR+AAI+QL IW  R  +  + +++G+DAA+
Sbjct: 196 GTGKTTTIGKLAAKLTEGGLNVMLAAGDTFRAAAIEQLHIWGKRIDSPVISTKLGADAAS 255

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA++AF++A+    DVLIIDTAGRL N S LM  + K+IRVL++  P APH++LQ LDAT
Sbjct: 256 LAFDAFEKAKKANSDVLIIDTAGRLQNKSELMDELAKIIRVLRKHSPQAPHTILQTLDAT 315

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNAL QVE+F  +AG  GL+MTK+DGTARGG LI I   HK+P+YF+GVGE I DL+P
Sbjct: 316 TGQNALSQVEIFRNIAGVNGLVMTKLDGTARGGILIAIAAKHKLPIYFIGVGENIEDLQP 375

Query: 301 FVAKDFSAVITG 312
           F A DF+  I G
Sbjct: 376 FSASDFAETIVG 387


>gi|163757350|ref|ZP_02164439.1| putative cell division protein [Hoeflea phototrophica DFL-43]
 gi|162284852|gb|EDQ35134.1| putative cell division protein [Hoeflea phototrophica DFL-43]
          Length = 529

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 172/300 (57%), Positives = 225/300 (75%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++L +G + TS +L   IT I + R+LD+   EELED+L+++D+GV  A +I + L +
Sbjct: 227 WWQRLRQGLSRTSGQLTGQITGIFTKRKLDEETLEELEDVLLQADLGVETALRITDALAS 286

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            RY KD+S   V   +++ I ++L P++KP   D SH+PHVILVVGVNG GKTT IGKL+
Sbjct: 287 GRYGKDISPAEVQKVMADEIARVLEPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGKLA 346

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            K+   GLKV LAAGDTFR+AAI+QLKIW DRT +  V +++G+DAA LAYEAF+ A+A 
Sbjct: 347 AKLHSGGLKVTLAAGDTFRAAAIEQLKIWGDRTGSKVVSTKLGADAAGLAYEAFETARAD 406

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DVLIIDTAGRL N + LM  + K++RV+ +LDP APH+VLQ LDATTGQNAL QVE+F
Sbjct: 407 GADVLIIDTAGRLQNRTELMDELAKVVRVIGKLDPDAPHTVLQTLDATTGQNALNQVEIF 466

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             VAG  GL+MTK+DGTARGG L+ I   HK+PVYF+GVGEG++DLEPF A DF++ I G
Sbjct: 467 KNVAGVNGLVMTKLDGTARGGILVAIAAKHKLPVYFIGVGEGVDDLEPFEAADFASAIAG 526


>gi|312114981|ref|YP_004012577.1| signal recognition particle-docking protein FtsY [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220110|gb|ADP71478.1| signal recognition particle-docking protein FtsY [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 409

 Score =  336 bits (861), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 221/303 (72%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           + W+++L +G   TS KL EGIT + + R+LDD   EELEDLLI+SD+G+AV+ +++  L
Sbjct: 106 VGWLQRLKQGLTKTSSKLTEGITGVFTKRKLDDDTLEELEDLLIQSDLGLAVSARVIAAL 165

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              RY  D+S + V   ++  + K+L P+++P   D S +P+V+L+VGVNG GKTT IGK
Sbjct: 166 KKARYNSDISPEEVRAILAAEVEKVLGPVAQPLEIDTSKKPYVVLMVGVNGTGKTTTIGK 225

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
            +K+ ++ GLKVMLAAGDTFR+AAI+QLK+W +RT A  V    G+DAA LA++A  +A+
Sbjct: 226 YAKQFTEQGLKVMLAAGDTFRAAAIEQLKVWGERTGAPVVSGAQGADAAGLAFDALTRAK 285

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
            +  D+LIIDTAGRL N + LMA + K+IRV++++DP APHSVL  LDATTGQNAL QVE
Sbjct: 286 KEGADLLIIDTAGRLQNKTGLMAELEKIIRVIRKVDPEAPHSVLLTLDATTGQNALSQVE 345

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F   AG TGLIMTK+DGTARGG L+ I   H +PV+ +GVGE  +DL+ F A+DF+  I
Sbjct: 346 IFGKTAGVTGLIMTKLDGTARGGILVAIAAKHGLPVHAIGVGESASDLQAFSAQDFARAI 405

Query: 311 TGC 313
            G 
Sbjct: 406 AGV 408


>gi|90421123|ref|ZP_01229025.1| cell division protein FtsY [Aurantimonas manganoxydans SI85-9A1]
 gi|90334615|gb|EAS48395.1| cell division protein FtsY [Aurantimonas manganoxydans SI85-9A1]
          Length = 362

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 219/303 (72%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           + W+++L +G A +S +L   I  I + RRLD+   ++ ED+LI++D+GV  A KI + L
Sbjct: 56  VPWLQRLREGLARSSTQLTGSIGAIFTKRRLDEDTLQDFEDVLIQADLGVETALKITDRL 115

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              R+ +++S Q V   ++E I K L P++ P   D + +PHVILVVGVNG GKTT IGK
Sbjct: 116 SEGRFGREISGQDVRTILAEEIEKALDPVALPLELDLAKKPHVILVVGVNGTGKTTTIGK 175

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K++  GLKV L AGDTFR+AA++QLKIW +RT ++ V   IG+DAA+LAYE + +A 
Sbjct: 176 LAAKLTRGGLKVTLCAGDTFRAAAVEQLKIWGERTQSEVVAKAIGADAASLAYEGYDRAV 235

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
               DVLIIDTAGRL N + LMA + K++RVL++ +P APH+VL  LDATTGQNA+ QVE
Sbjct: 236 ENGSDVLIIDTAGRLQNKTELMAELEKIVRVLQKREPDAPHTVLLTLDATTGQNAMNQVE 295

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG  GL+MTK+DG+ARGG L+ I    ++PVYF+GVGEGI+DLEPF AKDF+A I
Sbjct: 296 IFRNVAGVNGLVMTKLDGSARGGILVAIAAKFRLPVYFVGVGEGIDDLEPFKAKDFAAAI 355

Query: 311 TGC 313
            G 
Sbjct: 356 AGT 358


>gi|319409458|emb|CBI83107.1| cell division protein [Bartonella schoenbuchensis R1]
          Length = 407

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 159/301 (52%), Positives = 227/301 (75%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +W  +L KG + +S +L + +  +   ++LD+   +ELE++LI++D+GV  A +I + L 
Sbjct: 104 AWFERLKKGLSLSSQQLSDSLGALFIKKKLDEDTLQELENILIQADLGVETATRITDILA 163

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           + RY KD+S+  +   +++ I K+L P++ P   D SH+PHVIL+VGVNG GKTT IGKL
Sbjct: 164 SSRYEKDLSLDDLYTIMADEIKKVLEPVAIPLELDLSHKPHVILLVGVNGTGKTTTIGKL 223

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K+++ GLK+ LAAGDTFR+AAI+QL IW +RT A+ + +++G+DAA+LA++A+++A+ 
Sbjct: 224 AAKLAEGGLKITLAAGDTFRAAAIEQLHIWGERTGANVISTKLGADAASLAFDAYEKAKK 283

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           ++ DVLIIDTAGRL N S LM  + K+IRVLK+ +P APH+VLQ LDATTGQNAL QV++
Sbjct: 284 EESDVLIIDTAGRLQNKSELMDELAKIIRVLKKHNPQAPHTVLQTLDATTGQNALNQVDI 343

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           FH VAG  GL+MTK+DGTARGG LI I   +K+PVYF+G+GE I DLEPF A DF+  I 
Sbjct: 344 FHNVAGVNGLVMTKLDGTARGGILIAIANKYKLPVYFIGIGEKIEDLEPFSASDFAKAIV 403

Query: 312 G 312
           G
Sbjct: 404 G 404


>gi|121602701|ref|YP_988356.1| signal recognition particle-docking protein FtsY [Bartonella
           bacilliformis KC583]
 gi|120614878|gb|ABM45479.1| signal recognition particle-docking protein FtsY [Bartonella
           bacilliformis KC583]
          Length = 387

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 221/307 (71%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V  + ++W  +L  G + +S +L   I  + + R+L+    +ELED+LI++D+GV  A  
Sbjct: 78  VEQKEVAWFERLKHGLSRSSQQLGGSIGALFTKRKLNADTLQELEDILIQADLGVETASH 137

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           I + L + RY K++S+  +   V++ I K+L P++ P   D S++PHVIL VGVNG GKT
Sbjct: 138 ITDILSSGRYGKNLSLDDIHTIVADEIKKVLEPVAIPLELDLSYKPHVILFVGVNGTGKT 197

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K++  GLKVMLAAGDTFR+AAI+QL IW +RT A  V ++ G+DAA+LA+EA
Sbjct: 198 TTIGKLAAKLTSNGLKVMLAAGDTFRAAAIEQLHIWGERTGAPVVSTQSGADAASLAFEA 257

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           +++A+    DVLIIDTAGRL N + LM  + K+IRVL++ DP APH++LQ LDATTGQNA
Sbjct: 258 YEKAKKANNDVLIIDTAGRLQNKTELMDELAKIIRVLRKHDPQAPHTILQTLDATTGQNA 317

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QV++F  +AG  GL+MTK+DGTARGG L+ +   +K+PVYF+G+GE   DLEPF A D
Sbjct: 318 LNQVDIFRNIAGVNGLVMTKLDGTARGGILVALAAKYKLPVYFIGIGENTEDLEPFSASD 377

Query: 306 FSAVITG 312
           F+  ITG
Sbjct: 378 FAQAITG 384


>gi|49474822|ref|YP_032864.1| cell division protein ftsY [Bartonella quintana str. Toulouse]
 gi|49240326|emb|CAF26808.1| Cell division protein ftsY [Bartonella quintana str. Toulouse]
          Length = 407

 Score =  332 bits (850), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 156/307 (50%), Positives = 219/307 (71%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V  +  +W R+L KG A +S +L E I ++    +LD    ++LED+LI++D+GV  A  
Sbjct: 98  VEQKKTAWFRRLQKGLALSSQRLSESIGELFVKEKLDKDTLQKLEDILIQADLGVETAAH 157

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           I + + + RY K +S   +   ++  I K+L P++ P   D +H+PHVIL+VGVNG GKT
Sbjct: 158 ITDTIASSRYEKSLSPDNIHTIMANEIEKILEPVAIPLELDLNHKPHVILLVGVNGTGKT 217

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K++  GLKVMLAA D FR+AAI+QL IW++R  A  V +++G+DAA+LA++A
Sbjct: 218 TTIGKLAAKLTKGGLKVMLAACDMFRAAAIEQLHIWSERIGAPVVSTKLGADAASLAFDA 277

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           +++A+    DVLIIDTAGRL N + LM  + K+IRVL + +PHAPH++LQ LDATTGQNA
Sbjct: 278 YEKAKKANSDVLIIDTAGRLQNKTELMDELAKIIRVLGKHNPHAPHTILQTLDATTGQNA 337

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QVE+F  +AG  GL+MTK+DGTARGG L+ I   +K+PVYF+G+GE I DL+PF A D
Sbjct: 338 LNQVEIFRDIAGVNGLVMTKLDGTARGGILVAIAAKYKLPVYFIGIGEDIEDLQPFSASD 397

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 398 FAKTIAG 404


>gi|49476311|ref|YP_034352.1| cell division protein ftsY [Bartonella henselae str. Houston-1]
 gi|49239119|emb|CAF28423.1| Cell division protein ftsY [Bartonella henselae str. Houston-1]
          Length = 416

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 219/307 (71%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V  E  +W  +L KG A +S +L + I ++    +LD    +ELED+LI++D+GV  A  
Sbjct: 107 VEQEKRAWFGRLKKGLALSSQRLSKSIGEVFVKEKLDKDKLQELEDILIQADLGVETATH 166

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           I + L + RY K++S   V   ++  I K+L P++ P   D +H+PHVIL+VGVNG GKT
Sbjct: 167 ITDTLASSRYKKNLSPDDVHSIIANEIEKVLKPVAIPLELDLNHKPHVILLVGVNGTGKT 226

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K++  GLKVMLAAGDTFR+AAI+QL IW +R  A  + +++G+DAA+LA++A
Sbjct: 227 TTIGKLAAKLTKGGLKVMLAAGDTFRAAAIEQLHIWGERIGAPVISTKLGADAASLAFDA 286

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           +++A+    DVLIIDTAGRL N + LM  + K+IRVL + +P APH++LQ LDATTGQNA
Sbjct: 287 YEKAKKANSDVLIIDTAGRLQNKTELMDELAKIIRVLGKHNPQAPHTILQTLDATTGQNA 346

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QV++F  +AG  GL+MTK+DGTARGG L+ I   +K+PVYF+G+GE I DL+PF A D
Sbjct: 347 LNQVDIFRDIAGVNGLVMTKLDGTARGGILVAIAAKYKLPVYFIGIGENIEDLQPFSASD 406

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 407 FAKTIAG 413


>gi|240851394|ref|YP_002972797.1| cell division protein FtsY [Bartonella grahamii as4aup]
 gi|240268517|gb|ACS52105.1| cell division protein FtsY [Bartonella grahamii as4aup]
          Length = 417

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 223/312 (71%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +S   V  + ++W  +L K  + +S +L   I+D+   R+LD+   +E ED+LI++D+GV
Sbjct: 103 LSEPSVEQKKIAWFGRLKKSLSLSSQRLSGSISDLFVKRKLDEDTLQEFEDILIQADLGV 162

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
             A +I   L + RY KD+S   +   V++ + K+L P++ P   D S++PHVIL+VGVN
Sbjct: 163 ETATRITNTLASSRYGKDLSPDDIHTIVADEVKKVLEPVAIPLELDLSYKPHVILLVGVN 222

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K++  GLKVMLAAGDTFR+AAI+QL IW  RT +  + +++G+DAA+
Sbjct: 223 GTGKTTTIGKLAAKLTAGGLKVMLAAGDTFRAAAIEQLHIWGKRTDSPVISTKLGADAAS 282

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA++A+++A+    DVLIIDTAGRL N S LM  + K+IRVLK+  P APH++LQ LDAT
Sbjct: 283 LAFDAYEKAKKANSDVLIIDTAGRLQNKSELMDELAKIIRVLKKHTPQAPHTILQTLDAT 342

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNAL QV++F  +AG  GL+MTK+DG+ARGG L+ I   +K+PVYF+G+GE I DL+P
Sbjct: 343 TGQNALNQVKIFRDIAGVNGLVMTKLDGSARGGILVAIAAKYKLPVYFIGIGENIEDLQP 402

Query: 301 FVAKDFSAVITG 312
           F A DF+  I G
Sbjct: 403 FSASDFAETIAG 414


>gi|319407865|emb|CBI81518.1| cell division protein [Bartonella sp. 1-1C]
          Length = 413

 Score =  328 bits (840), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 223/312 (71%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +S   +  +  +W  +L KG + +S +L + I  +   ++LD+   +ELED+LI++D+G+
Sbjct: 99  LSTLTIEQKKAAWFERLKKGLSRSSQQLSDSIGTLFVKQKLDENTLQELEDVLIQADLGI 158

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
               +I++ L T+ Y K++S + +   V++ I K+L P++ P   D +H+PHVIL+VGVN
Sbjct: 159 ETTTRIIDILSTRYYEKNLSPKDIYAIVTDEIKKVLEPIAFPLEIDLNHKPHVILLVGVN 218

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K++  GLKVML AGDTFR+AA++QL IW +RT A    +++G+DAA+
Sbjct: 219 GTGKTTTIGKLAAKLTMGGLKVMLVAGDTFRAAAVEQLHIWGERTKAPVFSTKLGADAAS 278

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA++A+++A+ +  DVL+IDTAGRL N   LM  + K+IRVL + +P APH+VLQ LDA+
Sbjct: 279 LAFDAYEKAKKEGYDVLLIDTAGRLQNKIELMDELAKIIRVLGKHNPQAPHTVLQTLDAS 338

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNAL QV +F  +AG  GL+MTK+DGTARGG L+ I   HKIPV+F+GVGE + DLEP
Sbjct: 339 TGQNALNQVNVFRDIAGVNGLVMTKLDGTARGGILVAIASKHKIPVHFIGVGENVEDLEP 398

Query: 301 FVAKDFSAVITG 312
           F A DF+  I G
Sbjct: 399 FSASDFAEAIIG 410


>gi|319404905|emb|CBI78506.1| cell division protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 413

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 152/307 (49%), Positives = 219/307 (71%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           V  +  +W  +L KG + +S +L + I  +   ++LD+   +ELED+LI++D+G+    +
Sbjct: 104 VEQKKAAWFERLKKGLSRSSQQLSDSIGTLFVKKKLDENTLQELEDILIQADLGIETTTR 163

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           I++ L T+ Y K++S + +   V+  I K+L P++ P   D +H+PHVIL+VGVNG GKT
Sbjct: 164 IIDILSTRYYEKNLSPKDIYTIVTNEIKKVLEPIAFPLEIDLNHKPHVILLVGVNGTGKT 223

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+ K++  GLKVML AGDTFR+AA++QL IW +R  A    +++G+DAA+LA++A
Sbjct: 224 TTIGKLAAKLTMGGLKVMLVAGDTFRAAAVEQLHIWGERAKAPVFSTKLGADAASLAFDA 283

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           +++A+ +  DVL+IDTAGRL N   LM  + K+IRVL + +P APH+VLQ LDA+TGQNA
Sbjct: 284 YEKAKKENYDVLLIDTAGRLQNKIELMDELAKIIRVLGKHNPQAPHTVLQTLDASTGQNA 343

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L QV +F  +AG  GL+MTK+DGTARGG L+ I   HKIPV+F+GVGE + DLEPF A D
Sbjct: 344 LNQVNVFRDIAGVNGLVMTKLDGTARGGILVAIASKHKIPVHFIGVGENVEDLEPFSASD 403

Query: 306 FSAVITG 312
           F+  I G
Sbjct: 404 FAEAIIG 410


>gi|85713492|ref|ZP_01044482.1| cell division transporter substrate-binding protein FtsY
           [Nitrobacter sp. Nb-311A]
 gi|85699396|gb|EAQ37263.1| cell division transporter substrate-binding protein FtsY
           [Nitrobacter sp. Nb-311A]
          Length = 315

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 157/302 (51%), Positives = 216/302 (71%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW R+L+ G   TS  L   + D+++ R+LD  + +++ED+L+R+D+G AVA++I E + 
Sbjct: 12  SWWRRLSGGLKRTSTSLGTAVADLVTKRKLDRAMLDDIEDVLLRADLGAAVAERIAEAVG 71

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY K +S   V   V+  + K+L P+++P   D +  P VILVVGVNG GKTT IGKL
Sbjct: 72  EGRYDKAISADEVKAVVATEVEKVLAPVARPLVIDGTFTPFVILVVGVNGSGKTTTIGKL 131

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K+S  G KVM+AAGDTFR+AAI+QLK+W +RT +  +  E GSD+A+LA+ A   A+ 
Sbjct: 132 AAKLSAEGRKVMMAAGDTFRAAAIEQLKVWGERTGSPVIAGEQGSDSASLAFNALTAARN 191

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +K DVL+IDTAGRL N + LM  + KM+RV++R+D  APH VL VLDAT GQNAL QVE 
Sbjct: 192 EKRDVLLIDTAGRLQNKAELMNELEKMVRVIRRVDAAAPHVVLLVLDATVGQNALSQVEA 251

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           FH  AG TGL+MTK+DGTARGG L+ +   HK+PV+F+GVGEG++DL PF A+DF+  + 
Sbjct: 252 FHRTAGVTGLVMTKLDGTARGGILVALAEKHKLPVHFIGVGEGVDDLAPFTARDFARAVA 311

Query: 312 GC 313
           G 
Sbjct: 312 GI 313


>gi|75674514|ref|YP_316935.1| cell division transporter substrate-binding protein FtsY
           [Nitrobacter winogradskyi Nb-255]
 gi|74419384|gb|ABA03583.1| signal recognition particle-docking protein FtsY [Nitrobacter
           winogradskyi Nb-255]
          Length = 315

 Score =  325 bits (832), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 218/313 (69%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           MS+        SW R+L+ G   TS  L   + D+++ R+LD  + +++ED+L+R+D+G 
Sbjct: 1   MSDSSEDQPKQSWWRRLSGGLKRTSASLGTAVADLVTKRKLDRAMLDDIEDVLLRADLGT 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
           AVA++I E +   RY K +S   V   V+  + K+L P+++P   D + +P VILVVGVN
Sbjct: 61  AVAERIAEAVGEGRYDKAISADEVKAVVATEVEKVLAPVARPLIIDETVKPFVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K+S  G KVM+AAGDTFR+AAIDQLK+W +RT +  +    GSD+A+
Sbjct: 121 GSGKTTTIGKLAAKLSAEGRKVMMAAGDTFRAAAIDQLKVWGERTGSPVIAGAQGSDSAS 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA+ A  +A+ +  DVL+IDTAGRL N + LM  + KM+RV++R+D  APH VL VLDAT
Sbjct: 181 LAFNALTEARNQNSDVLLIDTAGRLQNKAELMNELEKMVRVIRRVDSSAPHVVLLVLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
            GQNAL QVE FH  AG TGL+MTK+DGTARGG L+ +   HK+PV+F+GVGEG++DL P
Sbjct: 241 VGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALAEKHKLPVHFIGVGEGVDDLAP 300

Query: 301 FVAKDFSAVITGC 313
           F A DF+  + G 
Sbjct: 301 FTAGDFARAVAGI 313


>gi|27375584|ref|NP_767113.1| cell division protein [Bradyrhizobium japonicum USDA 110]
 gi|27348721|dbj|BAC45738.1| bll0473 [Bradyrhizobium japonicum USDA 110]
          Length = 315

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 219/313 (69%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           M++       LSW R+L+ G   TS  L   + D+++ R+LD  + +++ED+L+R+D+G 
Sbjct: 1   MNDTTSDPPKLSWWRRLSNGLKRTSSSLGTAVADLVTKRKLDRAMLDDIEDVLLRADLGT 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
           +VA +I + + T RY K +S   V   V+  + K+L P++KP   D + +P VILVVGVN
Sbjct: 61  SVAVRIADAVGTGRYDKAISADEVKDVVATEVEKVLAPVAKPLEIDAARKPFVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKLS+K +  G KVMLAAGDTFR+AAI+QLK+W +RT    +    GSD+A+
Sbjct: 121 GSGKTTTIGKLSQKFASEGRKVMLAAGDTFRAAAIEQLKVWGERTKTPVIAGTQGSDSAS 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA+ A   A+ +K DVL+IDTAGRL N + LM  + K++RV++++D  APH+VL VLDAT
Sbjct: 181 LAFNALTAAKEQKTDVLLIDTAGRLQNKAELMNELEKVVRVIRKVDDTAPHAVLLVLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
            GQNAL QVE FH  AG TGL+MTK+DGTARGG L+ +    K+PV+F+GVGEG++DL P
Sbjct: 241 VGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALAEKFKLPVHFIGVGEGVDDLAP 300

Query: 301 FVAKDFSAVITGC 313
           F A+DF+  I G 
Sbjct: 301 FTARDFARAIAGI 313


>gi|154244370|ref|YP_001415328.1| signal recognition particle-docking protein FtsY [Xanthobacter
           autotrophicus Py2]
 gi|154158455|gb|ABS65671.1| signal recognition particle-docking protein FtsY [Xanthobacter
           autotrophicus Py2]
          Length = 529

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/300 (52%), Positives = 217/300 (72%), Gaps = 1/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W R L  G A T+  L +GITD++S R+LD    EELED+LIR+D+GV  + +IVE +  
Sbjct: 229 WSR-LASGLARTASSLGQGITDLVSKRKLDADTLEELEDVLIRADLGVETSMRIVETVGK 287

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K +S + V   ++E + ++L+P+++P   D +H+P V+L+VGVNG GKTT IGKL+
Sbjct: 288 GRHDKMISPEEVKRLIAEEVERILIPVAQPLVVDTAHKPFVVLMVGVNGSGKTTTIGKLA 347

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            +    G KV+LAAGDTFR+AAI+QLK+W  RT A  +  E GSDAA +A+EA  +A+A 
Sbjct: 348 AQWRTEGKKVVLAAGDTFRAAAIEQLKVWGTRTGATVIAREQGSDAAGVAHEAVVEARAA 407

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             D+L++DTAGRL N + LMA + K++RV+K+L+P APH+VL VLDAT GQNAL QVE F
Sbjct: 408 GADILMVDTAGRLQNRTELMAELEKVVRVIKKLEPSAPHAVLLVLDATVGQNALSQVEAF 467

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             +AG TG++MTK+DGTARGG L+ I   HK+PV+ +GVGE   DL+PF A+DF+  I G
Sbjct: 468 TRIAGVTGMVMTKLDGTARGGILVAIAAKHKLPVHLIGVGEAAEDLQPFAARDFARAIAG 527


>gi|319899511|ref|YP_004159608.1| cell division protein [Bartonella clarridgeiae 73]
 gi|319403479|emb|CBI77059.1| cell division protein [Bartonella clarridgeiae 73]
          Length = 387

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 220/312 (70%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +S   V  +  +W  +L KG + +S +L + I  + + ++LD+   +ELED+LI++D G+
Sbjct: 73  LSTSTVEQKKAAWFERLKKGLSLSSQQLSDSIGSLFAKKKLDENTLQELEDILIQADFGI 132

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
               +I++ L T RY K++S + +   V+  I K+L P++ P   D +H+PHVIL+VGVN
Sbjct: 133 ETTTRIIDILATGRYEKNLSPKDIYTIVTNEIKKVLEPIAFPLEIDLNHKPHVILLVGVN 192

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K++  GLK+ML AGDTFR+AAI+QL IW +RT A  + S++ +D A+
Sbjct: 193 GTGKTTTIGKLAAKLTAGGLKIMLVAGDTFRAAAIEQLHIWGERTKAPVISSKLAADPAS 252

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           L ++A+K+A+ +  DVLIIDTAGRL N   LM  + K+IRVL + +P APH+VLQ LDAT
Sbjct: 253 LVFDAYKKAKKEGSDVLIIDTAGRLQNKIELMDELAKIIRVLGKHNPQAPHTVLQTLDAT 312

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNAL QV +F  +AG  GL+MTK+DGTARGG L+ I   HK+PV+F+G+GE + DLEP
Sbjct: 313 TGQNALNQVNIFRDIAGVNGLVMTKLDGTARGGILVAIASKHKLPVHFIGIGENVEDLEP 372

Query: 301 FVAKDFSAVITG 312
           F A DF+  I G
Sbjct: 373 FSASDFAEAIIG 384


>gi|300024820|ref|YP_003757431.1| signal recognition particle-docking protein FtsY [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526641|gb|ADJ25110.1| signal recognition particle-docking protein FtsY [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 390

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 156/301 (51%), Positives = 210/301 (69%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W +KL  G   TS KL  GITD+ S R+LD    ++LEDLLI++D+G+A   +I + +  
Sbjct: 90  WFQKLKSGLGKTSAKLTSGITDLFSKRKLDAATLDDLEDLLIQADLGIATTGRITDAIGK 149

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K +S   V   +S  + ++L P++KP   D + +PHVI++VGVNG GKTT IGKL+
Sbjct: 150 GRFEKGISADEVRAILSSEVERVLKPVAKPLEVDAARKPHVIMMVGVNGTGKTTTIGKLA 209

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
           +K+   G  V+LAAGDTFR+AAIDQLK+W +RT    V  ++G DA+ LA++A KQAQ  
Sbjct: 210 QKLKAEGKSVVLAAGDTFRAAAIDQLKVWGERTGCPVVARQVGEDASGLAFDALKQAQGT 269

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DVL++DTAGRL N   LM  + K+IRVLK+LD  APH V+ VLDATTGQNAL+QVE+F
Sbjct: 270 GADVLLLDTAGRLQNKQALMEELEKVIRVLKKLDSTAPHDVILVLDATTGQNALQQVEVF 329

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              AG TGL+MTK+DGTARGG L+ I     +PV+ +GVGEG +DL+PF A +F+  I G
Sbjct: 330 RDRAGVTGLVMTKLDGTARGGILVAIADKFGLPVHAIGVGEGADDLQPFEAAEFARAIAG 389

Query: 313 C 313
            
Sbjct: 390 T 390


>gi|319406390|emb|CBI80031.1| cell division protein [Bartonella sp. AR 15-3]
          Length = 410

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 216/300 (72%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W  +L KG + +S +L + I  +   ++LD+   +ELED+LI++D+G+    +I++ L T
Sbjct: 108 WFERLKKGLSLSSQQLSDSIGTLFVKKKLDENTLQELEDILIQADLGIETTTRIIDILAT 167

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            RY K+ S + +   V++ I K+L P++ P   D +H+PHVIL+VGVNG GKTT IGKL+
Sbjct: 168 SRYEKNFSSKDIYTIVTDEIKKVLEPVAFPLEIDLNHKPHVILLVGVNGTGKTTTIGKLA 227

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            K++  GLKVML AGDTFR+AAI+QL IW +RT A  +  ++G+DAA+LA++A+ +A+ +
Sbjct: 228 AKLTAGGLKVMLVAGDTFRAAAIEQLHIWGERTKAPVISGKLGADAASLAFDAYGKAKKE 287

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DVLIIDTAGRL N   LM  + K+IRVL + +P APH+VLQ LDATTGQNAL QV +F
Sbjct: 288 NSDVLIIDTAGRLQNKIELMDELAKIIRVLGKHNPQAPHTVLQTLDATTGQNALNQVNVF 347

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             +AG  GL+MTK+DG+ARGG L+ I   HK+PV+F+G+GE + DLEPF A DF+  I G
Sbjct: 348 RDIAGVNGLVMTKLDGSARGGILVAIASKHKLPVHFIGIGENVEDLEPFSASDFAEAIIG 407


>gi|92116024|ref|YP_575753.1| signal recognition particle-docking protein FtsY [Nitrobacter
           hamburgensis X14]
 gi|91798918|gb|ABE61293.1| signal recognition particle-docking protein FtsY [Nitrobacter
           hamburgensis X14]
          Length = 315

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 158/312 (50%), Positives = 217/312 (69%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           MS+        SW R+L+ G   TS  L   + D+++ R+LD  + +++ED+L+R+D+G 
Sbjct: 1   MSDSTDDKPKQSWWRRLSGGLKRTSSSLGTAVADLVTKRKLDRAMLDDIEDVLLRADLGT 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
           AVA++I   +   RY K +S   V   V+  + K+L  ++KP   D +H+P VILVVGVN
Sbjct: 61  AVAERIAAAVGEGRYDKAISADEVKAVVATEVEKVLAAVAKPLVVDETHKPFVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K+S  G KVM+AAGDTFR+AAI+QL++W +RT +  V    GSDAA+
Sbjct: 121 GSGKTTTIGKLAAKLSAEGRKVMMAAGDTFRAAAIEQLQVWGERTGSPVVAGAQGSDAAS 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA+ A   A+  + DVL+IDTAGRL N + LM  + K++RV++R+D  APH+VL VLDAT
Sbjct: 181 LAFNALTAARDDRRDVLLIDTAGRLQNKAELMNELEKVVRVIRRVDAAAPHAVLLVLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
            GQNAL QVE FH  AG TGL+MTK+DGTARGG L+ +   HK+PV+F+GVGEG++DL P
Sbjct: 241 VGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALAEKHKLPVHFIGVGEGVDDLAP 300

Query: 301 FVAKDFSAVITG 312
           F A DF+  I G
Sbjct: 301 FTAHDFAKAIAG 312


>gi|39933286|ref|NP_945562.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris CGA009]
 gi|192288638|ref|YP_001989243.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris TIE-1]
 gi|39652911|emb|CAE25653.1| putative cell division protein FtsY [Rhodopseudomonas palustris
           CGA009]
 gi|192282387|gb|ACE98767.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris TIE-1]
          Length = 315

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 157/302 (51%), Positives = 210/302 (69%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW R+L+ G   TS  +   +++ +S R+LD  + EE+ED+L+R+D+G  VA +I + + 
Sbjct: 11  SWWRRLSSGLKRTSSSIGTALSEFVSKRKLDRAMLEEIEDVLLRADLGTEVAARIAKAVG 70

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY K +S   V   V+  + K+L P+++P   D  ++P VIL+VGVNG GKTT IGKL
Sbjct: 71  EGRYDKMISASDVKEIVAAEVEKVLAPVAQPLEVDAGNKPFVILMVGVNGSGKTTTIGKL 130

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           S + +  G KVMLAAGDTFR+AAIDQLK+W DRT    V    GSDAA LA+ A   A+ 
Sbjct: 131 SARFASEGHKVMLAAGDTFRAAAIDQLKVWGDRTGTPVVAGAQGSDAAGLAFNALTAAKE 190

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVL+IDTAGRL N + LM+ + K++RV+K++D  APH+VL VLDAT GQNAL QVE 
Sbjct: 191 QGRDVLLIDTAGRLQNRTELMSELEKVVRVIKKVDATAPHAVLLVLDATVGQNALSQVEA 250

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   AG TGL+MTK+DGTARGG L+ I   HK+PV+F+GVGEG+ DL PF A+DF+  I 
Sbjct: 251 FTKTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVEDLAPFTARDFAKAIA 310

Query: 312 GC 313
           G 
Sbjct: 311 GT 312


>gi|148251983|ref|YP_001236568.1| signal recognition particle-docking protein FtsY [Bradyrhizobium
           sp. BTAi1]
 gi|146404156|gb|ABQ32662.1| signal recognition particle-docking protein FtsY [Bradyrhizobium
           sp. BTAi1]
          Length = 315

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 220/315 (69%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           M++    +  LSW R+L+ G   TS  L   + D+++ R+LD  + +++ED+L+R+D+G 
Sbjct: 1   MNDTTSETPKLSWWRRLSAGLKRTSGALGTAVADLVTKRKLDRAMLDDIEDVLLRADLGT 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
            VA +I E +   RY K +S   V   V+  + K+L P++KP   + SH+P VILVVGVN
Sbjct: 61  QVAARIAEAVGAGRYDKAISADEVKAVVATEVEKVLSPVAKPLVVEASHKPFVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K +  G +VMLAAGDTFR+AAI+QLK+W +RT A  +    GSD+A+
Sbjct: 121 GSGKTTTIGKLAAKFASDGKQVMLAAGDTFRAAAIEQLKVWGERTKAPVIAGAQGSDSAS 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA+ A   A+ +  D+L+IDTAGRL N + LM  + K++RV++++D  APH+VL VLDAT
Sbjct: 181 LAFTAITAAKEQARDILLIDTAGRLQNKAELMNELEKVVRVIRKVDASAPHAVLLVLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
            GQNAL QVE FH  AG TGL+MTK+DGTARGG L+ +    K+PV+F+GVGEG++DL+P
Sbjct: 241 VGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALSEKFKLPVHFIGVGEGVDDLQP 300

Query: 301 FVAKDFSAVITGCLD 315
           F A+DF+  I G  D
Sbjct: 301 FAARDFARAIAGIDD 315


>gi|146337532|ref|YP_001202580.1| cell division transporter substrate-binding protein FtsY
           [Bradyrhizobium sp. ORS278]
 gi|146190338|emb|CAL74334.1| Cell division transporter substrate-binding protein FtsY (Signal
           recognition particle receptor) [Bradyrhizobium sp.
           ORS278]
          Length = 315

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 218/315 (69%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           M++    +   SW R+L+ G   TS  L   + D+++ R+LD  + +++ED+L+R+D+G 
Sbjct: 1   MNDTTSETPKRSWWRRLSDGLKRTSGALGTAVADLVTKRKLDRAMLDDIEDVLLRADLGT 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
            VA +I E +   RY K +S   V   V+  + K+L P++KP   +  H+P VILVVGVN
Sbjct: 61  QVAARIAEAVGAGRYDKAISADEVKAVVATEVEKVLSPVAKPLTIEPGHKPFVILVVGVN 120

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL++K +  G  VMLAAGDTFR+AAI+QLK+W +RT A  +    GSD+A+
Sbjct: 121 GSGKTTTIGKLAQKFASEGKHVMLAAGDTFRAAAIEQLKVWGERTKAPVIAGAQGSDSAS 180

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA+ A   A+ +  D+L+IDTAGRL N + LM  + K++RV++++D  APH+VL VLDAT
Sbjct: 181 LAFNAITAAKEQGRDILLIDTAGRLQNKAELMNELEKVVRVIRKVDASAPHAVLLVLDAT 240

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
            GQNAL QVE FH  AG TGL+MTK+DGTARGG L+ +    K+PV+F+GVGEG++DL+P
Sbjct: 241 VGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALSEKFKLPVHFIGVGEGVDDLQP 300

Query: 301 FVAKDFSAVITGCLD 315
           F AKDF+  I G  D
Sbjct: 301 FAAKDFARAIAGIED 315


>gi|218458897|ref|ZP_03498988.1| cell division protein [Rhizobium etli Kim 5]
          Length = 235

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 153/230 (66%), Positives = 189/230 (82%), Gaps = 4/230 (1%)

Query: 87  DVSEL----IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKV 142
           DVS +    I K+L P++KP   D SH+PHVILVVGVNG GKTT IGKL+ K+S AGLKV
Sbjct: 3   DVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGTGKTTTIGKLAAKLSGAGLKV 62

Query: 143 MLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTA 202
           MLAAGDTFR+AAI+QLKIWA+RT ++FV +++G+DAA LAY+AF+QA+AKK DVLI+DTA
Sbjct: 63  MLAAGDTFRAAAIEQLKIWAERTKSEFVGTKLGADAAGLAYDAFEQAKAKKCDVLIVDTA 122

Query: 203 GRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLI 262
           GRL N + LMA + K++RVL +LDP APH+VLQ LDATTGQNAL QVE+F  VAG  GLI
Sbjct: 123 GRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALSQVEIFRNVAGVNGLI 182

Query: 263 MTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
           MTK+DGTARGG L+ I   +K+PVYF+GVGEG++DLEPF A+DF+  I G
Sbjct: 183 MTKLDGTARGGILVAISAKYKLPVYFIGVGEGVDDLEPFEAEDFAHAIAG 232


>gi|299133082|ref|ZP_07026277.1| signal recognition particle-docking protein FtsY [Afipia sp. 1NLS2]
 gi|298593219|gb|EFI53419.1| signal recognition particle-docking protein FtsY [Afipia sp. 1NLS2]
          Length = 318

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 159/301 (52%), Positives = 214/301 (71%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW ++L+ G   TS  +   +TD++S R+LD  + E +ED+L+R+D+G  VA +I  ++ 
Sbjct: 12  SWWQRLSAGLKRTSGSIGGALTDLVSKRKLDRAMLEGIEDVLLRADLGTEVAARIAAKVG 71

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY KDVS Q V   V+  + K+L P++KP   D S +P VILVVGVNG GKTT IGKL
Sbjct: 72  EGRYDKDVSAQDVQEIVAAEVEKVLAPVAKPLVIDESQKPFVILVVGVNGSGKTTTIGKL 131

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K++  G +VMLAAGDTFR+AAI+QLK+W +RT    V    GSD+A+LA++A  +A+ 
Sbjct: 132 AAKLTAEGRRVMLAAGDTFRAAAIEQLKVWGERTGVPVVARAHGSDSASLAFDAASEAKT 191

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVL+IDTAGRL N + LM  + K+ RV++++D  APH+VL VLDAT GQNAL QVE 
Sbjct: 192 DNRDVLLIDTAGRLQNKAELMVELEKVARVIRKVDASAPHAVLLVLDATVGQNALSQVEA 251

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   AG TGL+MTK+DGTARGG L+ I  T+K+PV+F+GVGEGI+DL PF A DF+  I 
Sbjct: 252 FRKTAGVTGLVMTKLDGTARGGILVAISETYKLPVHFIGVGEGIDDLAPFTAHDFALAIA 311

Query: 312 G 312
           G
Sbjct: 312 G 312


>gi|316931820|ref|YP_004106802.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris DX-1]
 gi|315599534|gb|ADU42069.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris DX-1]
          Length = 315

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 209/302 (69%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW R+L+ G   TS  +   +++ +S R+LD  + EE+ED+L+R+D+G  VA +I   + 
Sbjct: 11  SWWRRLSSGLKRTSSSIGTALSEFVSKRKLDRAMLEEIEDVLLRADLGAEVASRIASAVG 70

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY K +S   V   V+  + K+L P+++P   D   +P V+L+VGVNG GKTT IGKL
Sbjct: 71  EGRYDKMISASDVKEIVAAEVEKVLAPVAQPLVVDAGKKPFVVLMVGVNGSGKTTTIGKL 130

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           S + +  G KVMLAAGDTFR+AAIDQLK+W +RT    V    GSDAA LA+ A   A+ 
Sbjct: 131 SARFASEGHKVMLAAGDTFRAAAIDQLKVWGERTGTPVVAGAQGSDAAGLAFNALTAAKE 190

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVL+IDTAGRL N + LM+ + K++RV+K++D  APH+VL VLDAT GQNAL QVE 
Sbjct: 191 QGRDVLLIDTAGRLQNRTELMSELEKVVRVIKKVDATAPHAVLLVLDATVGQNALSQVEA 250

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   AG TGL+MTK+DGTARGG L+ I   HK+PV+F+GVGEG++DL PF A+DF+  I 
Sbjct: 251 FTKTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVDDLSPFTARDFAKAIA 310

Query: 312 GC 313
           G 
Sbjct: 311 GT 312


>gi|323137224|ref|ZP_08072303.1| signal recognition particle-docking protein FtsY [Methylocystis sp.
           ATCC 49242]
 gi|322397582|gb|EFY00105.1| signal recognition particle-docking protein FtsY [Methylocystis sp.
           ATCC 49242]
          Length = 353

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 150/302 (49%), Positives = 212/302 (70%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +LT G A TS  + +G+ DI + R+LD    EELED+L+R+D+GV  A +I + + 
Sbjct: 40  SWWSRLTGGLARTSQAISQGVADIFTKRKLDALTLEELEDVLLRADLGVGAAMRITKAVG 99

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY KD+    V   ++  +  +L P++ PF  D S +P ++LVVGVNG GKTT I KL
Sbjct: 100 KARYEKDIEPDEVRAILAREVEAVLEPVAVPFEIDESKKPFIVLVVGVNGSGKTTTIAKL 159

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K +  G KV+LAAGDTFR+AA++QL+IW  R  A+ V    G+DAA LA++A K+A  
Sbjct: 160 ASKWTGEGKKVVLAAGDTFRAAAVEQLRIWGARLDAEVVAGNEGADAAGLAFDAIKRAGE 219

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              D++++DTAGRL N + LMA + K++RV+K+ +P APH+VL VLDAT GQNA++QVE+
Sbjct: 220 SGADIMLMDTAGRLQNRAELMAELEKIVRVMKKAEPEAPHAVLLVLDATVGQNAMQQVEV 279

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  +AG TGL+MTK+DGTARGG L+ I   + +P++F+GVGEG +DLEPF A+DF+  I 
Sbjct: 280 FQRMAGVTGLVMTKLDGTARGGILVAIAEAYGLPIHFIGVGEGQDDLEPFTARDFARAIA 339

Query: 312 GC 313
           G 
Sbjct: 340 GL 341


>gi|296448346|ref|ZP_06890235.1| signal recognition particle-docking protein FtsY [Methylosinus
           trichosporium OB3b]
 gi|296254138|gb|EFH01276.1| signal recognition particle-docking protein FtsY [Methylosinus
           trichosporium OB3b]
          Length = 346

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 151/309 (48%), Positives = 219/309 (70%), Gaps = 1/309 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +LT G + +S  + +GI+D+ + R+LD    EELED+L+R+D+G+A AQ+I   + 
Sbjct: 34  SWWERLTGGLSRSSQAIVQGISDLFTKRKLDALTLEELEDVLVRADLGLAAAQRISATVG 93

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY K +    V   ++E + ++L P+++PF  D S +P ++LVVGVNG GKTT I KL
Sbjct: 94  KARYEKTIGPDEVRAILAEEVERVLAPVARPFELDESKKPFIVLVVGVNGSGKTTTIAKL 153

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K +  G KVMLAAGDTFR+AA++QL+ W +R +     +  G+DAA LA++A K A+ 
Sbjct: 154 AAKWTAEGRKVMLAAGDTFRAAAVEQLRFWGERLNVSVCYAPEGADAAGLAFDAIKSARE 213

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  D+L++DTAGRL N + LMA + K++RV+K+ +P APH+VL VLDAT GQNA+ QV++
Sbjct: 214 RGSDILLMDTAGRLQNRTELMAELAKIVRVMKKAEPEAPHAVLLVLDATVGQNAVAQVDV 273

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  +AG TGL+MTK+DGTARGG L+ I   + +P++F+GVGEG  DLEPF A+DF+  I 
Sbjct: 274 FGKIAGVTGLVMTKLDGTARGGILVAIAEAYGLPIHFIGVGEGAEDLEPFTARDFARAIA 333

Query: 312 GCLDYGEEK 320
           G L+  EEK
Sbjct: 334 G-LEGDEEK 341


>gi|163852142|ref|YP_001640185.1| signal recognition particle-docking protein FtsY [Methylobacterium
           extorquens PA1]
 gi|163663747|gb|ABY31114.1| signal recognition particle-docking protein FtsY [Methylobacterium
           extorquens PA1]
          Length = 488

 Score =  314 bits (805), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 206/305 (67%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           SE   W  +LT G   TS  L + +T + + R+LD    E+LED LI++D GV  A ++ 
Sbjct: 180 SEKQGWWSRLTAGMRRTSSALSDRVTGLFTKRKLDATTLEDLEDALIQADFGVETAARMS 239

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E +   RY K +S   V   ++  I + L P++ P   D + +P+VIL VGVNG GKTT 
Sbjct: 240 EAVGKGRYEKGISPDEVRAILATEIERALEPVALPIEIDSAKKPYVILTVGVNGAGKTTT 299

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLS K    G  VMLAAGDTFR+AAI+QL++W DRT    +    GSDAA LA++AFK
Sbjct: 300 IGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGDRTGTPVISRAQGSDAAGLAFDAFK 359

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+    DVL+IDTAGRL N + LMA + K++RV+++LDP APHS L VLDAT GQNAL 
Sbjct: 360 EARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHSTLLVLDATVGQNALS 419

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F   A  +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG+ DLEPF A+DF+
Sbjct: 420 QVELFSQAAPVSGLVMTKLDGTARGGILVALATKFGLPVHFIGVGEGVEDLEPFAARDFA 479

Query: 308 AVITG 312
             ITG
Sbjct: 480 RAITG 484


>gi|304392647|ref|ZP_07374587.1| cell division protein FtsY [Ahrensia sp. R2A130]
 gi|303295277|gb|EFL89637.1| cell division protein FtsY [Ahrensia sp. R2A130]
          Length = 585

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 150/302 (49%), Positives = 210/302 (69%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +W  ++  G + +S +L   +  + + ++LD+   E+LED+L+++D+GV  A  I + L 
Sbjct: 278 TWFARMRSGLSRSSNQLTSNVAAVFTKKKLDEETLEQLEDVLLQADLGVETAVAITDALA 337

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
            +R  KD++   V   ++  I K L P++     D  H PHVILVVGVNG GKTT IGKL
Sbjct: 338 DQRMGKDITDLEVREFMAAEIEKTLDPVAAELELDLEHTPHVILVVGVNGSGKTTTIGKL 397

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           S+K+ DAG   +L AGDTFR+AAI+QLKIW DRT +     ++G+D+A LAY+A+ +A  
Sbjct: 398 SQKLYDAGFSTLLVAGDTFRAAAIEQLKIWGDRTQSPVAFRDLGADSAGLAYDAYAKALD 457

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DV+++DTAGRL N + LM  + K+IRVLK+ DP APH+VL  LDATTGQNAL QVE+
Sbjct: 458 EGQDVMLMDTAGRLQNKTELMDELRKIIRVLKKQDPTAPHTVLLTLDATTGQNALSQVEI 517

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG  GL+MTK+DGTARGG ++ +   HK+PVYF+GVGE ++DLEPF A+DF+  I 
Sbjct: 518 FKEVAGVNGLVMTKLDGTARGGIMVSLAAKHKLPVYFIGVGEQVDDLEPFEARDFARSIA 577

Query: 312 GC 313
           G 
Sbjct: 578 GL 579


>gi|254470691|ref|ZP_05084094.1| signal recognition particle-docking protein FtsY [Pseudovibrio sp.
           JE062]
 gi|211959833|gb|EEA95030.1| signal recognition particle-docking protein FtsY [Pseudovibrio sp.
           JE062]
          Length = 517

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 217/304 (71%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW ++L  G + +S  L EGI+ I + R+LD    EELED+LI++D+G+  A  I + + 
Sbjct: 211 SWFQRLKAGLSRSSNALTEGISSIFTKRKLDADTLEELEDILIQADLGIDTAIAITDRVS 270

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY K++S + V   +++ I  +L P++KP + +  H+PH++L+VGVNG GKTT IGKL
Sbjct: 271 DGRYDKEISGEEVRAILADEIESVLEPVAKPLDLNIGHKPHIVLMVGVNGTGKTTTIGKL 330

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           S  + + G KVMLAAGDTFR+AA++QLK+W  RT A+ V  + G+DAA LAY+A   A +
Sbjct: 331 SSLLHEQGKKVMLAAGDTFRAAAVEQLKVWGQRTGAEVVARDTGADAAGLAYDAVDAALS 390

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVL+IDTAGRL N + LM  + K+IRV+++  P APH+ L  LDATTGQNAL QVE+
Sbjct: 391 NDTDVLLIDTAGRLQNKAELMDELEKIIRVIRKRVPDAPHTTLLTLDATTGQNALSQVEI 450

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG TGL+MTK+DGTARGG L+ I   + +PV+F+GVGEG++DLEPF AKDF+A I 
Sbjct: 451 FGKVAGVTGLVMTKLDGTARGGILVAIARKYGLPVHFIGVGEGVDDLEPFSAKDFAAAIA 510

Query: 312 GCLD 315
           G  D
Sbjct: 511 GKDD 514


>gi|86747488|ref|YP_483984.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris HaA2]
 gi|86570516|gb|ABD05073.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris HaA2]
          Length = 315

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 154/302 (50%), Positives = 211/302 (69%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW R+L+ G   TS  +   +++ IS R+LD  + +E+ED+L+R+D+G  VA +I + + 
Sbjct: 11  SWWRRLSSGLKRTSSSIGTALSEFISKRKLDRAMLDEIEDVLLRADLGTEVATRISDAVG 70

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY K +S   V   V+  + K+L P++KP   D + +P V+LVVGVNG GKTT IGKL
Sbjct: 71  EGRYDKMISAGDVKEIVAAEVEKVLAPVAKPLVIDRAKKPFVVLVVGVNGSGKTTTIGKL 130

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           S + +  G KVM+AAGDTFR+AAI+QLK+W +RT    +    GSD+A+LA+ A   A+ 
Sbjct: 131 SARYAAEGHKVMMAAGDTFRAAAIEQLKVWGERTGTPVIAGAQGSDSASLAFNALTTAKE 190

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVL+IDTAGRL N + LM  +GK++RV+K++D  APH+VL VLDAT GQNAL QVE 
Sbjct: 191 QARDVLLIDTAGRLQNRTELMNELGKVVRVIKKVDDTAPHAVLLVLDATVGQNALSQVEA 250

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   AG TGL+MTK+DGTARGG L+ I   HK+PV+F+GVGEG+ DL PF A+DF+  I 
Sbjct: 251 FTKTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVEDLAPFTARDFAQAIA 310

Query: 312 GC 313
           G 
Sbjct: 311 GT 312


>gi|240139474|ref|YP_002963949.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein [Methylobacterium extorquens AM1]
 gi|240009446|gb|ACS40672.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein [Methylobacterium extorquens AM1]
          Length = 488

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 206/305 (67%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           SE   W  +LT G   TS  L + +T + + R+LD    E+LED LI++D GV  A ++ 
Sbjct: 180 SEKQGWWSRLTAGMRRTSSALSDRVTGLFTKRKLDATTLEDLEDALIQADFGVETATRMS 239

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E +   RY K +S   V   ++  I + L P++ P   D + +P+VIL VGVNG GKTT 
Sbjct: 240 EAVGKGRYEKGISPDEVRAILATEIERALEPVALPIEIDSAKKPYVILTVGVNGAGKTTT 299

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLS K    G  VMLAAGDTFR+AAI+QL++W DRT    +    GSDAA LA++AFK
Sbjct: 300 IGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGDRTGTPVISRAQGSDAAGLAFDAFK 359

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+    DVL+IDTAGRL N + LMA + K++RV+++LDP APH+ L VLDAT GQNAL 
Sbjct: 360 EARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHATLLVLDATVGQNALS 419

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F   A  +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG+ DLEPF A+DF+
Sbjct: 420 QVELFSQAAPVSGLVMTKLDGTARGGILVALATKFGLPVHFIGVGEGVEDLEPFAARDFA 479

Query: 308 AVITG 312
             ITG
Sbjct: 480 RAITG 484


>gi|254561888|ref|YP_003068983.1| fused Signal Recognition Particle [Methylobacterium extorquens DM4]
 gi|254269166|emb|CAX25132.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein [Methylobacterium extorquens DM4]
          Length = 488

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 206/305 (67%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           SE   W  +LT G   TS  L + +T + + R+LD    E+LED LI++D GV  A ++ 
Sbjct: 180 SEKQGWWSRLTAGMRRTSSALSDRVTGLFTKRKLDATTLEDLEDALIQADFGVETATRMS 239

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E +   RY K +S   V   ++  I + L P++ P   D + +P+VIL VGVNG GKTT 
Sbjct: 240 EAVGKGRYEKGISPDEVRAILATEIERALEPVALPIEIDSAKKPYVILTVGVNGAGKTTT 299

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLS K    G  VMLAAGDTFR+AAI+QL++W DRT    +    GSDAA LA++AFK
Sbjct: 300 IGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGDRTGTPVISRAQGSDAAGLAFDAFK 359

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+    DVL+IDTAGRL N + LMA + K++RV+++LDP APH+ L VLDAT GQNAL 
Sbjct: 360 EARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHATLLVLDATVGQNALS 419

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F   A  +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG+ DLEPF A+DF+
Sbjct: 420 QVELFSQAAPVSGLVMTKLDGTARGGILVALATKFGLPVHFIGVGEGVEDLEPFAARDFA 479

Query: 308 AVITG 312
             ITG
Sbjct: 480 RAITG 484


>gi|218530901|ref|YP_002421717.1| signal recognition particle-docking protein FtsY [Methylobacterium
           chloromethanicum CM4]
 gi|218523204|gb|ACK83789.1| signal recognition particle-docking protein FtsY [Methylobacterium
           chloromethanicum CM4]
          Length = 488

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 206/305 (67%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           SE   W  +LT G   TS  L + +T + + R+LD    E+LED LI++D GV  A ++ 
Sbjct: 180 SEKQGWWSRLTAGMRRTSSALSDRVTGLFTKRKLDATTLEDLEDALIQADFGVETATRMS 239

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E +   RY K +S   V   ++  I + L P++ P   D + +P+VIL VGVNG GKTT 
Sbjct: 240 EAVGKGRYEKGISPDEVRAILATEIERALEPVALPIEIDSAKKPYVILTVGVNGAGKTTT 299

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLS K    G  VMLAAGDTFR+AAI+QL++W DRT    +    GSDAA LA++AFK
Sbjct: 300 IGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGDRTGTPVISRAQGSDAAGLAFDAFK 359

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+    DVL+IDTAGRL N + LMA + K++RV+++LDP APH+ L VLDAT GQNAL 
Sbjct: 360 EARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHATLLVLDATVGQNALS 419

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F   A  +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG+ DLEPF A+DF+
Sbjct: 420 QVELFSQAAPVSGLVMTKLDGTARGGILVALATKFGLPVHFIGVGEGVEDLEPFAARDFA 479

Query: 308 AVITG 312
             ITG
Sbjct: 480 RAITG 484


>gi|91974997|ref|YP_567656.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris BisB5]
 gi|91681453|gb|ABE37755.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris BisB5]
          Length = 315

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 212/306 (69%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           ++  SW R+L+ G   TS  +   +++ IS R+LD  + +E+ED+L+R+D+G  VA +I 
Sbjct: 7   TQKPSWWRRLSSGLKRTSSSIGTALSEFISKRKLDRAMLDEIEDVLLRADLGTEVASRIS 66

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           + +   RY K +S   V   V+  + K+L P++KP   D + +P V+LVVGVNG GKTT 
Sbjct: 67  DAVGEGRYDKMISASDVKEIVASEVEKVLAPVAKPLVIDDAKKPFVVLVVGVNGSGKTTT 126

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLS + +  G KVM+AAGDTFR+AAI+QLK+W +RT    +    GSD+A+LA+ A  
Sbjct: 127 IGKLSARFAAEGRKVMMAAGDTFRAAAIEQLKVWGERTGTPVIAGAQGSDSASLAFNALT 186

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+ +  DVL+IDTAGRL N   LM+ + K++RV+K++D  APH+VL VLDAT GQNAL 
Sbjct: 187 AAKEQGRDVLLIDTAGRLQNRKELMSELEKVVRVIKKVDDTAPHAVLLVLDATVGQNALS 246

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE F   AG TGL+MTK+DGTARGG L+ I   HK+PV+F+GVGEG+ DL PF A+DF+
Sbjct: 247 QVEAFTRTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVEDLSPFTARDFA 306

Query: 308 AVITGC 313
             I G 
Sbjct: 307 QAIAGT 312


>gi|188582090|ref|YP_001925535.1| signal recognition particle-docking protein FtsY [Methylobacterium
           populi BJ001]
 gi|179345588|gb|ACB81000.1| signal recognition particle-docking protein FtsY [Methylobacterium
           populi BJ001]
          Length = 493

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 206/305 (67%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           +E   W  +LT G   TS  L + +T + + R+LD    E+LED LI++D GV  A ++ 
Sbjct: 185 TEKQGWWSRLTAGMRRTSSALSDRVTGLFTKRKLDATTLEDLEDALIQADFGVETAMRMS 244

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E +   RY K +S   V   ++  I + L P++ P   D + +P+VIL VGVNG GKTT 
Sbjct: 245 EAVGKGRYEKGISPDEVRAILATEIERALEPVATPIAIDSAKKPYVILTVGVNGAGKTTT 304

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLS K    G  VMLAAGDTFR+AAI+QL++W +RT    +    GSDAA LA++AFK
Sbjct: 305 IGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGERTGTPVISRAQGSDAAGLAFDAFK 364

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+    DVL+IDTAGRL N + LMA + K++RV+++LDP APH+ L VLDAT GQNAL 
Sbjct: 365 EARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHATLLVLDATVGQNALS 424

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F   A  +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG+ DLEPF A+DF+
Sbjct: 425 QVELFSQAAPVSGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVEDLEPFAARDFA 484

Query: 308 AVITG 312
             ITG
Sbjct: 485 RAITG 489


>gi|182677358|ref|YP_001831504.1| signal recognition particle-docking protein FtsY [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633241|gb|ACB94015.1| signal recognition particle-docking protein FtsY [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 408

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/309 (50%), Positives = 214/309 (69%), Gaps = 1/309 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +L  G + +S  +  G+ DI + R+LD+ + E+LED+LIR+D+G AVAQ+I E + 
Sbjct: 100 SWWTRLRDGLSRSSSSIGTGLVDIFTKRKLDEAMLEDLEDILIRADLGTAVAQRITEAVG 159

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY  DV  + V   ++  + ++L P +KP   D + +P VILVVGVNG GKTT IGKL
Sbjct: 160 KGRYNWDVDPREVKTILASEVEQVLTPYAKPLVIDTTKKPFVILVVGVNGSGKTTTIGKL 219

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + + S  G KVMLAAGDTFR+AAI+QL+IW  R     +    GSDA+ LA++A K A++
Sbjct: 220 AAQFSREGHKVMLAAGDTFRAAAIEQLQIWGQRLGCTVIARPQGSDASGLAFDAIKTARS 279

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  D+L++DTAGRL N + LM  + K+IRV+++ D  APH+VL VLDAT GQNAL QVE+
Sbjct: 280 EGADLLLMDTAGRLQNRAELMDELEKIIRVMRKQDEEAPHAVLLVLDATVGQNALNQVEI 339

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG TGL+MTK+DGTARGG L+ I    K+P++F+GVGE ++DLEPF A DF   I 
Sbjct: 340 FGRVAGVTGLVMTKLDGTARGGILVAITEKFKLPIHFIGVGEKVDDLEPFAASDFGLAIA 399

Query: 312 GCLDYGEEK 320
           G LD  E +
Sbjct: 400 G-LDKDESQ 407


>gi|115522346|ref|YP_779257.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris BisA53]
 gi|115516293|gb|ABJ04277.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris BisA53]
          Length = 316

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 213/310 (68%)

Query: 3   NQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAV 62
           N    S+  SW R+L+ G   TS  +   + + +S R+LD  + EE+ED+L+R+D+G  V
Sbjct: 2   NDTSESKKPSWWRRLSSGLKRTSSSIGTALAEFVSKRKLDRAMLEEIEDVLLRADLGTEV 61

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
           + +I   +   RY K +S   V   V+  + K+L P+++P   D + +P VIL+VGVNG 
Sbjct: 62  SARIAAAVGEGRYDKMISASDVKEIVAAEVEKVLAPVARPLVIDGAKKPFVILMVGVNGS 121

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+ ++S  G KVMLAAGDTFR+AAI+QLK+W +RT +  V    GSD+A+LA
Sbjct: 122 GKTTTIGKLAARLSGEGRKVMLAAGDTFRAAAIEQLKVWGERTGSPVVAGAQGSDSASLA 181

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           + A  QA+ +  DVL+IDTAGRL N + LM  + K++RV++++D  APH+VL VLDAT G
Sbjct: 182 FNALTQAKDEGRDVLLIDTAGRLQNRTELMNELEKVVRVIRKVDSSAPHAVLLVLDATVG 241

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNAL QVE F   AG TGL+MTK+DGTARGG L+ +   HK+PV+F+GVGE ++DL PF 
Sbjct: 242 QNALSQVEAFSRTAGVTGLVMTKLDGTARGGILVALAEKHKLPVHFIGVGESVDDLAPFT 301

Query: 303 AKDFSAVITG 312
           A DF+  I G
Sbjct: 302 APDFAKAIAG 311


>gi|23015509|ref|ZP_00055283.1| COG0552: Signal recognition particle GTPase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 330

 Score =  308 bits (790), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 212/304 (69%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           E+ SW  +L  G A +S KL +G+ D+ + R+LDD   E+LEDLLI +D+GVA A ++ +
Sbjct: 25  ETASWFGRLKSGLAKSSSKLTQGLGDLFTKRKLDDEALEDLEDLLITADLGVATAARVTK 84

Query: 69  ELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
            L   R+ +DV+   +   ++E I ++L P+++P   D + +PHV+LVVGVNG GKTT I
Sbjct: 85  HLAKTRFGQDVTSDEIKATLAEEITRILAPVARPLAIDPNRKPHVVLVVGVNGSGKTTTI 144

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GK++K   DAGL V LAAGDTFR+AA++QLK+W +RT+   +  E G+DAA LAY+A +Q
Sbjct: 145 GKMAKTYKDAGLSVTLAAGDTFRAAAVEQLKVWGERTNCPVIARETGADAAGLAYDAVEQ 204

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           ++A+  D+L IDTAGRL N + LMA + K++R +K++D  APHSVL VLDAT GQNA  Q
Sbjct: 205 SRARGDDLLFIDTAGRLQNKADLMAELAKLVRSIKKVDETAPHSVLLVLDATVGQNAHSQ 264

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
           VE+F  +   +GL++TK+DGTARGG L+ +     +PV+ +GVGE   DL PF A  F+ 
Sbjct: 265 VEIFKDMVAVSGLVLTKLDGTARGGVLVALAEKFGLPVHAIGVGEKAEDLRPFEADAFAK 324

Query: 309 VITG 312
            + G
Sbjct: 325 SLVG 328


>gi|220924283|ref|YP_002499585.1| signal recognition particle-docking protein FtsY [Methylobacterium
           nodulans ORS 2060]
 gi|219948890|gb|ACL59282.1| signal recognition particle-docking protein FtsY [Methylobacterium
           nodulans ORS 2060]
          Length = 437

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 205/300 (68%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W  +LT G   TS  L E +T + + R+LD    EELED LI++D GV  A +I E +  
Sbjct: 133 WWSRLTGGLRRTSSALSERVTGLFTKRKLDATTLEELEDALIQADFGVETAMRISEAVGK 192

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            RY K ++   V   ++  + + L P+++P   D   +P V+L+VGVNG GKTT IGKL+
Sbjct: 193 GRYEKGIAPDEVRAILATEVERALEPVARPLALDPGAKPFVLLMVGVNGAGKTTTIGKLA 252

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
           +K    G  VMLAAGDTFR+AAI+QLK+W +RT A  V    G+DAA LA++A + A+  
Sbjct: 253 QKFRAQGRSVMLAAGDTFRAAAIEQLKVWGERTGAPVVTRPQGADAAGLAFDALQAARES 312

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DVL+IDTAGRL N + LMA + K++RV+++LD  APH+VL VLDAT GQNA+ QVE+F
Sbjct: 313 GTDVLMIDTAGRLQNKAGLMAELEKIVRVIRKLDESAPHAVLLVLDATVGQNAISQVELF 372

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              AG TGL+MTK+DGTARGG L+ +     +PV+F+GVGEG++DLEPF A+DF+  I G
Sbjct: 373 QKTAGVTGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVDDLEPFTARDFARAIAG 432


>gi|298293311|ref|YP_003695250.1| signal recognition particle-docking protein FtsY [Starkeya novella
           DSM 506]
 gi|296929822|gb|ADH90631.1| signal recognition particle-docking protein FtsY [Starkeya novella
           DSM 506]
          Length = 318

 Score =  308 bits (788), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 210/301 (69%), Gaps = 1/301 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++LT+G   T+  L  GITD+ + R+LD    EELED+LIR+D+GV  + +I E +  
Sbjct: 17  W-KRLTQGLTRTASGLSTGITDLFTKRKLDATTLEELEDVLIRADLGVETSARIAEAVGK 75

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            RY K +  + V   V+  I  +L P++ P  ++   +P V+L+VGVNG GKTT IGKL+
Sbjct: 76  GRYDKGIDPEEVRNLVAAEIEAVLTPVAHPLAFNTGAKPFVLLMVGVNGSGKTTTIGKLA 135

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             +   G KV+LAAGDTFR+AAI+QLK+WADRT A  V    G+DAA +A++  +QA+  
Sbjct: 136 STLRAQGKKVVLAAGDTFRAAAIEQLKVWADRTGAAIVARPPGADAAGVAFDGLQQAREV 195

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DVLIIDTAGRL N + LMA + K++RV+K+ D  APH+V+  LDAT GQNAL+QVE F
Sbjct: 196 GADVLIIDTAGRLQNRAELMAELEKVVRVIKKQDASAPHAVVLTLDATVGQNALQQVEAF 255

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             VAG TGL+MTK+DGTARGG L+ I   + +PV+ +G+GEGI+DL+PF A+DF+  I G
Sbjct: 256 RRVAGVTGLVMTKLDGTARGGILVAIAAKYGLPVHMIGIGEGIDDLQPFAARDFARAIVG 315

Query: 313 C 313
            
Sbjct: 316 L 316


>gi|170741579|ref|YP_001770234.1| signal recognition particle-docking protein FtsY [Methylobacterium
           sp. 4-46]
 gi|168195853|gb|ACA17800.1| signal recognition particle-docking protein FtsY [Methylobacterium
           sp. 4-46]
          Length = 473

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 207/304 (68%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           E   W  +LT G   TS  L E +T + + R+LD    EELED LI++D GV  A +I E
Sbjct: 165 ERRGWWSRLTGGLRRTSSALSERVTGLFTKRKLDATTLEELEDALIQADFGVETATRIAE 224

Query: 69  ELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
            +   RY K +S   V   ++  + + L P+++P   + + +P V+L+VGVNG GKTT I
Sbjct: 225 AVGKGRYEKGISPDEVRAILAAEVERALEPVARPLTLEGAAKPFVLLMVGVNGAGKTTTI 284

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL++K    G  VMLAAGDTFR+AAI+QLK+W +RT A  +    G+DAA LA++A + 
Sbjct: 285 GKLAQKFRAQGRSVMLAAGDTFRAAAIEQLKVWGERTGAPVLSRPQGADAAGLAFDALQA 344

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+    DVL+IDTAGRL N + LMA + K++RV+++LD  APH+VL VLDAT GQNA+ Q
Sbjct: 345 AREAGTDVLMIDTAGRLQNKAGLMAELEKIVRVIRKLDETAPHAVLLVLDATVGQNAISQ 404

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
           VE+F   AG +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG++DLEPF A+DF+ 
Sbjct: 405 VELFQKTAGVSGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVDDLEPFTARDFAR 464

Query: 309 VITG 312
            I G
Sbjct: 465 AIAG 468


>gi|90421736|ref|YP_530106.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris BisB18]
 gi|90103750|gb|ABD85787.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas
           palustris BisB18]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 210/311 (67%)

Query: 3   NQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAV 62
           N    ++  SW R+L+ G   TS  +   + + ++ R+LD  + +E+ED+L+R+D+G  V
Sbjct: 2   NDTTETKKPSWWRRLSSGLKRTSSSIGTALAEFVTKRKLDRAMLDEIEDVLLRADLGTEV 61

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
           + +I   +   RY K +S   V   V+  + K+L P+++P   D +H+P VIL+VGVNG 
Sbjct: 62  SARIAAAVGVGRYDKMISAGDVKTIVAAEVEKVLAPVAQPLVIDAAHKPFVILMVGVNGS 121

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+ K +  G KVMLAAGDTFR+AAI+QLK+W +RT A  +    GSD+A LA
Sbjct: 122 GKTTTIGKLAAKFAAEGRKVMLAAGDTFRAAAIEQLKVWGERTGAPVISGTQGSDSAGLA 181

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           + A   A+  + DVL+IDTAGRL N + LM  + K++RV+K++D  APH+VL VLDAT G
Sbjct: 182 FTALTAAKDDRRDVLLIDTAGRLQNKAELMNELEKVVRVIKKVDATAPHAVLLVLDATVG 241

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNAL QVE F   AG TGL+MTK+DGTARGG L+ +   +K+PV+F+GVGE + DL PF 
Sbjct: 242 QNALSQVEAFSRTAGVTGLVMTKLDGTARGGILVALAEKYKLPVHFVGVGESVEDLAPFT 301

Query: 303 AKDFSAVITGC 313
           A DF+  I G 
Sbjct: 302 AADFAKAIAGT 312


>gi|170751708|ref|YP_001757968.1| signal recognition particle-docking protein FtsY [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658230|gb|ACB27285.1| signal recognition particle-docking protein FtsY [Methylobacterium
           radiotolerans JCM 2831]
          Length = 466

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 202/305 (66%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
            E+  W  +LT G   TS  L + +T + + R+LD    E+LED LI++D G+  A ++ 
Sbjct: 158 PEAKGWWSRLTSGMKRTSSALSDRVTGLFTKRKLDATTLEDLEDALIQADFGLETAMRVS 217

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E +   RY K +S   V   ++  + + L P++ P   D + +P VIL VGVNG GKTT 
Sbjct: 218 EAVGKGRYEKGISPDEVRAILAAEVERALEPVAVPLTIDAARKPFVILTVGVNGAGKTTT 277

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           +GKL+ K+   G  VMLAAGDTFR+AAIDQLK+W  RT    V    G+DAA LA++A K
Sbjct: 278 LGKLASKLRAEGRTVMLAAGDTFRAAAIDQLKVWGARTGTPVVSGAQGADAAGLAFDALK 337

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           QA A   DVL+IDTAGRL N + LMA + K++RVL++ DP APH+ L VLDAT GQNAL 
Sbjct: 338 QAGAAGTDVLLIDTAGRLQNKAGLMAELEKIVRVLRKQDPDAPHATLLVLDATVGQNALS 397

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F   A  +GL+MTK+DGTARGG L+ +     +PV+F+GVGEG+ DLEPF A+DF+
Sbjct: 398 QVELFSQAAPVSGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVEDLEPFAARDFA 457

Query: 308 AVITG 312
             I G
Sbjct: 458 RAIAG 462


>gi|209883417|ref|YP_002287274.1| signal recognition particle-docking protein FtsY [Oligotropha
           carboxidovorans OM5]
 gi|209871613|gb|ACI91409.1| signal recognition particle-docking protein FtsY [Oligotropha
           carboxidovorans OM5]
          Length = 318

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 156/301 (51%), Positives = 213/301 (70%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW ++L+ G   TS  +   + D++  R+LD  + E++ED+L+R+D+G  VA +I  ++ 
Sbjct: 12  SWWQRLSAGLKRTSGSIGAAVADLVVKRKLDRAMLEDIEDVLLRADLGTEVAARIAAKVG 71

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY KDVS Q V   V+  + K+L P++ P   D S +P +ILVVGVNG GKTT IGKL
Sbjct: 72  EGRYDKDVSAQDVQAIVAAEVEKVLAPVAMPLVIDESQKPFIILVVGVNGSGKTTTIGKL 131

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K +  G +VMLAAGDTFR+AAI+QLKIW +RT A  +  + GSDAA+LA++A   A+A
Sbjct: 132 AAKFAAEGRRVMLAAGDTFRAAAIEQLKIWGERTGAPVIARDHGSDAASLAFDAASAAKA 191

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVL+IDTAGRL N + LM  + K+ RV++++D  APH+VL VLDAT GQNAL QVE 
Sbjct: 192 DNRDVLLIDTAGRLQNKAELMVELEKVARVIRKVDTSAPHAVLLVLDATVGQNALSQVEA 251

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   AG TGL+MTK+DGTARGG L+ I   +K+PV+F+GVGEG++DL PF A+DF+  I 
Sbjct: 252 FRKTAGVTGLVMTKLDGTARGGILVAISEIYKLPVHFIGVGEGVDDLAPFTARDFAHAIA 311

Query: 312 G 312
           G
Sbjct: 312 G 312


>gi|109649512|gb|ABG36707.1| FtsY [Bartonella australis]
          Length = 366

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 208/299 (69%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +S   V  +  +W  +L KG + +S +L   I D+    +L     +EL D+  ++D+GV
Sbjct: 68  LSEPSVEQKKTAWFGRLKKGLSLSSQRLSGSICDLFVKEKLVKDTLQELGDIPFQADLGV 127

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
             A  I + + + RY K +S   +   ++  I K+L P++ P   D +H+PHVIL+VGVN
Sbjct: 128 ETAAHITDTIASSRYEKSLSPDNIHTIMANEIEKILEPVAIPLELDLNHKPHVILLVGVN 187

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL+ K++ +GLKV LAAGDTFR+AAI+QL +W +RT +  V +++G+DAA+
Sbjct: 188 GTGKTTTIGKLAAKLTASGLKVTLAAGDTFRAAAIEQLHVWGERTRSPVVSTKLGADAAS 247

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           LA++A+++A+ +  DVLIIDTAGRL N + LM  + K+IRVL +  P APH+VLQ LDAT
Sbjct: 248 LAFDAYEKAKKENSDVLIIDTAGRLQNKTELMDELAKIIRVLGKHTPKAPHTVLQTLDAT 307

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
           TGQNAL QV++F  VAG  GL+MTK+DG+ARGG L+ I   +K+PVYF+GVGE I DL+
Sbjct: 308 TGQNALNQVDIFRDVAGVNGLVMTKLDGSARGGILVAIASKYKLPVYFIGVGENIEDLQ 366


>gi|83592517|ref|YP_426269.1| signal recognition particle-docking protein FtsY [Rhodospirillum
           rubrum ATCC 11170]
 gi|83575431|gb|ABC21982.1| signal recognition particle-docking protein FtsY [Rhodospirillum
           rubrum ATCC 11170]
          Length = 506

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 214/297 (72%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +S+  +L  G + TS KL  GI  ++S R+LDD   E+LEDLLI +DIGV  A K+   L
Sbjct: 203 VSFFARLRGGLSRTSGKLVGGIMGLVSERKLDDQALEDLEDLLITADIGVETAGKLTRSL 262

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
             +R+ K+V+ + +    ++ I  +L P+++P   D S +PHV+LVVGVNG GKTT IGK
Sbjct: 263 AKERFGKNVTGEEIRGHFADEIATILGPVARPLEIDGSLKPHVVLVVGVNGSGKTTTIGK 322

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           ++ ++     +V+LAAGDTFR+AA++QL+IW DRT  + +  + G+D+A LA++A ++A+
Sbjct: 323 IANQLVHENKRVLLAAGDTFRAAAVEQLRIWGDRTGCEVIARDTGADSAGLAFDALQKAR 382

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+  DVL+IDTAGRLHN + LM  + K++RVL+++DP  PH+ LQVLDAT GQNA +QV+
Sbjct: 383 AEGYDVLLIDTAGRLHNKTELMEELKKVVRVLRKIDPAVPHTCLQVLDATVGQNAHQQVK 442

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           +F  +   +GL+MTK+DGTA+GG ++ +     +PV+++G+GEGI+DL PF A+DF+
Sbjct: 443 VFQEMTDVSGLVMTKLDGTAKGGVVVALADKFGLPVHYVGIGEGIDDLRPFSARDFA 499


>gi|217979345|ref|YP_002363492.1| signal recognition particle-docking protein FtsY [Methylocella
           silvestris BL2]
 gi|217504721|gb|ACK52130.1| signal recognition particle-docking protein FtsY [Methylocella
           silvestris BL2]
          Length = 483

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 208/300 (69%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W  +L +G A +S  +  G+  I + R+LD  + +ELE++LIR+D+GVA A  I   +  
Sbjct: 175 WWTRLRQGLARSSDSIGSGLKAIFTKRKLDAAMLDELEEVLIRADLGVATATHIAGLVGK 234

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            RY K + V  V   ++E + ++L P ++P   D + +P VILVVGVNG GKTT IGKL+
Sbjct: 235 GRYDKSIEVDEVKTILAEEVERVLAPYARPLEIDPAIKPFVILVVGVNGSGKTTTIGKLA 294

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            + S  G KV+LAAGDTFR+AAI+QL++W DR +   +    GSDA+ALA++A + A+  
Sbjct: 295 AQFSQEGRKVLLAAGDTFRAAAIEQLRLWGDRLNCAVIAGNQGSDASALAFDAIRAARES 354

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             D+LI+DTAGRL N + LMA + K++RV+K+++P APH+VL VLDAT GQNA+ Q E+F
Sbjct: 355 GADILIMDTAGRLQNRAELMAELEKIVRVMKKVEPAAPHAVLLVLDATVGQNAVSQTEIF 414

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             VAG TGL+MTK+DGTARGG L+ +    ++P++++GVGE   DL PF A+DF+  I G
Sbjct: 415 SKVAGVTGLVMTKLDGTARGGILVALAEKFQLPIHYVGVGETAADLAPFAARDFARAIAG 474


>gi|158425332|ref|YP_001526624.1| cell division transporter substrate-binding protein [Azorhizobium
           caulinodans ORS 571]
 gi|158332221|dbj|BAF89706.1| cell division transporter substrate-binding protein [Azorhizobium
           caulinodans ORS 571]
          Length = 313

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/304 (50%), Positives = 215/304 (70%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           E   + R+LT G A T+  L +GITD+++ R+LD    EELEDLLIR+D+G A A +IVE
Sbjct: 8   EKPGFWRRLTSGLARTATSLTQGITDLVTKRKLDAETLEELEDLLIRADLGTATAARIVE 67

Query: 69  ELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
            +   R+ K ++   V   ++  + ++L P++KPF  D   +P V+L+VGVNG GKTT I
Sbjct: 68  AVGKGRHDKMIAPDEVKGLIASEVEEILGPVAKPFVPDAGQKPFVVLMVGVNGSGKTTTI 127

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+ +    G ++ LAAGDTFR+AAI+QLK+W  RT A  V  E G+DAA +A++A  +
Sbjct: 128 GKLAAQWRSEGKRLTLAAGDTFRAAAIEQLKVWGARTGAHVVAREQGADAAGVAHDAITE 187

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A   D+++IDTAGRL N + LM  + K++RV+K+L+P APH+VL VLDAT GQNAL Q
Sbjct: 188 ARANGSDIVMIDTAGRLQNRTELMDELEKVVRVVKKLEPTAPHAVLLVLDATVGQNALNQ 247

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
           VE+F   AG TGL+MTK+DGTARGG L+ I   +++P++ +GVGEG  DL+PF A+DFS 
Sbjct: 248 VEVFARTAGVTGLVMTKLDGTARGGILVAIAQKYRLPIHLVGVGEGAEDLQPFSARDFSR 307

Query: 309 VITG 312
            I G
Sbjct: 308 AIAG 311


>gi|254292478|ref|YP_003058501.1| signal recognition particle-docking protein FtsY [Hirschia baltica
           ATCC 49814]
 gi|254041009|gb|ACT57804.1| signal recognition particle-docking protein FtsY [Hirschia baltica
           ATCC 49814]
          Length = 446

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 206/303 (67%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  ++T+G   +S KL +GI+ + + ++LDD   EELEDLLI SD+G +VA ++ + +  
Sbjct: 139 FFARMTQGLQRSSSKLADGISSVFTKKKLDDDTLEELEDLLISSDLGASVAMRVCDNIRK 198

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K+V+ + +   +++ I  +L P  +  +      P V+L VGVNG GKTT IGK++
Sbjct: 199 DRFDKEVTDEEIKQALAQEITNVLKPREEILDLSDGPSPRVVLFVGVNGSGKTTTIGKIA 258

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            K+S  G  ++LAAGDTFR+AA++QLK+WA+R +A F+    G+D+A LAY+A KQA  +
Sbjct: 259 SKLSAQGANILLAAGDTFRAAAVEQLKVWAERANAGFLSRPDGADSAGLAYDAVKQATTE 318

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             D+++IDTAGRL N + LM  + K++R +++++P APH V+ VLDAT GQNAL QVE F
Sbjct: 319 NRDLVLIDTAGRLQNRTELMDELAKVVRAIRKIEPTAPHEVILVLDATVGQNALSQVEAF 378

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              AG TGL+MTK+DGTA+GG L+ I   H +P++F+G+GE   DL PF A  F+  + G
Sbjct: 379 KHTAGVTGLVMTKLDGTAKGGVLVAIADKHALPIHFVGIGEKAEDLHPFSASAFANALVG 438

Query: 313 CLD 315
             D
Sbjct: 439 LSD 441


>gi|296114906|ref|ZP_06833554.1| signal recognition particle-docking protein FtsY [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978612|gb|EFG85342.1| signal recognition particle-docking protein FtsY [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 331

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 208/303 (68%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L +  +L  G + ++ KL  G++ + + R+LDD   E+LEDLLI +D+G  VA K+++ 
Sbjct: 2   ALGFFSRLKAGLSRSTQKLSGGLSAVFTRRKLDDQALEDLEDLLISADLGPNVAAKVIDS 61

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             + ++ K+V+ + V   ++E I K+L P++ PF  D +H+PHV+LVVGVNG GKTT IG
Sbjct: 62  FRSSKFGKEVTDEEVRTALAEEIAKILEPVAIPFEPDPAHKPHVVLVVGVNGTGKTTTIG 121

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K+++   + G KVM+ AGDTFR+AA++QL++W +R  A  +     +DAA LA+EA K+ 
Sbjct: 122 KMARYYGEQGKKVMMVAGDTFRAAAVEQLQVWGERVGAPVIAGPPNADAAGLAFEALKKG 181

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+  D+L++DTAGRLHN   LM  + K+IRV+++ D  APHSV  VLDATTGQNA+ QV
Sbjct: 182 KAEGADLLLVDTAGRLHNKGALMEELAKIIRVMRKFDETAPHSVFLVLDATTGQNAMEQV 241

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
            +F  +   TGL++TK+DG+ARGG ++ +     +PV+ +GVGE   DL PF A+ F+  
Sbjct: 242 RVFKELVNVTGLVVTKLDGSARGGIVVALADAFGLPVHMVGVGEQAEDLRPFSAQAFAQG 301

Query: 310 ITG 312
           + G
Sbjct: 302 LVG 304


>gi|154251866|ref|YP_001412690.1| signal recognition particle-docking protein FtsY [Parvibaculum
           lavamentivorans DS-1]
 gi|154155816|gb|ABS63033.1| signal recognition particle-docking protein FtsY [Parvibaculum
           lavamentivorans DS-1]
          Length = 316

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 209/311 (67%)

Query: 3   NQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAV 62
             + A +  S  +++ +G   ++  L  GIT I + ++LD    +ELE+LLI +D+G+  
Sbjct: 5   GSEAAEKKRSLFQRMKEGLTRSTKNLSGGITGIFTKKKLDRATLDELEELLIGADLGLDA 64

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
           A  I E +   RY K+VS + +   V++ I ++L P+ KP   D + +P VIL+ GVNG 
Sbjct: 65  AAAIAEAVGKDRYDKEVSPEEIRKIVADEIAEVLKPVEKPLEIDATKKPFVILMTGVNGA 124

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGK+   +   G  VMLAAGDTFR+AA++QLK+W  R  A    ++ G DAA LA
Sbjct: 125 GKTTTIGKIGATLKAEGKSVMLAAGDTFRAAAVEQLKVWGTRIGAPVCATKTGGDAAGLA 184

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           YEA  +A+ +  DVL+IDTAGRL N + LMA + K+IRV+++LDP  PH+ L VLDATTG
Sbjct: 185 YEALARAKEEGTDVLLIDTAGRLQNKADLMAELEKVIRVMRKLDPETPHATLLVLDATTG 244

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNAL QVE+F  VAG TGL+MTK+DGTARGG L+ I     +PV+ +GVGEGI+DL+PF 
Sbjct: 245 QNALNQVEIFGQVAGITGLVMTKLDGTARGGILVAIARKFGLPVHMIGVGEGIDDLQPFS 304

Query: 303 AKDFSAVITGC 313
           A+ ++  ITG 
Sbjct: 305 AEAYARAITGA 315


>gi|144898020|emb|CAM74884.1| Signal recognition particle GTPase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 357

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 200/307 (65%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           +A    SW+ +L  G   +S KL +G+ D+ + R+LDD   E+LEDLLI +D+GV  A +
Sbjct: 49  LAEAPQSWLSRLKSGLTKSSSKLTQGLGDLFTKRKLDDEALEDLEDLLITTDLGVGTAAR 108

Query: 66  IVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           + + L   R+ +DV  + +   ++E + ++L P++KP       RPHV+LVVGVNG GKT
Sbjct: 109 VTKRLAKTRFGQDVGAEEIKQVLAEEVAQILAPVAKPLQPACVARPHVVLVVGVNGSGKT 168

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGK++K   D G +V LAAGDTFR+AA++QLK+W +RT       E G+DAA L ++A
Sbjct: 169 TTIGKMAKHFKDQGKQVALAAGDTFRAAAVEQLKVWGERTQCPVFSRETGADAAGLVFDA 228

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
             ++  +  D+L +DTAGRL N + LM  + K++RV+K+ D  APH VL VLDAT GQNA
Sbjct: 229 MAESAKRGDDLLFVDTAGRLQNKADLMEELRKVVRVIKKQDETAPHDVLLVLDATVGQNA 288

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
             QVE+F  +   TGL++TK+DGTARGG L+ +     +PV+ +GVGE   DL PF A  
Sbjct: 289 HSQVEVFKDMVDVTGLVLTKLDGTARGGVLVALAEKFALPVHAIGVGEKAEDLRPFDANA 348

Query: 306 FSAVITG 312
           F+  + G
Sbjct: 349 FARSLVG 355


>gi|83309312|ref|YP_419576.1| Signal recognition particle GTPase [Magnetospirillum magneticum
           AMB-1]
 gi|82944153|dbj|BAE49017.1| Signal recognition particle GTPase [Magnetospirillum magneticum
           AMB-1]
          Length = 332

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 147/301 (48%), Positives = 209/301 (69%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +L  G A +S KL +G+ D+ + R+LDD   EELEDLLI +D+GVA+A ++ + L 
Sbjct: 30  SWFGRLKSGLAKSSSKLTQGLGDLFTKRKLDDEALEELEDLLITADLGVAMAARVTKHLA 89

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             R+ +DV+   +   ++E I ++L P++KP   D + +PHV+LVVGVNG GKTT IGK+
Sbjct: 90  KTRFGQDVTSDEIKATLAEEITRILTPVAKPLEIDSTRKPHVVLVVGVNGSGKTTTIGKM 149

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K   DAGL V LAAGDTFR+AA++QLK+W +RT    +  E G+DAA LAY+A +Q++A
Sbjct: 150 AKTYKDAGLNVTLAAGDTFRAAAVEQLKVWGERTHCPVIARETGADAAGLAYDAVEQSRA 209

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  D+L IDTAGRL N + LMA + K++R +K++D  APH VL VLDAT GQNA  QVE+
Sbjct: 210 RGDDLLFIDTAGRLQNKADLMAELAKLVRSIKKVDETAPHDVLLVLDATVGQNAHSQVEI 269

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  +   +GL++TK+DGTARGG L+ +     +PV+ +G+GE   DL PF A  F+  + 
Sbjct: 270 FKDMVAVSGLVLTKLDGTARGGVLVALAEKFGLPVHAIGIGEKAEDLRPFEADAFAKSLV 329

Query: 312 G 312
           G
Sbjct: 330 G 330


>gi|329113597|ref|ZP_08242377.1| Cell division protein FtsY-like protein [Acetobacter pomorum DM001]
 gi|326697119|gb|EGE48780.1| Cell division protein FtsY-like protein [Acetobacter pomorum DM001]
          Length = 309

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 214/306 (69%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L +  +L +G + ++ KL  GIT I + R+LDD   EELEDLLI +D+G AVA++I+E 
Sbjct: 2   ALGFFSRLKQGLSRSTQKLGGGITGIFTKRKLDDEALEELEDLLITADMGPAVAERIIES 61

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             + R+  +V+ + +   +++ I  +L P++KPF  D  H+PHV+L+VGVNGVGKTT IG
Sbjct: 62  FRSSRFGTEVTDEEIRTTLADEIAAILEPVAKPFEPDPEHKPHVVLMVGVNGVGKTTTIG 121

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K+++  ++ G KVM+ AGDTFR+AA++QL+IW +RT    +    G+DAA LA+EA K+ 
Sbjct: 122 KMARFFTEEGKKVMMVAGDTFRAAAVEQLQIWGERTGCPVIAGPPGADAAGLAFEALKRG 181

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+  D+L +DTAGRLHN S LM  + K+IRV+++ D  APHSVL VLDATTGQNA+ QV
Sbjct: 182 KAEGADLLFVDTAGRLHNKSALMEELAKIIRVMRKFDETAPHSVLLVLDATTGQNAVEQV 241

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
            +F  +   TGL++TK+DG+ARGG ++ +     +PV+ +GVGE   DL PF A D++  
Sbjct: 242 RVFRELVNVTGLVVTKLDGSARGGIVVALADQFGLPVHAVGVGEQAEDLRPFSAVDYARG 301

Query: 310 ITGCLD 315
           + G  D
Sbjct: 302 LVGVTD 307


>gi|148261479|ref|YP_001235606.1| signal recognition particle-docking protein FtsY [Acidiphilium
           cryptum JF-5]
 gi|326404963|ref|YP_004285045.1| signal recognition particle-docking protein FtsY [Acidiphilium
           multivorum AIU301]
 gi|146403160|gb|ABQ31687.1| signal recognition particle-docking protein FtsY [Acidiphilium
           cryptum JF-5]
 gi|325051825|dbj|BAJ82163.1| signal recognition particle-docking protein FtsY [Acidiphilium
           multivorum AIU301]
          Length = 312

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 202/304 (66%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L ++ +L  G   ++ KL  GITD  + R+LDD   EELEDLLI +D+G A A +++  
Sbjct: 3   ALGFLSRLKSGLTRSTQKLAAGITDTFTKRKLDDAALEELEDLLITADLGPAAAARVIRA 62

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
               R+ +DVS   +   ++E + K+L P+++P   D S  P VIL+VGVNG GKTT IG
Sbjct: 63  FRRTRFGQDVSAPEIRASLAEEVAKILAPVAQPLAIDRSKNPFVILMVGVNGTGKTTTIG 122

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL++  ++AG + +L AGDTFR+AA++QL++W +RT A  +     +D A LA++A  +A
Sbjct: 123 KLAQSYAEAGARPLLVAGDTFRAAAVEQLQVWGERTGAPVMTGPANADPAGLAFDAIARA 182

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +    D+++IDTAGRLHN + LM  + K+IRV+++ D  APH+VL  LDATTGQNA+ QV
Sbjct: 183 RRDGHDIVLIDTAGRLHNKAALMEELRKIIRVIRKQDETAPHAVLLTLDATTGQNAIAQV 242

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
             F  +   TGLI+TK+DG+AR G ++ +  T  +P++ +GVGE   DL PF A +F+  
Sbjct: 243 ATFKEMVDLTGLIVTKLDGSARAGVVVALAETAALPIHAVGVGEQAADLRPFDATEFARA 302

Query: 310 ITGC 313
           +TG 
Sbjct: 303 LTGA 306


>gi|85710834|ref|ZP_01041895.1| Signal recognition particle GTPase [Idiomarina baltica OS145]
 gi|85695238|gb|EAQ33175.1| Signal recognition particle GTPase [Idiomarina baltica OS145]
          Length = 426

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 196/295 (66%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W R LT+G   TS  +  G+  +   +++DD + EELE  L+ +D+GV    KI++ L  
Sbjct: 121 WAR-LTEGLKRTSGSIGSGLFGVFKGKKIDDDLFEELETQLLMADLGVKTTTKIIDNLTQ 179

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  E +  +L P+ KP   D S  P+VILV GVNGVGKTT IGKL
Sbjct: 180 QADRKQLKDAEALYELLQEQMEALLEPVDKPLAIDTSKTPYVILVTGVNGVGKTTTIGKL 239

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL+IW +R     +  + GSD+A++ ++A + A+A
Sbjct: 240 AKQFKREGKSVMLAAGDTFRAAAVEQLQIWGERNEIPVIAQQTGSDSASVLFDAMQAAKA 299

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+ DP APH V+  LDA TGQNA+ Q ++
Sbjct: 300 RGIDVLIADTAGRLQNKSNLMEELKKIVRVMKKQDPEAPHEVMLTLDAGTGQNAISQAKL 359

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G +G++MTK+DGTA+GG +  +    KIP+ ++GVGE ++DL PFVA+DF
Sbjct: 360 FTEAVGVSGIVMTKLDGTAKGGVIFAVADEFKIPIRYIGVGEQLDDLRPFVARDF 414


>gi|307294714|ref|ZP_07574556.1| signal recognition particle-docking protein FtsY [Sphingobium
           chlorophenolicum L-1]
 gi|306879188|gb|EFN10406.1| signal recognition particle-docking protein FtsY [Sphingobium
           chlorophenolicum L-1]
          Length = 312

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 144/302 (47%), Positives = 196/302 (64%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +L  G   TS KL E +T + +   LD+   +E+E+ LI SD+G A+A ++ + L 
Sbjct: 7   SWRDRLFGGLKRTSDKLGENLTGLFTKAALDEQTLDEIEEALIVSDLGPAMAARVRDRLS 66

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY ++++   +   ++E I K L P+++P   +   RP VILV+GVNG GKTT I KL
Sbjct: 67  EGRYNRELTEDYLREIIAEEIEKTLAPVARPLEIEAFPRPQVILVIGVNGSGKTTTIAKL 126

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +    +    VMLAAGDTFR+AAI QLK+WADR     V  + G DAA + ++A KQA A
Sbjct: 127 ANNFLEQDYGVMLAAGDTFRAAAIGQLKVWADRLGIPIVAGKEGGDAAGIVFDAVKQATA 186

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
             +DVLI+DTAGRL N + LM  + K+ RVL RL+P APH V+ VLDATTGQNAL Q+E+
Sbjct: 187 TGIDVLIVDTAGRLQNKTELMDELAKIRRVLGRLNPAAPHDVVLVLDATTGQNALSQIEV 246

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VA  TGL+MTK+DGTARGG L+     +++P++ +GVGE I DL PF   D +  I 
Sbjct: 247 FKEVAQVTGLVMTKLDGTARGGVLVAAAEKYRLPIHAIGVGEKIEDLRPFDPGDMARAIA 306

Query: 312 GC 313
           G 
Sbjct: 307 GT 308


>gi|16127909|ref|NP_422473.1| signal recognition particle-docking protein FtsY [Caulobacter
           crescentus CB15]
 gi|221236729|ref|YP_002519166.1| cell division protein FtsY [Caulobacter crescentus NA1000]
 gi|13425439|gb|AAK25641.1| signal recognition particle-docking protein FtsY [Caulobacter
           crescentus CB15]
 gi|220965902|gb|ACL97258.1| cell division protein ftsY [Caulobacter crescentus NA1000]
          Length = 313

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 200/303 (66%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++LT G   +S  + E +T + + + LD    + LE++LI +D+G  +A +I E    
Sbjct: 11  WFQRLTSGLTRSSQAMTEQVTGVFTKKALDQEQLDALEEMLIEADLGPQIAARITEAFGK 70

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K  +   V   ++ELI   L      F+     RP+V+L +GVNG GKTT +GK++
Sbjct: 71  ARFGKSSTDDEVKEALAELIAAELADRQGDFDPLNGPRPYVVLFIGVNGSGKTTTLGKIA 130

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             +++ G +V++AAGDTFR+AA++QLK+WADR  ADF+    GSDAAALAYEA ++A+A+
Sbjct: 131 ADLTEKGARVLIAAGDTFRAAAVEQLKVWADRAGADFMSKPTGSDAAALAYEAVERAKAE 190

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DV++IDTAGRL N   LM  + K+IRV+K++DP  PH  L VLDAT G+NAL Q ++F
Sbjct: 191 HYDVVLIDTAGRLQNKQGLMDELLKVIRVVKKVDPDYPHETLLVLDATVGRNALAQEKIF 250

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
            +  G +G++MTK+DGTARGG L+P+      P+  +GVGEG+ DL+PF A+ FS  + G
Sbjct: 251 GSQVGVSGIVMTKLDGTARGGVLVPVARASDSPIKLIGVGEGVEDLQPFDARAFSRSLVG 310

Query: 313 CLD 315
             D
Sbjct: 311 LKD 313


>gi|330993224|ref|ZP_08317160.1| Cell division protein ftsY-like protein [Gluconacetobacter sp.
           SXCC-1]
 gi|329759626|gb|EGG76134.1| Cell division protein ftsY-like protein [Gluconacetobacter sp.
           SXCC-1]
          Length = 334

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 212/303 (69%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L +  +L  G + ++ KL  GIT + + R+LDD   EELEDLLI +D+G +VA+K+++ 
Sbjct: 2   ALGFFSRLKAGLSRSTQKLSGGITAVFTRRKLDDEALEELEDLLISADLGPSVAEKVIDS 61

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
               ++ K+V+ + V   ++E I  +L P++ PF  D  H+PHV+LVVGVNG GKTT IG
Sbjct: 62  FRRAKFGKEVTDEEVRAALAEEIANILQPVAIPFEPDPKHKPHVVLVVGVNGTGKTTTIG 121

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K+++   + G KVM+ AGDTFR+AA++QL++W +RT A  +     +DAA LA+EA K+A
Sbjct: 122 KMARFYGEQGKKVMMVAGDTFRAAAVEQLQVWGERTGAPVIAGRPNADAAGLAFEALKRA 181

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
            A++ D+L++DTAGRLHN S LM  + K+IRV+++ D  APHSVL VLDATTGQNA+ QV
Sbjct: 182 TAEQADLLLVDTAGRLHNKSALMEELAKIIRVMRKFDETAPHSVLLVLDATTGQNAVEQV 241

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
            +F  +   TGL++TK+DG+ARGG ++ +     +PV+ +GVGE  +DL PF A+ F+  
Sbjct: 242 RVFKELVNVTGLVVTKLDGSARGGIVVALADAFGLPVHLVGVGEQADDLRPFSAEAFARG 301

Query: 310 ITG 312
           + G
Sbjct: 302 LVG 304


>gi|294012738|ref|YP_003546198.1| signal recognition particle GTPase [Sphingobium japonicum UT26S]
 gi|292676068|dbj|BAI97586.1| signal recognition particle GTPase [Sphingobium japonicum UT26S]
          Length = 310

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 144/302 (47%), Positives = 196/302 (64%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +L  G   TS KL E +T + +   LD+   +E+E+ LI SD+G A+A ++ + L 
Sbjct: 5   SWRDRLFGGLKRTSDKLGENLTGLFTKAALDEQTLDEIEEALIVSDLGPAMAARVRDRLS 64

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             RY ++++   +   ++E I K L P+++P   +   RP VILV+GVNG GKTT I KL
Sbjct: 65  EGRYNRELTEDYLREIIAEEIEKTLAPVARPLEIEAFPRPQVILVIGVNGSGKTTTIAKL 124

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +    +    VMLAAGDTFR+AAI QLK+WADR     V  + G DAA + ++A KQA A
Sbjct: 125 ANLFLEQDYGVMLAAGDTFRAAAIGQLKVWADRLGIPIVAGKEGGDAAGIVFDAVKQATA 184

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
             +DVLI+DTAGRL N + LM  + K+ RVL RL+P APH V+ VLDATTGQNAL Q+E+
Sbjct: 185 TGIDVLIVDTAGRLQNKTELMDELAKIRRVLGRLNPAAPHDVVLVLDATTGQNALSQIEV 244

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VA  TGL+MTK+DGTARGG L+     +++P++ +GVGE I DL PF   D +  I 
Sbjct: 245 FKEVAQVTGLVMTKLDGTARGGVLVAAAEKYRLPIHAIGVGEKIEDLRPFDPGDMARAIA 304

Query: 312 GC 313
           G 
Sbjct: 305 GT 306


>gi|7230353|gb|AAF42961.1|AF090335_1 FtsY [Caulobacter vibrioides]
          Length = 313

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 199/303 (65%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++LT G   +S  + E +T + + + LD    + LE++LI +D+G  +A +I E    
Sbjct: 11  WFQRLTSGLTRSSQAMTEQVTGVFTKKALDQEQLDALEEMLIEADLGPQIAARITEAFGK 70

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K  +   V   ++ELI   L      F+     RP+V+L +GVNG GKTT +GK++
Sbjct: 71  ARFGKSSTDDEVKEALAELIAAELADRQGDFDPLNGPRPYVVLFIGVNGSGKTTTLGKIA 130

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             +++ G +V++AAGDTFR+AA++QLK+WADR  ADF+    GSDAAALAYEA ++A+A+
Sbjct: 131 ADLTEKGARVLIAAGDTFRAAAVEQLKVWADRAGADFMSKPTGSDAAALAYEAVERAKAE 190

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DV++IDTAGRL N   LM  + K IRV+K++DP  PH  L VLDAT G+NAL Q ++F
Sbjct: 191 HYDVVLIDTAGRLQNKQGLMDELLKGIRVVKKVDPDYPHETLLVLDATVGRNALAQEKIF 250

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
            +  G +G++MTK+DGTARGG L+P+      P+  +GVGEG+ DL+PF A+ FS  + G
Sbjct: 251 GSQVGVSGIVMTKLDGTARGGVLVPVARASDSPIKLIGVGEGVEDLQPFDARAFSRSLVG 310

Query: 313 CLD 315
             D
Sbjct: 311 LKD 313


>gi|304320389|ref|YP_003854032.1| FtsY, signal recognition particle-docking protein [Parvularcula
           bermudensis HTCC2503]
 gi|303299291|gb|ADM08890.1| FtsY, signal recognition particle-docking protein [Parvularcula
           bermudensis HTCC2503]
          Length = 459

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 191/289 (66%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L  G A TS KL  GI  I + +RLDD   EELEDLLI +DIGV    +I+ +L  
Sbjct: 157 FFGRLRSGLAKTSAKLSGGIGTIFTKKRLDDDTLEELEDLLIMADIGVPTTTRIITQLAK 216

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            ++ ++VS + +   +S  I   L PL      D +H PHVIL+ GVNG GKTT IGKL+
Sbjct: 217 DKFDQEVSGEDIRAILSREIETTLAPLEAQLAPDGTHGPHVILMTGVNGAGKTTTIGKLA 276

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
           ++ +  G  V+LAA DTFR+AAI+QL +W +R     +  E G+D AALAY+A  +AQA+
Sbjct: 277 QQFTAEGKSVLLAACDTFRAAAIEQLTVWGERVGVPVISREQGADPAALAYDAVAKAQAE 336

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
            +D+++IDTAGRL N   LM  +GK++RV+K+LD  APH  + VLDAT GQNAL Q E F
Sbjct: 337 GIDIVLIDTAGRLQNRRELMDELGKIVRVVKKLDDSAPHDAVLVLDATVGQNALSQTEAF 396

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
              A  TGLIMTK+DGTARGG L+ +     +P++ +GVGE + DL+PF
Sbjct: 397 LETAKITGLIMTKLDGTARGGVLVALGDKFGLPIHAIGVGETVEDLQPF 445


>gi|295691524|ref|YP_003595217.1| signal recognition particle-docking protein FtsY [Caulobacter
           segnis ATCC 21756]
 gi|295433427|gb|ADG12599.1| signal recognition particle-docking protein FtsY [Caulobacter
           segnis ATCC 21756]
          Length = 313

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 198/303 (65%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++LT G   TS  + E +T + + + LD    + LE++LI +D+G  +A +I +    
Sbjct: 11  WFQRLTSGLTRTSQAMTEQVTGVFTKKPLDQEQLDALEEMLIEADLGPEIAARITDAFGK 70

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K  +   V   ++ELI   L      F+     RP+V+L +GVNG GKTT +GK++
Sbjct: 71  ARFGKSSTDDEVKEALAELIAAELADRQGDFDPLSGPRPYVVLFIGVNGSGKTTTLGKIA 130

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             +++ G +V++AAGDTFR+AA++QLK+WADR  ADF+    GSDAA LAYEA ++A+A+
Sbjct: 131 ADLTEKGARVLIAAGDTFRAAAVEQLKVWADRAGADFMSKPTGSDAAGLAYEAVERAKAE 190

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DV++IDTAGRL N   LM  + K+IRV+K++DP  PH  L VLDAT G+NAL Q ++F
Sbjct: 191 HYDVVLIDTAGRLQNKQGLMDELLKVIRVVKKVDPDYPHETLLVLDATVGRNALAQEKIF 250

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
               G +G++MTK+DGTARGG L+P+      P+  +GVGEG+ DL+PF A+ FS  + G
Sbjct: 251 GNQVGVSGIVMTKLDGTARGGVLVPVARASDSPIKLIGVGEGVEDLQPFDARAFSRSLVG 310

Query: 313 CLD 315
             D
Sbjct: 311 LKD 313


>gi|114799634|ref|YP_762197.1| signal recognition particle-docking protein FtsY [Hyphomonas
           neptunium ATCC 15444]
 gi|114739808|gb|ABI77933.1| signal recognition particle-docking protein FtsY [Hyphomonas
           neptunium ATCC 15444]
          Length = 414

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 204/298 (68%), Gaps = 1/298 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G A ++ KL EG+   +  R+LDD   EEL+DLLI SD+G  VA ++ + +   R+
Sbjct: 115 RLGEGLARSTAKLTEGLA-ALGRRKLDDATLEELQDLLITSDMGTRVAMRVTKGIAKGRF 173

Query: 76  AKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKM 135
            K++S + +   ++E I ++L P  +  ++    RP ++L VGVNG GKTT IGK++ K+
Sbjct: 174 DKEISGEEIRLALAEEIEEILKPREQVVDFSDGPRPRIVLFVGVNGSGKTTTIGKIASKL 233

Query: 136 SDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVD 195
            + G K +L AGDTFR+AA++QLK+W +R     +    G+DAA L Y A ++A+A+ +D
Sbjct: 234 QEQGAKALLVAGDTFRAAAVEQLKVWGERAGIPVMAGAHGADAAGLVYGAVERAKAEDLD 293

Query: 196 VLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV 255
           ++++DTAGRL N + LM+ +GK++RV+K++DP APH V+ VLDAT GQNAL QVE F   
Sbjct: 294 LVLVDTAGRLQNKAELMSELGKIVRVMKKIDPDAPHDVILVLDATVGQNALSQVEAFRHT 353

Query: 256 AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           AG TGL+MTK+DGTA+GG L+ I   H +P++F+G+GE   DL PF A+ F+  + G 
Sbjct: 354 AGVTGLVMTKLDGTAKGGVLVAIAEAHDLPIHFIGIGERAEDLRPFSAEAFAKALVGI 411


>gi|296532246|ref|ZP_06894991.1| cell division protein FtsY [Roseomonas cervicalis ATCC 49957]
 gi|296267431|gb|EFH13311.1| cell division protein FtsY [Roseomonas cervicalis ATCC 49957]
          Length = 328

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 207/301 (68%), Gaps = 1/301 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L  G + ++ +L +G+T + + R+LD+   EELE+ LI +D+GVA +Q+IVE    
Sbjct: 26  FFARLKAGLSRSTARLTDGLTGLFTRRKLDEAALEELEEALITADLGVAASQRIVERFRK 85

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K+VS   V   ++E I  +L P++KP   D + RPHV+LVVGVNG GKTT I KL 
Sbjct: 86  TRFGKEVSDTEVKEALAEEIAAILAPVAKPLEIDAAKRPHVVLVVGVNGTGKTTTIAKLG 145

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSEIGSDAAALAYEAFKQAQA 191
           ++  + G KV   AGDTFR+AA++QL+IW +RT A     ++ G+DAA LA++A K AQA
Sbjct: 146 QQFGEQGKKVAFVAGDTFRAAAVEQLQIWGNRTGAQVHAPAKQGADAAGLAFDALKAAQA 205

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              ++L++DTAGRLHN   LM  + K++RV++R+DP APHSVL VLDATTGQNA +Q ++
Sbjct: 206 DGTEILLVDTAGRLHNKGALMEELRKVVRVMQRVDPTAPHSVLLVLDATTGQNATQQCKV 265

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  +   TGL++TK+DG+A+GG ++ +     +PV+ +GVGE   DL PF A+D++  + 
Sbjct: 266 FAEMVNVTGLVVTKLDGSAKGGIVVALAQEFGLPVHAVGVGEKAADLRPFSARDYARSLL 325

Query: 312 G 312
           G
Sbjct: 326 G 326


>gi|85373608|ref|YP_457670.1| signal recognition particle GTPase [Erythrobacter litoralis
           HTCC2594]
 gi|84786691|gb|ABC62873.1| signal recognition particle GTPase [Erythrobacter litoralis
           HTCC2594]
          Length = 304

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 193/303 (63%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +SW  +L  GF  TS +L E +T  +S+  LDD   EE+ED LI SD+G A A +I E+L
Sbjct: 1   MSWTERLFGGFKKTSDRLSENLTTAVSTATLDDATLEEVEDALIMSDLGPAAASRIREKL 60

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
             KR+   +S + +   V++ I ++L P++KP       RP VILV+GVNG GKTT I K
Sbjct: 61  KEKRFGLQISERELKKAVADEIAEILRPVAKPLEITAFPRPQVILVIGVNGSGKTTTIAK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+  + +   +VMLAAGDTFR+AAI+QL  WADR     V    G D A++ ++  K   
Sbjct: 121 LAHWLVEEDYEVMLAAGDTFRAAAIEQLATWADRVGVPIVKGPQGGDPASIVFDGVKAGT 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
            +  D L++DTAGRL N   LM  + K+ +VL RL+P APH V+ VLDAT GQNAL Q++
Sbjct: 181 DRGTDALVVDTAGRLQNKRELMDELAKIRKVLGRLNPEAPHDVILVLDATNGQNALSQID 240

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           +F  VAG TGLIMTK+DGTARGG L+     + +P++ +GVGE I+DL PF     + VI
Sbjct: 241 VFKEVAGVTGLIMTKLDGTARGGVLVAAAEQYGLPIHAIGVGETIDDLRPFDPDLVAKVI 300

Query: 311 TGC 313
            G 
Sbjct: 301 AGI 303


>gi|56459337|ref|YP_154618.1| Signal recognition particle GTPase [Idiomarina loihiensis L2TR]
 gi|56178347|gb|AAV81069.1| Signal recognition particle GTPase [Idiomarina loihiensis L2TR]
          Length = 449

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 196/299 (65%), Gaps = 2/299 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W R LT+G   TS  +  G+  +   +++DD + EELE  L+ +D+GVA   KI++ L  
Sbjct: 138 WAR-LTQGLRRTSGSIGSGLIGVFRGKKIDDDLFEELETQLLMADLGVATTTKIIDNLTK 196

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  E + ++L P+ K      S  P+VIL+ GVNGVGKTT IGKL
Sbjct: 197 QADRKQLKDAEALYELLQEQLAEILKPVDKRLEIPESDSPYVILMTGVNGVGKTTTIGKL 256

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+A
Sbjct: 257 AKQFKAEGKSVMLAAGDTFRAAAVEQLQVWGERNDIPVIAQHTGADSASVLYDALQAAKA 316

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N + LM  + K++RV+K+LDP APH V+  LDA TGQNA+ Q ++
Sbjct: 317 RDVDVLIADTAGRLQNKANLMEELKKLVRVMKKLDPEAPHEVMLTLDAGTGQNAISQAKL 376

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           F    G +G++MTK+DGTA+GG +  +     IP+ ++GVGE + DL PFVAKDF A +
Sbjct: 377 FTEAVGVSGIVMTKLDGTAKGGVIFAVADQFAIPIRYIGVGESLEDLRPFVAKDFIAAL 435


>gi|148555838|ref|YP_001263420.1| signal recognition particle-docking protein FtsY [Sphingomonas
           wittichii RW1]
 gi|148501028|gb|ABQ69282.1| signal recognition particle-docking protein FtsY [Sphingomonas
           wittichii RW1]
          Length = 311

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 193/306 (63%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W  KL  GF  TS +L E +T +     LD+   +E+E+ LI SD+G A A +I   L  
Sbjct: 6   WHEKLFGGFRKTSDRLGENLTGLFGKAALDEATLDEIEEALIASDLGPATAGRIRARLKG 65

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
           + + K +  + +   V++ I K+L P++KP   +   RP VILV+GVNG GKTT I KL+
Sbjct: 66  EMFEKGLDERALREIVAQEIEKVLAPVAKPLEIEAFPRPQVILVIGVNGSGKTTTIAKLA 125

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             + +    VML AGDTFR+AAI QLK+WADR     +  + G DAA L +E  KQ   K
Sbjct: 126 HMLQEQDYAVMLVAGDTFRAAAIGQLKVWADRIGVPIISGKEGGDAAGLVFEGVKQGTEK 185

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
            +DVLI+DTAGRL N + LM  + K+ RVL RL+  APH VL VLDATTGQNAL Q+E+F
Sbjct: 186 GIDVLIVDTAGRLQNKAGLMDELAKIRRVLGRLNTAAPHDVLLVLDATTGQNALSQIEIF 245

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              AG TGLIMTK+DGTARGG L+       +PV+ +G+GEG++DL+PF   + +  I G
Sbjct: 246 KETAGVTGLIMTKLDGTARGGVLVAAAERTGMPVHAIGLGEGVDDLKPFDPAEVARAIAG 305

Query: 313 CLDYGE 318
               G+
Sbjct: 306 LERIGK 311


>gi|94495524|ref|ZP_01302104.1| signal recognition particle-docking protein FtsY [Sphingomonas sp.
           SKA58]
 gi|94424912|gb|EAT09933.1| signal recognition particle-docking protein FtsY [Sphingomonas sp.
           SKA58]
          Length = 310

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 195/302 (64%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +W  +L  G   TS +L + +T + +   LDD   +E+E+ LI SD+G A+A ++ + L 
Sbjct: 5   NWRDRLFGGLKRTSDRLGDNLTGLFTKAALDDQTLDEIEEALIVSDLGPAMAARVRDRLA 64

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             R+ K+++ + +   ++E I K L P+++P   +   RP VILV+GVNG GKTT I KL
Sbjct: 65  EGRFNKELTEEYLREIIAEEIEKTLAPVARPLEIEAFPRPQVILVIGVNGSGKTTTIAKL 124

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +    +    VMLAAGDTFR+AAI QLK+WA+R     +  + G DAA + ++A KQA A
Sbjct: 125 AHNFLEQDYGVMLAAGDTFRAAAIGQLKVWAERLGIPIIAGKEGGDAAGIVFDAVKQATA 184

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
             +DVLI+DTAGRL N + LM  + K+ RVL RL+P APH V+ VLDATTGQNAL Q+E+
Sbjct: 185 TGIDVLIVDTAGRLQNKTELMDELAKVRRVLGRLNPAAPHDVVLVLDATTGQNALNQIEV 244

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   A  TGL+MTK+DGTARGG L+      ++P++ +GVGE I DL PF   D +  I 
Sbjct: 245 FKETAQVTGLVMTKLDGTARGGVLVAAAEKFRLPIHAIGVGEKIEDLRPFDPGDMAKAIA 304

Query: 312 GC 313
           G 
Sbjct: 305 GT 306


>gi|254441406|ref|ZP_05054899.1| signal recognition particle-docking protein FtsY, putative
           [Octadecabacter antarcticus 307]
 gi|198251484|gb|EDY75799.1| signal recognition particle-docking protein FtsY, putative
           [Octadecabacter antarcticus 307]
          Length = 550

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 133/285 (46%), Positives = 193/285 (67%), Gaps = 1/285 (0%)

Query: 28  LKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYD 87
           L  G    +  R LDD + E LE+LLI +D+GV  A ++   +   R+ K +S Q +   
Sbjct: 264 LGRGEKKTVVRRELDDDMLERLEELLISADMGVDTALRVTSNMAEGRFGKRLSTQEIKEL 323

Query: 88  VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAG 147
           ++  I +++ P+++P    +  +P V+LVVGVNG GKTT IGKL+ +   AG KV++AAG
Sbjct: 324 LAAEITRVMEPVARPLPL-YPTKPQVVLVVGVNGSGKTTTIGKLASQFQAAGKKVVIAAG 382

Query: 148 DTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHN 207
           DTFR+AA++QL++W DR     + +  GSD A+LAY+A +QA     D+L+IDTAGRL N
Sbjct: 383 DTFRAAAVEQLQVWGDRAGVPVLTAPQGSDPASLAYDAMEQAARDGADLLMIDTAGRLQN 442

Query: 208 NSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMD 267
            + LM  + K++RV+++ DP APH+ L VLDATTGQNAL QV+ F  +A  TGLIMTK+D
Sbjct: 443 RADLMEELQKIVRVIRKKDPDAPHNTLLVLDATTGQNALSQVKTFQELADVTGLIMTKLD 502

Query: 268 GTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
           GTA+GG L+ +     +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 503 GTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEDFAAALTG 547


>gi|114763008|ref|ZP_01442438.1| Signal recognition particle-docking protein FtsY [Pelagibaca
           bermudensis HTCC2601]
 gi|114544332|gb|EAU47340.1| Signal recognition particle-docking protein FtsY [Roseovarius sp.
           HTCC2601]
          Length = 462

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 133/284 (46%), Positives = 195/284 (68%), Gaps = 1/284 (0%)

Query: 29  KEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV 88
           +E  +  +  R LDD + E LE+LLI SD+GV  A ++   +   RY K VS Q +   +
Sbjct: 176 RETPSAPVVRRVLDDDMLESLEELLIASDMGVDTALRVSANIAEGRYGKRVSTQEIKAAL 235

Query: 89  SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148
           +  + +++ P++KP    +  +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGD
Sbjct: 236 AAEVARVMDPVAKPLPL-YPKKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGD 294

Query: 149 TFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNN 208
           TFR+AA++QL++W DR     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N 
Sbjct: 295 TFRAAAVEQLQVWGDRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNR 354

Query: 209 SILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDG 268
             LM  + K++RV+++ DP APH+ L VLDATTGQNAL QVE+F  VA  +GL+MTK+DG
Sbjct: 355 QDLMEELAKIVRVIRKKDPDAPHNTLLVLDATTGQNALTQVEIFRQVADVSGLVMTKLDG 414

Query: 269 TARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
           TA+GG L+ +     +P++ +GVGE I+DL PF  ++F+A +TG
Sbjct: 415 TAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTG 458


>gi|260433210|ref|ZP_05787181.1| signal recognition particle-docking protein FtsY [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417038|gb|EEX10297.1| signal recognition particle-docking protein FtsY [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 383

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 193/275 (70%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI SD+GV  A ++   +   RY + +S Q +   +++ I +++ P
Sbjct: 107 RTLDDDMLEQLEELLIASDMGVDTALRVTANMAEGRYGRKLSTQEIKQLLAQEIARVMEP 166

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    +  RP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 167 VAKPMPL-YPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQL 225

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQA   D+L+IDTAGRL N + LM  + K+
Sbjct: 226 QVWGDRAGVPVLTAPEGSDPASLAFDALTKAQADGADLLMIDTAGRLQNRADLMEELAKI 285

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV++++D  APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 286 VRVIRKIDETAPHNTLLVLDATTGQNALSQVETFRKLADVSGLVMTKLDGTAKGGVLVAL 345

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 346 ADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGL 380


>gi|288957724|ref|YP_003448065.1| signal recognition particle receptor [Azospirillum sp. B510]
 gi|288910032|dbj|BAI71521.1| signal recognition particle receptor [Azospirillum sp. B510]
          Length = 402

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 208/300 (69%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W  KL +G + +S KL +GIT I + R+LDD   EELE+LLI +D+G A A K+  EL  
Sbjct: 99  WFAKLKEGLSKSSSKLTDGITSIFTKRKLDDDALEELEELLITADLGPATAAKVTAELAR 158

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K+VS   V   ++  + K++ P+++P   D + +PHV+LVVGVNG GKTT IGKL+
Sbjct: 159 TRFGKEVSPDEVKATLAAEVSKIVSPVARPLVLDPALKPHVVLVVGVNGTGKTTTIGKLA 218

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
           ++    G  VMLAAGDTFR+AA+ QLKIW +RT    V  + G+DAA LAY+A ++A+A+
Sbjct: 219 RQFKAEGRSVMLAAGDTFRAAAVSQLKIWGERTGCPVVARDTGADAAGLAYDALERARAE 278

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
            VDVL+IDTAGRL N + LM  + K++RV+K+LD  APH+ L  LDATTGQNA  QVE+F
Sbjct: 279 GVDVLLIDTAGRLQNKTGLMEELRKIVRVIKKLDETAPHTTLLTLDATTGQNAHSQVEIF 338

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             +    GLI+TK+DG+ARGG L+ +    +IPV+ +GVGEG+ DL PF A  F+  + G
Sbjct: 339 RDMVNVNGLILTKLDGSARGGVLVSLAEKFRIPVHAIGVGEGVYDLRPFDADAFAKSLMG 398


>gi|254450341|ref|ZP_05063778.1| signal recognition particle-docking protein FtsY [Octadecabacter
           antarcticus 238]
 gi|198264747|gb|EDY89017.1| signal recognition particle-docking protein FtsY [Octadecabacter
           antarcticus 238]
          Length = 409

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 193/285 (67%), Gaps = 1/285 (0%)

Query: 28  LKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYD 87
           L  G    +  R LDD + E LE+LLI +D+GV  A ++   +   R+ K +S Q +   
Sbjct: 123 LGRGDAKTVVRRELDDDMLERLEELLISADMGVDTALRVTSNMAEGRFGKRLSTQEIKEL 182

Query: 88  VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAG 147
           ++  I +++ P+++P    +  +P V+LVVGVNG GKTT IGKL+ +   AG KV++AAG
Sbjct: 183 LAAEITRIMEPVARPMPL-YPTKPQVVLVVGVNGSGKTTTIGKLASQFQAAGKKVVIAAG 241

Query: 148 DTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHN 207
           DTFR+AA++QL++W DR     + +  GSD A+LA++A +QA     D+L+IDTAGRL N
Sbjct: 242 DTFRAAAVEQLQVWGDRAGVPVLTAPEGSDPASLAFDAMEQAACDGADLLMIDTAGRLQN 301

Query: 208 NSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMD 267
            + LM  + K++RV+++ DP APH+ L VLDATTGQNAL QV+ F  +A  TGLIMTK+D
Sbjct: 302 RADLMEELQKIVRVIRKKDPDAPHNTLLVLDATTGQNALSQVKTFQELADVTGLIMTKLD 361

Query: 268 GTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
           GTA+GG L+ +     +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 362 GTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEDFAAALTG 406


>gi|114328162|ref|YP_745319.1| cell division protein ftsY [Granulibacter bethesdensis CGDNIH1]
 gi|114316336|gb|ABI62396.1| cell division protein ftsY [Granulibacter bethesdensis CGDNIH1]
          Length = 306

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 139/305 (45%), Positives = 209/305 (68%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L +  KL +G A ++ KL   +T +IS RRLDD   EELE+ LI +D+G +VA +++E 
Sbjct: 2   ALGFFSKLKEGLARSTQKLTTNLTSVISHRRLDDAALEELEEALIAADLGTSVAARVIEA 61

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
               R+ ++V+ + +   ++E I ++L P++ P   D + +PHVIL+VGVNG GKTT IG
Sbjct: 62  FRRTRFGREVTEEEIKTALAEEIARILHPVAIPLEPDLTRKPHVILMVGVNGTGKTTTIG 121

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL++   D GL+ +L AGDTFR+AA++QL++W +R  A  +    G+DAA LA++A  +A
Sbjct: 122 KLAQSWKDQGLRSILVAGDTFRAAAVEQLQVWGERVGAPVISGPAGADAAGLAFDALAKA 181

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           QA++ D+L+IDTAGRLHN   LM  + K+IRV+++ D   PHS+L VLDATTGQNA+ QV
Sbjct: 182 QAEQADILLIDTAGRLHNKGALMEELSKIIRVMRKHDETVPHSILLVLDATTGQNAVEQV 241

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
            +F  +   TGLI+TK+DG+ARGG ++ +     +PV+ +GVGE   DL PF A +F+  
Sbjct: 242 RVFKDMVNITGLIVTKLDGSARGGIVVALAEDFGLPVHAVGVGEKAGDLRPFDAMEFARG 301

Query: 310 ITGCL 314
           + G +
Sbjct: 302 LVGAV 306


>gi|332185721|ref|ZP_08387468.1| signal recognition particle-docking protein FtsY [Sphingomonas sp.
           S17]
 gi|332014079|gb|EGI56137.1| signal recognition particle-docking protein FtsY [Sphingomonas sp.
           S17]
          Length = 311

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 190/306 (62%), Gaps = 1/306 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           S S SW  KL  GF  TS +L   +  +  + RLD+   +E+E+ LI SD+G   A  I 
Sbjct: 2   SSSPSWHEKLLGGFRRTSDRLVGNLAGL-GTARLDEDTLDEIEEALIASDLGPETAGHIR 60

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
             L    + +++    +   V+E + K L  ++ P   D   RP VILV+GVNG GKTT 
Sbjct: 61  TRLSEGSFERNMEDLGIRLVVAEEVEKALAKVATPLEIDAFPRPQVILVIGVNGSGKTTT 120

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           I KL+    +    VMLAAGDTFR+AAI QL  WA+R     V  + G DAA + YEA K
Sbjct: 121 IAKLAHLFMEQDYGVMLAAGDTFRAAAIGQLATWAERVGVPIVSGKEGGDAAGIVYEAVK 180

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           QA A  VDVLI+DTAGRL N   LM  + K+ RVL RL+P APH +L VLDATTGQNAL 
Sbjct: 181 QATATGVDVLIVDTAGRLQNKRELMDELSKIRRVLGRLNPEAPHDILLVLDATTGQNALN 240

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           Q+E+F  VAG TGL+MTK+DGTARGG L+     + +P++ +GVGEG+ DL PF A + S
Sbjct: 241 QIEVFKDVAGVTGLVMTKLDGTARGGVLVAAAEKYGLPIHAIGVGEGMTDLRPFDANEVS 300

Query: 308 AVITGC 313
            +I G 
Sbjct: 301 RIIAGI 306


>gi|87199421|ref|YP_496678.1| signal recognition particle-docking protein FtsY [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135102|gb|ABD25844.1| signal recognition particle-docking protein FtsY [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 308

 Score =  268 bits (685), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 145/303 (47%), Positives = 188/303 (62%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  ++  GF  TS +L E +  I+ S RL +   ++LED LI SD+G   A +I E L 
Sbjct: 5   SWSDRILGGFRKTSERLAENLGGIVGSSRLTEAQLDDLEDALILSDLGPRAAARIRERLK 64

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             R+   V  Q +   V+E I  +L P++KP       RP VILV+GVNG GKTT I KL
Sbjct: 65  GARFENGVDEQGLKEAVAEEIAAILRPVAKPLEIVAFPRPQVILVIGVNGSGKTTTIAKL 124

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +    +    VMLAAGDTFR+AAI QLK+WADR     V    G D A++ ++A K A  
Sbjct: 125 AHLFQEQDYGVMLAAGDTFRAAAIGQLKVWADRLGVPIVTGPEGGDPASIVFDAVKAATD 184

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
             +D LI+DTAGRL N   LM  + K+ RVL RL+P APH V+ VLDAT GQNAL+Q+E+
Sbjct: 185 TGIDTLIVDTAGRLQNKRELMDELAKVRRVLGRLNPAAPHDVVLVLDATNGQNALQQIEI 244

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG TGLIMTK+DGTARGG L+     + +P++ +GVGE I+DL PF     + VI 
Sbjct: 245 FKEVAGVTGLIMTKLDGTARGGVLVAAAEQYGLPIHAIGVGEKIDDLRPFDPDLVAKVIA 304

Query: 312 GCL 314
           G  
Sbjct: 305 GVF 307


>gi|89053705|ref|YP_509156.1| signal recognition particle-docking protein FtsY [Jannaschia sp.
           CCS1]
 gi|88863254|gb|ABD54131.1| signal recognition particle-docking protein FtsY [Jannaschia sp.
           CCS1]
          Length = 381

 Score =  268 bits (685), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 192/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI SD+GV +A ++   +   RY K +S   +   ++  I +++ P
Sbjct: 105 RALDDDMLEQLEELLIASDMGVDIALRVTANMAEGRYGKMLSATEIKELLASEITRVMEP 164

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +   P V+LVVGVNG GKTT IGKLS +   AG KV++AAGDTFR+AA++QL
Sbjct: 165 VARPLPI-YPKTPQVVLVVGVNGSGKTTTIGKLSSQFRAAGKKVVIAAGDTFRAAAVEQL 223

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD AALAY+A  +A+A   D+L+IDTAGRL N + LM  + K+
Sbjct: 224 QVWGDRAGVPVLTAPEGSDPAALAYDAMVKAEADGADLLMIDTAGRLQNRADLMEELAKI 283

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNALRQVE+F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 284 VRVIRKKDPDAPHNTLLVLDATTGQNALRQVELFGQMADVSGLVMTKLDGTAKGGVLVAL 343

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL+PF  ++F+  + G 
Sbjct: 344 ADKFGLPIHAIGVGEQIDDLQPFDPEEFADALVGL 378


>gi|162148087|ref|YP_001602548.1| cell division protein ftsY [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542701|ref|YP_002274930.1| signal recognition particle-docking protein FtsY [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786664|emb|CAP56247.1| Cell division protein ftsY [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530378|gb|ACI50315.1| signal recognition particle-docking protein FtsY [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 326

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 204/303 (67%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L +  +L  G + ++ KL  GI  + + R+LDD   EELEDLLI +D+G AVA +I+E 
Sbjct: 2   ALGFFSRLKAGLSRSTQKLGGGIAAVFTRRKLDDEALEELEDLLISADLGPAVAARIIES 61

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
               R+  +V+   V   +S  I ++L P++ PF  D   +PHV+LVVGVNG GKTT IG
Sbjct: 62  FRHSRFGAEVTDDEVRDALSAEIAQVLEPVAVPFVPDPQRKPHVVLVVGVNGTGKTTTIG 121

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K+++   + GLKVM+ AGDTFR+AA++QL++W  R  A  +     +DAA LA+EA K+ 
Sbjct: 122 KMARYYGEQGLKVMMVAGDTFRAAAVEQLQVWGQRVGAPVIAGPPNADAAGLAFEALKRG 181

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           QA+  D+L+IDTAGRLHN   LM  + K+IRV+++ D  APHSVL VLDATTGQNA+ QV
Sbjct: 182 QAEGCDLLLIDTAGRLHNKGALMEELAKIIRVMRKFDESAPHSVLLVLDATTGQNAIEQV 241

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
            +F  +   TGL++TK+DG+ARGG ++ +  T  +PV+ +GVGE   DL PF A+ F+  
Sbjct: 242 RVFKELVNVTGLVVTKLDGSARGGIVVALADTFGLPVHAVGVGEQAEDLRPFSAEAFARG 301

Query: 310 ITG 312
           + G
Sbjct: 302 LVG 304


>gi|71278165|ref|YP_266925.1| signal recognition particle-docking protein FtsY [Colwellia
           psychrerythraea 34H]
 gi|71143905|gb|AAZ24378.1| signal recognition particle-docking protein FtsY [Colwellia
           psychrerythraea 34H]
          Length = 481

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 196/301 (65%), Gaps = 1/301 (0%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           A   L +  +L +G + T   L  G+ D+   +++DD + EELE  L+ +D+GV    KI
Sbjct: 174 AESKLGFFARLKQGLSKTRQNLGGGLIDLFRGKQIDDDLFEELETHLLLADVGVETTMKI 233

Query: 67  VEELLTKRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           +E L      K +     LYD+ ++ + K++  +S+P        P VIL+VGVNGVGKT
Sbjct: 234 IESLTQSANRKQLKDASALYDLLKIELKKVIEDVSQPLVIPEDDGPFVILMVGVNGVGKT 293

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+K+    G  VMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ ++A
Sbjct: 294 TTIGKLAKQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQHTGADSASVIFDA 353

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
              A+A+KVD++I DTAGRL N + LM  + K++RV+K+LD +APH V+  LDA TGQNA
Sbjct: 354 ISAAKARKVDIIIADTAGRLQNKAHLMEELKKVVRVMKKLDVNAPHEVMLTLDAGTGQNA 413

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q ++F    G TGL +TK+DGTA+GG +  +   H IP+ +LGVGEGI+DL PF + D
Sbjct: 414 LSQTKLFDEAVGLTGLTITKLDGTAKGGVIFAVADKHSIPIRYLGVGEGIDDLRPFNSDD 473

Query: 306 F 306
           F
Sbjct: 474 F 474


>gi|56551966|ref|YP_162805.1| signal recognition particle-docking protein FtsY [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241761948|ref|ZP_04760033.1| signal recognition particle-docking protein FtsY [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752487|ref|YP_003225380.1| signal recognition particle-docking protein FtsY [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|56543540|gb|AAV89694.1| signal recognition particle-docking protein FtsY [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241373628|gb|EER63200.1| signal recognition particle-docking protein FtsY [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258551850|gb|ACV74796.1| signal recognition particle-docking protein FtsY [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 310

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 194/305 (63%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           SE   W +K+  G   TS +L E ++ I     LDD   +E+E+ LI  D+G   A +I 
Sbjct: 2   SEETPWYKKIGFGLKRTSERLTENLSSIALKAALDDETLDEIEETLIACDLGPGTAGRIR 61

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           E L  +R+ + V+   V   V++ I K+L P++KP   D   RP VILV+GVNG GKTT 
Sbjct: 62  ERLAGERFPQGVTELEVREVVAQEIAKILKPVAKPIEIDAFPRPQVILVIGVNGSGKTTT 121

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           I KL+    +   +VML AGDTFR+AAI QLK+WA+R     +    G+DAA+L ++  K
Sbjct: 122 IAKLAHWFQELDYEVMLVAGDTFRAAAIGQLKVWAERLEIPIISGAEGADAASLVFQGVK 181

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +  A+  D LI+DTAGRL N S LM  + K+ +VL RL+P APH+V+ VLDAT GQNAL 
Sbjct: 182 EGTAQGTDTLIVDTAGRLQNKSGLMDELAKIKKVLGRLNPAAPHNVILVLDATNGQNALS 241

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           Q+E+F  +AG +GLIMTK+DGTARGG ++     + +P++ +GVGE ++DL PF  +  +
Sbjct: 242 QIEVFKEIAGVSGLIMTKLDGTARGGIMVAAAEKYGLPIHAIGVGESMDDLRPFDPEAVA 301

Query: 308 AVITG 312
             I G
Sbjct: 302 RAIVG 306


>gi|255261414|ref|ZP_05340756.1| cell division protein FtsY [Thalassiobium sp. R2A62]
 gi|255103749|gb|EET46423.1| cell division protein FtsY [Thalassiobium sp. R2A62]
          Length = 574

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 194/286 (67%), Gaps = 1/286 (0%)

Query: 28  LKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYD 87
           L  G    +  R LDD + E LE+LLI +D+GV  A ++   +   R+ K +SV  +   
Sbjct: 288 LGRGEKKTVVRRALDDDMLESLEELLITADMGVHTALRVTANMAEGRFGKKLSVDEIKEL 347

Query: 88  VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAG 147
           ++  + +++ P++KP    ++ +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAG
Sbjct: 348 LASEVTRIMEPVAKPMPL-YAKKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAG 406

Query: 148 DTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHN 207
           DTFR+AA++QL++W DR     + +  GSD A+LA++A  QA+A   D+L+IDTAGRL N
Sbjct: 407 DTFRAAAVEQLQVWGDRAGVPVLTAPEGSDPASLAFDAMTQAEADGADLLMIDTAGRLQN 466

Query: 208 NSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMD 267
            + LM  + K++RV+++ DP APH+ L VLDATTGQNAL QV+ F  +A  +GL+MTK+D
Sbjct: 467 RADLMEELAKIVRVIRKKDPEAPHNTLLVLDATTGQNALSQVKTFQELADVSGLVMTKLD 526

Query: 268 GTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           GTA+GG L+ +     +P++ +GVGE I+DL PF  +DF+A +TG 
Sbjct: 527 GTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEDFAAALTGL 572


>gi|85706875|ref|ZP_01037966.1| signal recognition particle-docking protein FtsY [Roseovarius sp.
           217]
 gi|85668668|gb|EAQ23538.1| signal recognition particle-docking protein FtsY [Roseovarius sp.
           217]
          Length = 397

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/286 (45%), Positives = 195/286 (68%), Gaps = 1/286 (0%)

Query: 28  LKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYD 87
           L  G  ++   R LDD + E LE+LLI +D+GV  A ++   +   R  K +S Q +   
Sbjct: 110 LGRGAGEVAPRRVLDDAMLESLEELLIGADMGVDTALRVTANMAEGRMGKRLSTQEIKEL 169

Query: 88  VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAG 147
           +++ I +++ P+++P    ++ RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAG
Sbjct: 170 LAQEIARIMDPVARPMPI-YAKRPQVVLVVGVNGSGKTTTIGKLAAQFKSAGKSVVIAAG 228

Query: 148 DTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHN 207
           DTFR+AA++QL++W +R     + +  GSD A+LAY+A  +A+A+  D+L+IDTAGRL N
Sbjct: 229 DTFRAAAVEQLQVWGERAGVPVMTAPEGSDPASLAYDAMTRAEAEGADLLMIDTAGRLQN 288

Query: 208 NSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMD 267
            + LM  + K++RV+++ DP APH+ L VLDATTGQNAL QV  F  +A  +GLIMTK+D
Sbjct: 289 RADLMEELAKIVRVIRKKDPSAPHNTLLVLDATTGQNALSQVATFQKLADVSGLIMTKLD 348

Query: 268 GTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           GTARGG L+ +     +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 349 GTARGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPQEFAAALTGL 394


>gi|103488209|ref|YP_617770.1| signal recognition particle-docking protein FtsY [Sphingopyxis
           alaskensis RB2256]
 gi|98978286|gb|ABF54437.1| signal recognition particle-docking protein FtsY [Sphingopyxis
           alaskensis RB2256]
          Length = 308

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 193/303 (63%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +L  GF  TS +L E +  +    RLD+   + +E+ LI +D+G A+A +I + L 
Sbjct: 5   SWSERLLGGFRRTSERLGENLAGLTGKARLDEADLDRIEEALITADLGPAMAARIRDRLA 64

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
            +R       + +   V++ I  +L P+++P + D   RP VILV+GVNG GKTT I KL
Sbjct: 65  ERRDVAANGTEELRQIVADEIAAVLRPVAEPLDIDAFPRPQVILVIGVNGSGKTTTIAKL 124

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +    +    VML AGDTFR+AAI QLKIWA+R     +    G D+A + ++A K+A A
Sbjct: 125 AHLFQEQDYGVMLVAGDTFRAAAIGQLKIWAERLGVPIMAGPEGGDSAGIVFDAVKRATA 184

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
             +DVLI+DTAGRL N   LM  + K+ RVL RL+P APH V+ VLDATTGQNAL Q+++
Sbjct: 185 TGIDVLIVDTAGRLQNKRELMDELAKIKRVLGRLNPAAPHDVVLVLDATTGQNALSQIDV 244

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG TGL+MTK+DGTARGG L+     H +P++ +G+GE + DL PF A + + +I 
Sbjct: 245 FREVAGVTGLVMTKLDGTARGGVLVAAAERHGLPIHAIGIGETMEDLRPFDADEIAGIIA 304

Query: 312 GCL 314
           G +
Sbjct: 305 GNI 307


>gi|331007678|ref|ZP_08330814.1| Signal recognition particle receptor protein FtsY [gamma
           proteobacterium IMCC1989]
 gi|330418521|gb|EGG93051.1| Signal recognition particle receptor protein FtsY [gamma
           proteobacterium IMCC1989]
          Length = 399

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 206/311 (66%), Gaps = 7/311 (2%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDII-SSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           SL++ +++ KG + TS +L EGI  ++   + +DD + EELE  L+ +D+G+    +I++
Sbjct: 77  SLAFFQRIKKGLSRTSSQLVEGIASVVLGKKHIDDELLEELETQLLMADVGIDATTQIID 136

Query: 69  ELLTKRYAKDVSVQRVLY-----DVSELIHKMLMPLS-KPFNWDFSHRPHVILVVGVNGV 122
           +L      K ++    LY      + +L+     P+  +P   D    P V LVVGVNGV
Sbjct: 137 KLTKAVERKQLNDGDSLYAALQQQLRDLLVDTQAPMMIQPQFADGKKMPMVTLVVGVNGV 196

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K++ + G +VMLAAGDTFR+AA++QLKIW DR     V  + G+D+A++ 
Sbjct: 197 GKTTTIGKLTKRLQNEGKQVMLAAGDTFRAAAVEQLKIWGDRNQVAVVSQDTGADSASVI 256

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A   AQAK +DVLI DTAGRLHN S LM  + K+ RV+ +LDP+APH VL VLDA TG
Sbjct: 257 YDALSSAQAKGIDVLIADTAGRLHNKSHLMDELAKVKRVMAKLDPNAPHEVLLVLDAGTG 316

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNAL Q E F   AG TGL++TK+DGTA+GG +  +    K+P+ F+GVGEGI+DL+PFV
Sbjct: 317 QNALSQAEHFIKAAGVTGLVLTKLDGTAKGGIVFALSERFKLPIRFIGVGEGIDDLQPFV 376

Query: 303 AKDFSAVITGC 313
           A DF   + G 
Sbjct: 377 ADDFVRALFGT 387


>gi|254510515|ref|ZP_05122582.1| signal recognition particle-docking protein FtsY [Rhodobacteraceae
           bacterium KLH11]
 gi|221534226|gb|EEE37214.1| signal recognition particle-docking protein FtsY [Rhodobacteraceae
           bacterium KLH11]
          Length = 379

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 200/296 (67%), Gaps = 3/296 (1%)

Query: 18  TKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAK 77
           T+G        +E  T I   R LDD + E+LE+LLI SD+GV  A ++   +   R+ +
Sbjct: 85  TRGLLGKLFNRREDRTAI--RRTLDDDMLEQLEELLIASDMGVDTALRVTANMAEGRFGR 142

Query: 78  DVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD 137
            +S Q +   +++ + +++ P++KP    +  RP V+LVVGVNG GKTT IGKL+ +   
Sbjct: 143 KLSTQEIKALLAQEVARVMDPVAKPMPL-YPKRPQVVLVVGVNGSGKTTTIGKLASQFKA 201

Query: 138 AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVL 197
           AG KV++AAGDTFR+AA++QL++W DR     + +  GSD A+LA++A  +AQ +  D+L
Sbjct: 202 AGKKVVIAAGDTFRAAAVEQLQVWGDRAGVPVLTAPEGSDPASLAFDALTKAQNEGTDLL 261

Query: 198 IIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAG 257
           +IDTAGRL N + LM  + K++RV++++D  APH+ L VLDATTGQNAL QVE F  +A 
Sbjct: 262 MIDTAGRLQNRADLMEELAKIVRVIRKVDDTAPHNTLLVLDATTGQNALSQVETFRKLAD 321

Query: 258 TTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
            +GL+MTK+DGTA+GG L+ +     +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 322 VSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGL 377


>gi|149186850|ref|ZP_01865160.1| signal recognition particle GTPase [Erythrobacter sp. SD-21]
 gi|148829517|gb|EDL47958.1| signal recognition particle GTPase [Erythrobacter sp. SD-21]
          Length = 307

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 190/302 (62%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           SW  +L  GF  TS +L E + + ++  +LDD   +++ED LI SD+G + A +I E L 
Sbjct: 5   SWTERLFGGFKKTSERLSENLAEAVTKAKLDDATLDDVEDALIMSDLGPSAAARIRERLK 64

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
            KR+  ++S   +   V+E I  +L P++KP       RP V+LV+GVNG GKTT I KL
Sbjct: 65  EKRFGLEISADELKEAVAEEIAAILRPVAKPLEITAFPRPQVLLVIGVNGSGKTTTIAKL 124

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +    +    VMLAAGDTFR+AAI QL+ WADR     V    G D A++ ++A ++   
Sbjct: 125 AHLFVEDDYNVMLAAGDTFRAAAIGQLQTWADRVGVPIVRGPEGGDPASIVFDAVRKGTE 184

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
              DVLI+DTAGRL N   LM  + K+ +VL RL+P APH V+ VLDAT GQNAL Q+++
Sbjct: 185 IGTDVLIVDTAGRLQNKRELMDELAKIRKVLGRLNPEAPHDVVLVLDATNGQNALSQIDV 244

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F  VAG TGL+MTK+DGTARGG L+     + +P++ +GVGE I+DL PF     + VI 
Sbjct: 245 FKEVAGVTGLVMTKLDGTARGGVLVQAAKKYGLPIHAIGVGEKIDDLRPFDPDLVARVIA 304

Query: 312 GC 313
           G 
Sbjct: 305 GI 306


>gi|119384655|ref|YP_915711.1| signal recognition particle-docking protein FtsY [Paracoccus
           denitrificans PD1222]
 gi|119374422|gb|ABL70015.1| signal recognition particle-docking protein FtsY [Paracoccus
           denitrificans PD1222]
          Length = 346

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 192/277 (69%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + EELE++LI++D+GV  A ++   +   R  + VS   +   +++ I +++ P
Sbjct: 71  RELDDAMLEELEEMLIQADMGVETALRVTANIAEGRMGRRVSATELKELLADEIARIMTP 130

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    +  RP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 131 VAKPLPL-YPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQL 189

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +A+A+  D+L+IDTAGRL N   LM  + K+
Sbjct: 190 QVWGQRAGVPVMTAPEGSDPASLAFDAMTKAEAEGADLLMIDTAGRLQNRQDLMEELAKI 249

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE+F  +A  +GL+MTK+DGTARGG L+ +
Sbjct: 250 VRVIRKKDPSAPHNTLLVLDATTGQNALSQVEIFRKLADVSGLVMTKLDGTARGGVLVAL 309

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL+ F A+DF+  + G  D
Sbjct: 310 ADRFGLPIHAIGVGEQIDDLDAFDARDFARALVGLGD 346


>gi|197103597|ref|YP_002128974.1| signal recognition particle-docking protein FtsY [Phenylobacterium
           zucineum HLK1]
 gi|196477017|gb|ACG76545.1| signal recognition particle-docking protein FtsY [Phenylobacterium
           zucineum HLK1]
          Length = 314

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/304 (42%), Positives = 199/304 (65%), Gaps = 1/304 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W ++LT+G   +S ++ + I  + +++  LD    +ELE++LI +D+G   A +I     
Sbjct: 8   WFQRLTQGLTKSSKQMGDQIASVFTAKEPLDQAKLDELEEMLIEADLGPHSAARITARFA 67

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
            +++ KDV  + +   +++ I   L      F+     RP+V+L +GVNG GKTT +GK+
Sbjct: 68  EEKFGKDVGEEEIKEALAQAIGDELSSRQGGFDPLSGPRPYVVLFIGVNGSGKTTTLGKI 127

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +  +   G KV++ AGDTFR+AA++QLK+WA+R  ADF+    GSDAA LA++A ++A+A
Sbjct: 128 AADLRSRGAKVLIVAGDTFRAAAVEQLKVWAERAGADFMGRPTGSDAAGLAFDAVQRAKA 187

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DV++IDTAGRL N   LM  + K+IRV+K+LDP APH  L VLDAT G+NAL Q  +
Sbjct: 188 EGYDVVLIDTAGRLQNKQGLMDELLKIIRVVKKLDPEAPHETLLVLDATVGRNALNQENI 247

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F    G +G++MTK+DGTARGG L+P+      P+  +GVGEGI+DL+PF A+ F+  + 
Sbjct: 248 FGNQIGVSGIVMTKLDGTARGGVLVPVAQASDSPIKLIGVGEGIDDLQPFDARAFARSLV 307

Query: 312 GCLD 315
           G  +
Sbjct: 308 GLAE 311


>gi|84500000|ref|ZP_00998266.1| signal recognition particle-docking protein FtsY [Oceanicola
           batsensis HTCC2597]
 gi|84391934|gb|EAQ04202.1| signal recognition particle-docking protein FtsY [Oceanicola
           batsensis HTCC2597]
          Length = 440

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 190/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI SD+GV  A ++   +   R  + +S   +   +++ + +++ P
Sbjct: 161 RALDDDMLEQLEELLIASDMGVDTALRVASNMAEGRMGRRLSTAEIKGLLADEVTRIMEP 220

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    F  +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 221 VARPLPL-FPKKPQVVLVVGVNGSGKTTTIGKLASQFRGAGKSVVIAAGDTFRAAAVEQL 279

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           +IW DR     + +  GSD AALAY+A ++A+A+  D+L+IDTAGRL N + LM  + K+
Sbjct: 280 EIWGDRAGVPVLKAAEGSDPAALAYDALEKAEAEGADLLMIDTAGRLQNRADLMEELAKI 339

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RVL++ DP APH+ L VLDATTGQNAL QVE F  +A  TGL+MTK+DGTA+GG L+ +
Sbjct: 340 VRVLRKRDPSAPHNTLLVLDATTGQNALSQVETFRKMADVTGLVMTKLDGTAKGGVLVAL 399

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF   DF+  +TG 
Sbjct: 400 ADKFGLPIHAIGVGEQIDDLAPFDPGDFARALTGA 434


>gi|163740777|ref|ZP_02148170.1| signal recognition particle-docking protein FtsY [Phaeobacter
           gallaeciensis 2.10]
 gi|161385768|gb|EDQ10144.1| signal recognition particle-docking protein FtsY [Phaeobacter
           gallaeciensis 2.10]
          Length = 415

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 192/274 (70%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LEDLL+ +D+GV  A ++   +   R  K +S + +   ++  + +++ P
Sbjct: 139 RALDDDMLEQLEDLLVGADMGVDTALRVTANMAEGRLGKRLSTREIKELLAAEVARIMEP 198

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    ++ RP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 199 VARPMPI-YAKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQL 257

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ +  D+L+IDTAGRL N + LM  + K+
Sbjct: 258 QVWGDRAGVPVLTAPEGSDPASLAFDAMTRAQEEGADLLMIDTAGRLQNRADLMEELAKI 317

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QV+ F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 318 VRVIQKKDPSAPHNTLLVLDATTGQNALNQVDTFQKLADVSGLVMTKLDGTAKGGVLVAL 377

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 378 ADRFGLPIHAIGVGEQIDDLAPFDPEDFAAALTG 411


>gi|149202012|ref|ZP_01878986.1| signal recognition particle-docking protein FtsY [Roseovarius sp.
           TM1035]
 gi|149145060|gb|EDM33089.1| signal recognition particle-docking protein FtsY [Roseovarius sp.
           TM1035]
          Length = 403

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 191/279 (68%), Gaps = 1/279 (0%)

Query: 34  DIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIH 93
           D    R LDD + E LE+LLI +D+GV  A ++   +   R  K +S Q +   +++ I 
Sbjct: 122 DSAPRRVLDDAMLESLEELLIAADMGVDTALRVTANMAEGRMGKRLSTQEIKELLAQEIA 181

Query: 94  KMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA 153
           +++ P+++P    ++ RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+A
Sbjct: 182 RIMEPVARPMPI-YAKRPQVVLVVGVNGSGKTTTIGKLAAQFKGAGKSVVIAAGDTFRAA 240

Query: 154 AIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMA 213
           A++QL++W  R     + +  GSD A+LA++A  +A+A+  D+L+IDTAGRL N + LM 
Sbjct: 241 AVEQLQVWGQRAGVPVMTAPEGSDPASLAFDAMTRAEAEGADLLMIDTAGRLQNRADLME 300

Query: 214 GIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGG 273
            + K++RV+++ DP APH+ L VLDATTGQNAL QV  F  +A  +GL+MTK+DGTARGG
Sbjct: 301 ELAKIVRVIRKKDPSAPHNTLLVLDATTGQNALSQVATFQKLADVSGLVMTKLDGTARGG 360

Query: 274 GLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
            L+ +     +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 361 VLVALADKFGLPIHAIGVGEQIDDLAPFDPQDFAAALTG 399


>gi|257455444|ref|ZP_05620679.1| cell division protein FtsY [Enhydrobacter aerosaccus SK60]
 gi|257447406|gb|EEV22414.1| cell division protein FtsY [Enhydrobacter aerosaccus SK60]
          Length = 404

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 193/296 (65%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W  ++ +G + +   L EG+T+I I  + +DD + EE+ED L+ +DIGV    +I++ L 
Sbjct: 100 WFSRMKQGLSKSRKNLTEGLTNILIGGKEIDDELLEEVEDQLLVADIGVNATNRIIKNLT 159

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                 D+     LY  + + +  +L P   P   D S +P VILVVGVNGVGKTT IGK
Sbjct: 160 EATARGDLIYSHSLYKALQKELTDILTPKVAPLVVDASTKPFVILVVGVNGVGKTTTIGK 219

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G  VMLAAGDTFR+AA +QL++W +R +   V    GSD+A++ ++A + A+
Sbjct: 220 LAKRLQGEGKSVMLAAGDTFRAAATEQLQVWGERNNIPVVAQGHGSDSASVIFDAIQSAK 279

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DVLI DTAGRL N + LM  + K+IRV+++ DP APH  + VLDA TGQNAL QVE
Sbjct: 280 ARGIDVLIADTAGRLQNKTNLMEELKKVIRVMQKADPTAPHESMIVLDAGTGQNALNQVE 339

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F+     TG+ +TK+DGTA+GG +  I     +P+ F+GVGE I+DL PF A DF
Sbjct: 340 IFNEAVPLTGVTVTKLDGTAKGGVVFNIAENTNVPIRFIGVGEKIDDLRPFQADDF 395


>gi|209965480|ref|YP_002298395.1| cell division ABC transporter, periplasmic substrate-binding
           protein FtsY [Rhodospirillum centenum SW]
 gi|209958946|gb|ACI99582.1| cell division ABC transporter, periplasmic substrate-binding
           protein FtsY [Rhodospirillum centenum SW]
          Length = 402

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/305 (46%), Positives = 207/305 (67%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
            E   W  +L  G + ++ +L EGI+ I + R+LDD   EELE+LLIR+D+G   A ++ 
Sbjct: 95  PERKGWFARLKDGLSKSTSRLTEGISGIFTKRKLDDEALEELEELLIRADLGPTTAARMT 154

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
             L   R+ K+VS Q V   ++  + K++ P+++P   +   RPHVIL+VGVNG GKTT 
Sbjct: 155 AGLARTRFGKEVSPQEVREYLAGEVQKLVEPVARPLVIEPERRPHVILLVGVNGTGKTTT 214

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL++++ + G  V +AAGDTFR+AA+ QLK+W +RT    V  + G+DAA LA+EA +
Sbjct: 215 IGKLARQLREEGKTVWMAAGDTFRAAAVSQLKVWGERTGCPVVAKDTGADAAGLAFEALE 274

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+A   DVL+IDTAGRL N + LM  + K++RV+K+LDP APH+ L  LDATTGQNA  
Sbjct: 275 KARAAGADVLLIDTAGRLQNKTGLMEELRKIVRVIKKLDPEAPHTTLLTLDATTGQNAHS 334

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F  +    GL++TK+DG+ARGG L+ +     +PV+ +GVGEG+ DL PF A+ F+
Sbjct: 335 QVEVFKEMVAINGLVLTKLDGSARGGVLVALAEKFGLPVHAIGVGEGVYDLRPFDARQFA 394

Query: 308 AVITG 312
             + G
Sbjct: 395 RALVG 399


>gi|93006307|ref|YP_580744.1| signal recognition particle-docking protein FtsY [Psychrobacter
           cryohalolentis K5]
 gi|92393985|gb|ABE75260.1| signal recognition particle-docking protein FtsY [Psychrobacter
           cryohalolentis K5]
          Length = 477

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 201/313 (64%), Gaps = 4/313 (1%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIG 59
           +  ++ +S+  SW  ++  G + +   L EG+  I I  + +DD + EE+ED L+ +DIG
Sbjct: 159 LQEEQESSKKGSWFNRMKTGLSKSRKNLAEGMVSILIGGKEIDDELLEEVEDQLLVADIG 218

Query: 60  VAVAQKIVEELLTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVV 117
           V    +I++ L  +    D+     LY    +EL+  +L P   P   D S +P VILVV
Sbjct: 219 VNATNRIIKSLTEQTDRGDLIYAHSLYKALQTELVD-ILTPKVAPLIIDSSKKPFVILVV 277

Query: 118 GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD 177
           GVNGVGKTT IGKL+K++   G  VMLAAGDTFR+AA +QL+IW +R     V    GSD
Sbjct: 278 GVNGVGKTTTIGKLAKRLQGEGKSVMLAAGDTFRAAATEQLQIWGERNHIPVVAQGHGSD 337

Query: 178 AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVL 237
           +A++ ++A + A+AK +DVLI DTAGRL N + LMA + K++RV+++ DP APH  + VL
Sbjct: 338 SASVIFDAMQSAKAKNIDVLIADTAGRLQNKTHLMAELEKVVRVMRKADPSAPHEGMIVL 397

Query: 238 DATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGIND 297
           DA TGQNA+ QVE+F+ V   TG+ +TK+DGTA+GG +  I  T  +P+ ++GVGE I+D
Sbjct: 398 DAGTGQNAINQVELFNKVVPLTGITITKLDGTAKGGVVFNIAETTDVPIRYIGVGESIDD 457

Query: 298 LEPFVAKDFSAVI 310
           L  F  K F A +
Sbjct: 458 LRAFSPKQFVAAL 470


>gi|84515411|ref|ZP_01002773.1| Signal recognition particle-docking protein FtsY [Loktanella
           vestfoldensis SKA53]
 gi|84510694|gb|EAQ07149.1| Signal recognition particle-docking protein FtsY [Loktanella
           vestfoldensis SKA53]
          Length = 323

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 192/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + EELEDLLI +D+GV  AQ+++  +      K VSV+ V   +   + +++ P
Sbjct: 48  RALDDAMLEELEDLLIAADMGVETAQRVIANIAEGHLGKRVSVEEVKRLLMAEVVRIMEP 107

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    ++  P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 108 VARPLPI-YAKTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKNVVIAAGDTFRAAAVEQL 166

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LAY+A  +AQA   D+L+IDTAGRL N + LM  + K+
Sbjct: 167 QVWGQRAGVPVLTAPEGSDPASLAYDAMTKAQADGADLLMIDTAGRLQNRADLMEELSKI 226

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+VL VLDATTGQNA++QV++F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 227 VRVIRKKDPDAPHNVLLVLDATTGQNAVQQVKVFQELAAVSGLVMTKLDGTAKGGVLVSL 286

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+A + G 
Sbjct: 287 ADRFGLPIHAIGVGEQIDDLAPFDPEEFAAALVGL 321


>gi|126733156|ref|ZP_01748903.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           CCS2]
 gi|126716022|gb|EBA12886.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           CCS2]
          Length = 315

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 194/278 (69%), Gaps = 1/278 (0%)

Query: 36  ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKM 95
           +  R LDD + E+LE+LLI +D+GV  A ++   +   R  + +SVQ +   +++ + ++
Sbjct: 37  VVKRTLDDDMLEQLEELLITADMGVDTALRVTANMAEGRLGRKLSVQEIKELMAQEVSRI 96

Query: 96  LMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI 155
           + P+++P    ++  P V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA+
Sbjct: 97  MEPVARPMPL-YTKTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAAV 155

Query: 156 DQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGI 215
           +QL++W +R     + +  GSD A+LA++A  QAQA   D+L+IDTAGRL N + LM  +
Sbjct: 156 EQLQVWGERADVPVLTAPEGSDPASLAFDAMTQAQADGADLLMIDTAGRLQNRADLMEEL 215

Query: 216 GKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGL 275
            K++RV+++ DP APH+ L VLDATTGQNA++QV++F  +A  +GL+MTK+DGTA+GG L
Sbjct: 216 AKIVRVIRKKDPDAPHNTLLVLDATTGQNAVQQVKVFQELADVSGLVMTKLDGTAKGGVL 275

Query: 276 IPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           + +     +P++ +GVGE I+DL PF   DF+A + G 
Sbjct: 276 VALADKFGLPIHAIGVGEQIDDLAPFDPDDFAAALVGL 313


>gi|163737648|ref|ZP_02145065.1| signal recognition particle-docking protein FtsY [Phaeobacter
           gallaeciensis BS107]
 gi|161389174|gb|EDQ13526.1| signal recognition particle-docking protein FtsY [Phaeobacter
           gallaeciensis BS107]
          Length = 415

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 191/274 (69%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LEDLL+ +D+GV  A ++   +   R  K +S + +   ++  + +++ P
Sbjct: 139 RALDDDMLEQLEDLLVGADMGVDTALRVTANMAEGRLGKRLSTREIKELLAAEVARIMEP 198

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    ++ RP V+LVVGVNG GKTT IGKL+ +    G KV++AAGDTFR+AA++QL
Sbjct: 199 VARPMPI-YAKRPQVVLVVGVNGSGKTTTIGKLASQFKAVGKKVVIAAGDTFRAAAVEQL 257

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ +  D+L+IDTAGRL N + LM  + K+
Sbjct: 258 QVWGDRAGVPVLTAPEGSDPASLAFDAMTRAQEEGADLLMIDTAGRLQNRADLMEELAKI 317

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QV+ F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 318 VRVIQKKDPSAPHNTLLVLDATTGQNALNQVDTFQKLADVSGLVMTKLDGTAKGGVLVAL 377

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 378 ADRFGLPIHAIGVGEQIDDLAPFDPEDFAAALTG 411


>gi|126725602|ref|ZP_01741444.1| signal recognition particle-docking protein FtsY [Rhodobacterales
           bacterium HTCC2150]
 gi|126704806|gb|EBA03897.1| signal recognition particle-docking protein FtsY [Rhodobacterales
           bacterium HTCC2150]
          Length = 420

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/275 (45%), Positives = 192/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI SD+GV  A ++   +   R+ K +S   +   +++ + ++L P
Sbjct: 145 RVLDDDMLEQLEELLITSDMGVETALRVTANMAEGRFGKKLSSSEIKSLLAQEVARILEP 204

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    ++ +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 205 VAKPMPL-YTKKPQVVLVVGVNGSGKTTTIGKLASQFKAAGKSVVIAAGDTFRAAAVEQL 263

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W +R +   + +  GSD A+LA++A  +A+    D+L+IDTAGRL N S LM  + K+
Sbjct: 264 QVWGERANVPVLTAPEGSDPASLAFDAMTKAENDGADLLLIDTAGRLQNRSDLMEELAKI 323

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QV+ F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 324 VRVIRKKDPEAPHNTLLVLDATTGQNALNQVDAFQKLADVSGLVMTKLDGTAKGGVLVAL 383

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 384 ADRFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGT 418


>gi|326560132|gb|EGE10522.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis 46P47B1]
 gi|326573383|gb|EGE23351.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis 101P30B1]
          Length = 313

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 197/302 (65%), Gaps = 4/302 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   W  ++  G + +S  L EG+ ++ +  +++DD + EE+ED L+ +DIGV    +I
Sbjct: 4   NEKGGWFSRMKAGLSKSSKNLSEGLVNVLVGGKQIDDELLEEVEDQLLVADIGVNATNRI 63

Query: 67  VEELLTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           ++ L  +    D+     LY    +EL   +L P   P   D + +P+VIL+VGVNGVGK
Sbjct: 64  IKNLTEQTARGDLIYSHALYKALKTELTD-ILTPKVAPLIIDTTKKPYVILMVGVNGVGK 122

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K++ + G  VMLAAGDTFR+AA +QL+IW +R     V    GSD+A++ ++
Sbjct: 123 TTTIGKLAKRLQNEGKSVMLAAGDTFRAAATEQLQIWGERNGIPVVAQGHGSDSASVIFD 182

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A+AK +DVLI DTAGRL N + LM  + K++RV+K+ D  APH  + VLDA TGQN
Sbjct: 183 AMQSAKAKGIDVLIADTAGRLQNKTHLMNELEKVVRVMKKGDETAPHETMIVLDAGTGQN 242

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ QV++F      TG+ +TK+DGTA+GG +  I     IP+ F+GVGEGI+DL+PF  K
Sbjct: 243 AINQVQVFSEAVNLTGISVTKLDGTAKGGVVFNIAQNTDIPIRFIGVGEGIDDLQPFKPK 302

Query: 305 DF 306
           DF
Sbjct: 303 DF 304


>gi|284008656|emb|CBA75288.1| cell division protein [Arsenophonus nasoniae]
          Length = 414

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 199/296 (67%), Gaps = 2/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           ++  +L +G   T   +  G       +++DD + +ELE+ L+ +D+G+   +KI++ L 
Sbjct: 111 NFFSRLRRGLLKTRQNMGIGFVSFFRGKKIDDDLFDELEEQLLIADVGLETTRKIIDSLT 170

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                K+++   +LY  + E +  +L  + KP   + +  P+VIL+VGVNGVGKTT IGK
Sbjct: 171 NHANRKELNDAAMLYSKLREEMANILSGVEKPLVIE-NKLPYVILMVGVNGVGKTTTIGK 229

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+++    G  VMLAAGDTFR+AA++QL++W +R +   V  + G+D A++ ++A + A+
Sbjct: 230 LARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQQTGADPASVIFDAIQSAK 289

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +D+LI DTAGRL N + LM  + K++RV+++LD HAPH V+  LDA+TGQNA+ Q +
Sbjct: 290 AKGIDILIADTAGRLQNKTHLMEELKKIVRVMQKLDQHAPHEVMLTLDASTGQNAINQAK 349

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +FH   G TG+I+TK+DGTA+GG +  I    KIP+ ++G+GEGI+DL PFVA DF
Sbjct: 350 IFHEAVGLTGIILTKLDGTAKGGVIFAIADQFKIPIRYIGIGEGIDDLRPFVAHDF 405


>gi|119944395|ref|YP_942075.1| signal recognition particle-docking protein FtsY [Psychromonas
           ingrahamii 37]
 gi|119862999|gb|ABM02476.1| signal recognition particle-docking protein FtsY [Psychromonas
           ingrahamii 37]
          Length = 453

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/306 (40%), Positives = 198/306 (64%), Gaps = 1/306 (0%)

Query: 2   SNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVA 61
             QK   ++L +  +  +    T L +  G+  + S +++D  + EELE+ LI +DIGV 
Sbjct: 136 EKQKTEEKALGFFARFKQSLTKTRLSIGSGLYSLFSGKKIDADLFEELEEQLILADIGVD 195

Query: 62  VAQKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
              KI+++L  +   K +     LY +  E +  +L  + +P   D +  P+VIL+VGVN
Sbjct: 196 TTLKIIDKLTAQANRKQLKDAEALYTLLKEDLSGILQEVEQPLVIDETKSPYVILMVGVN 255

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           GVGKTT IGKL+KK    G  VMLAAGDTFR+AA++QL++W +R +   +  + GSD+A+
Sbjct: 256 GVGKTTTIGKLAKKYQQQGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQQTGSDSAS 315

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           + ++A   A+A+ +DVLI DTAGRL N   LM  + K++R++++ DP APH ++  +DA+
Sbjct: 316 VLFDAMDAAKARGIDVLIADTAGRLQNKEHLMDELSKVVRIMRKKDPSAPHEIMLTIDAS 375

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNA+ Q ++F+   G TG+ +TK+DGTA+GG +  I   +K+P+ ++G GEGI+DL  
Sbjct: 376 TGQNAISQADLFNKAVGITGITLTKLDGTAKGGVIFSIADKYKLPIRYIGTGEGIDDLRE 435

Query: 301 FVAKDF 306
           F A++F
Sbjct: 436 FNAREF 441


>gi|192973052|gb|ACF06951.1| signal recognition partical docking protein FtsY [uncultured
           Roseobacter sp.]
          Length = 395

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 195/288 (67%), Gaps = 1/288 (0%)

Query: 26  LKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVL 85
           L  K G+      R LDD + E+LE+LLI SD+GV  A +I   L   R+ + +S   + 
Sbjct: 107 LPQKTGVFGRAPRRVLDDDMLEQLEELLISSDMGVDTAVRITANLAEGRFGRKLSTAEIK 166

Query: 86  YDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA 145
             ++E I +++ P+++P    ++ +P VILVVGVNG GKTT IGKL+ +   AG  V++A
Sbjct: 167 SALAEEIARVMEPVARPLPI-YNKKPQVILVVGVNGSGKTTTIGKLASQFKKAGKSVVIA 225

Query: 146 AGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRL 205
           AGDTFR+AA+ QL++W +R     + +  GSD A+LA++A  QA+    D+L+IDTAGRL
Sbjct: 226 AGDTFRAAAVGQLQVWGERAGVPVMTAAEGSDPASLAFDAMTQAEKDGADLLMIDTAGRL 285

Query: 206 HNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTK 265
            N + LM  + K+IRV+++ DP APH+ + VLDATTGQNA+ QVE+F  +A  TGL+MTK
Sbjct: 286 QNRADLMEELSKIIRVIRKKDPDAPHNTVLVLDATTGQNAVNQVEVFRKMADVTGLVMTK 345

Query: 266 MDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           +DGTA+GG L+ +     +P++ +GVGE I+DL+ F  ++F+A +TG 
Sbjct: 346 LDGTAKGGVLVSLADKFALPIHAIGVGEQIDDLDAFDPQEFAAALTGV 393


>gi|256823779|ref|YP_003147742.1| signal recognition particle-docking protein FtsY [Kangiella
           koreensis DSM 16069]
 gi|256797318|gb|ACV27974.1| signal recognition particle-docking protein FtsY [Kangiella
           koreensis DSM 16069]
          Length = 427

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 203/301 (67%), Gaps = 4/301 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDII-SSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   +  +L  G + T  +L + + +++  S+ +DD + E++E  L+ +D+GV+  +KI
Sbjct: 116 AEKQGFFSRLKAGLSRTRGQLADSLANLVLGSKEIDDDLLEDIETQLLMADVGVSATRKI 175

Query: 67  VEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           +++L  K   K++   + L D + +L+ +++ P ++P   + +H+P VIL+VGVNGVGKT
Sbjct: 176 IDDLTDKAARKELKDPQALMDRLRQLLSEIIEPCTQPL--ELTHKPFVILMVGVNGVGKT 233

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+KK    G  VMLAAGDTFR+AA++QL++W +R +        G+D+A++ ++A
Sbjct: 234 TTIGKLAKKFQGEGKSVMLAAGDTFRAAAVEQLQVWGERNNIHVTAQHTGADSASVIFDA 293

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + AQA+K+DVLI DTAGRLH  S LM  + K+ RV+++LDP APH V+ V+DA TGQNA
Sbjct: 294 LQAAQARKIDVLIADTAGRLHTKSNLMDELSKVQRVMQKLDPSAPHEVMLVVDAGTGQNA 353

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q E F+     +G+ +TK+DGTA+GG +  +    K P+ F+GVGEGI+DL  F  +D
Sbjct: 354 LNQAEHFNKAVPLSGITITKLDGTAKGGIIFALADKMKTPIRFIGVGEGIDDLREFNGQD 413

Query: 306 F 306
           F
Sbjct: 414 F 414


>gi|326565395|gb|EGE15572.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis 103P14B1]
 gi|326575720|gb|EGE25643.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis CO72]
          Length = 313

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 197/302 (65%), Gaps = 4/302 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   W  ++  G + +S  L EG+ ++ +  +++DD + EE+ED L+ +DIGV    +I
Sbjct: 4   NEKGGWFSRMKAGLSKSSKNLSEGLVNVLVGGKQIDDELLEEVEDQLLVADIGVNATNRI 63

Query: 67  VEELLTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           ++ L  +    D+     LY    +EL   +L P   P   D + +P+VIL+VGVNGVGK
Sbjct: 64  IKNLTEQTARGDLIYSHALYKALKTELTD-ILTPKVAPLIIDTTKKPYVILMVGVNGVGK 122

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K++ + G  VMLAAGDTFR+AA +QL+IW +R     +    GSD+A++ ++
Sbjct: 123 TTTIGKLAKRLQNEGKSVMLAAGDTFRAAATEQLQIWGERNGIPVIAQGHGSDSASVIFD 182

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A+AK +DVLI DTAGRL N + LM  + K++RV+K+ D  APH  + VLDA TGQN
Sbjct: 183 AMQSAKAKGIDVLIADTAGRLQNKTHLMNELEKVVRVMKKGDETAPHETMIVLDAGTGQN 242

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ QV++F      TG+ +TK+DGTA+GG +  I     IP+ F+GVGEGI+DL+PF  K
Sbjct: 243 AINQVQVFSEAVNLTGISVTKLDGTAKGGVVFNIAQNTDIPIRFIGVGEGIDDLQPFKPK 302

Query: 305 DF 306
           DF
Sbjct: 303 DF 304


>gi|296113141|ref|YP_003627079.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis RH4]
 gi|295920835|gb|ADG61186.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis RH4]
 gi|326560515|gb|EGE10897.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis 7169]
 gi|326565755|gb|EGE15917.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis BC1]
 gi|326570406|gb|EGE20446.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis BC8]
 gi|326571092|gb|EGE21116.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis BC7]
 gi|326577186|gb|EGE27080.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis O35E]
          Length = 313

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 197/302 (65%), Gaps = 4/302 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   W  ++  G + +S  L EG+ ++ +  +++DD + EE+ED L+ +DIGV    +I
Sbjct: 4   NEKGGWFSRMKAGLSKSSKNLSEGLVNVLVGGKQIDDELLEEVEDQLLVADIGVNATNRI 63

Query: 67  VEELLTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           ++ L  +    D+     LY    +EL   +L P   P   D + +P+VIL+VGVNGVGK
Sbjct: 64  IKNLTEQTARGDLIYSHALYKALKTELTD-ILTPKVAPLIIDTTKKPYVILMVGVNGVGK 122

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K++ + G  VMLAAGDTFR+AA +QL+IW +R     +    GSD+A++ ++
Sbjct: 123 TTTIGKLAKRLQNEGKSVMLAAGDTFRAAATEQLQIWGERNGIAVIAQGHGSDSASVIFD 182

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A+AK +DVLI DTAGRL N + LM  + K++RV+K+ D  APH  + VLDA TGQN
Sbjct: 183 AMQSAKAKGIDVLIADTAGRLQNKTHLMNELEKVVRVMKKGDETAPHETMIVLDAGTGQN 242

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ QV++F      TG+ +TK+DGTA+GG +  I     IP+ F+GVGEGI+DL+PF  K
Sbjct: 243 AINQVQVFSEAVNLTGISVTKLDGTAKGGVVFNIAQNTDIPIRFIGVGEGIDDLQPFKPK 302

Query: 305 DF 306
           DF
Sbjct: 303 DF 304


>gi|326564152|gb|EGE14388.1| signal recognition particle-docking protein FtsY [Moraxella
           catarrhalis 12P80B1]
          Length = 313

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 197/302 (65%), Gaps = 4/302 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   W  ++  G + +S  L EG+ ++ +  +++DD + EE+ED L+ +DIGV    +I
Sbjct: 4   NEKGGWFSRMKAGLSKSSKNLSEGLVNVLVGGKQIDDELLEEVEDQLLVADIGVNATNRI 63

Query: 67  VEELLTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           ++ L  +    D+     LY    +EL   +L P   P   D + +P+VIL+VGVNGVGK
Sbjct: 64  IKNLTEQAARGDLIYSHALYKALKTELTD-ILTPKVAPLIIDTTKKPYVILMVGVNGVGK 122

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K++ + G  VMLAAGDTFR+AA +QL+IW +R     +    GSD+A++ ++
Sbjct: 123 TTTIGKLAKRLQNEGKSVMLAAGDTFRAAATEQLQIWGERNGIAVIAQGHGSDSASVIFD 182

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A+AK +DVLI DTAGRL N + LM  + K++RV+K+ D  APH  + VLDA TGQN
Sbjct: 183 AMQSAKAKGIDVLIADTAGRLQNKTHLMNELEKVVRVMKKGDETAPHETMIVLDAGTGQN 242

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ QV++F      TG+ +TK+DGTA+GG +  I     IP+ F+GVGEGI+DL+PF  K
Sbjct: 243 AINQVQVFSEAVNLTGISVTKLDGTAKGGVVFNIAQNTDIPIRFIGVGEGIDDLQPFKPK 302

Query: 305 DF 306
           DF
Sbjct: 303 DF 304


>gi|192360531|ref|YP_001983953.1| signal recognition particle receptor FtsY [Cellvibrio japonicus
           Ueda107]
 gi|190686696|gb|ACE84374.1| signal recognition particle receptor FtsY [Cellvibrio japonicus
           Ueda107]
          Length = 374

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 201/302 (66%), Gaps = 2/302 (0%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQK 65
           A   L +  ++ +G + TS    EG+  +   R+ +D+ + EELE  L+ +D+G+    +
Sbjct: 63  AEPKLGFFARIKRGLSRTSSHFAEGLGKLFLGRKTIDEELFEELETQLLIADVGMEATSE 122

Query: 66  IVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           I++ L ++   K ++    L+  + E + ++L P+ +P     +++P+VILVVGVNGVGK
Sbjct: 123 IIDNLTSRVARKQLADSDALFAALREQLAELLRPVEQPLVIPAANKPYVILVVGVNGVGK 182

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K++ + G KVMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++
Sbjct: 183 TTTIGKLAKRLQNDGRKVMLAAGDTFRAAAVEQLQVWGQRNNVPVIAQHSGADSASVIFD 242

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A   AQ++ +DV+I DTAGRLHN + LM  + K+ RV+ +LD  APH VL VLDA TGQN
Sbjct: 243 ALSAAQSRGIDVVIADTAGRLHNKNHLMDELAKVKRVMAKLDVSAPHEVLLVLDAGTGQN 302

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           AL Q E F   AG TG+ +TK+DGTA+GG +  +     +PV F+GVGEGI+DL+PF A+
Sbjct: 303 ALNQAEQFRDAAGVTGIALTKLDGTAKGGVIFALSKKFGLPVRFIGVGEGIDDLQPFAAE 362

Query: 305 DF 306
            F
Sbjct: 363 PF 364


>gi|254476268|ref|ZP_05089654.1| signal recognition particle-docking protein FtsY [Ruegeria sp. R11]
 gi|214030511|gb|EEB71346.1| signal recognition particle-docking protein FtsY [Ruegeria sp. R11]
          Length = 418

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 190/274 (69%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LEDLL+ +D+GV  A ++   +   RY K +S + +   ++  + +++ P
Sbjct: 142 RVLDDEMLEQLEDLLVGADMGVDTALRVTANMAEGRYGKRLSAREIKELLAGEVARIMEP 201

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 202 VARPMPI-YEKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQL 260

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ    D+L+IDTAGRL N + LM  + K+
Sbjct: 261 QVWGDRAGVPVLTAPEGSDPASLAFDAMTRAQEDGADLLMIDTAGRLQNRADLMEELAKI 320

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 321 VRVIRKKDETAPHNTLLVLDATTGQNALNQVETFQKLADVSGLVMTKLDGTAKGGVLVAL 380

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL PF  ++F+A +TG
Sbjct: 381 ADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTG 414


>gi|294638159|ref|ZP_06716415.1| cell division protein FtsY [Edwardsiella tarda ATCC 23685]
 gi|291088726|gb|EFE21287.1| cell division protein FtsY [Edwardsiella tarda ATCC 23685]
          Length = 500

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 131/300 (43%), Positives = 194/300 (64%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI++ L T
Sbjct: 198 FFARLKRSLVKTRQNLGSGFFGLFRGKKIDDDLFDELEEQLLVADVGVDTTRKIIDTLTT 257

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFS-HRPHVILVVGVNGVGKTT 126
               K++     LY     ++ E++HK+  PL      D S H+P VIL+VGVNGVGKTT
Sbjct: 258 HASRKELKDAEALYGKLKQEMGEILHKVDAPL------DISGHQPFVILMVGVNGVGKTT 311

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A 
Sbjct: 312 TIGKLARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAI 371

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+KVDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 372 QAAKARKVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEQAPHEVMLTIDASTGQNAI 431

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q  +FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A DF
Sbjct: 432 SQARLFHEAVGLTGITLTKLDGTAKGGVIFAVADQFGIPIRYIGVGEGIEDLRPFKADDF 491


>gi|84683623|ref|ZP_01011526.1| signal recognition particle-docking protein FtsY [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668366|gb|EAQ14833.1| signal recognition particle-docking protein FtsY [Rhodobacterales
           bacterium HTCC2654]
          Length = 453

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 190/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE+L+I SD+GV  A ++   +   R  + VSV+ +   +++ I +++ P
Sbjct: 180 RVLDDDMLESLEELMIASDMGVDTALRVSANIAEGRLGRKVSVEEIKEILAKEIARVMEP 239

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    + +RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 240 VAKPLPL-YPNRPQVVLVVGVNGAGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 298

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W +R     + +  GSD A+LA++A  +A+A   D+L+IDTAGRL N   LMA + K+
Sbjct: 299 QVWGERAGVPVLTAPEGSDPASLAFDALTKARADGADLLMIDTAGRLQNREDLMAELAKI 358

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+K++D  APH+ L VLDATTGQNAL QV+ F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 359 VRVIKKIDDSAPHNTLLVLDATTGQNALSQVQTFQKLADVSGLVMTKLDGTAKGGVLVAL 418

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF   DF+  +TG 
Sbjct: 419 ADKFGLPIHAIGVGEQIDDLAPFDPDDFAKALTGL 453


>gi|86136625|ref|ZP_01055204.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           MED193]
 gi|85827499|gb|EAQ47695.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           MED193]
          Length = 355

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 190/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R  K +S + +   ++  + +++  
Sbjct: 79  RTLDDDMLEQLEELLIAADMGVDTALRVTANMAEGRLGKKLSAREIKELLAAEVARVMEH 138

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    ++HRP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 139 VAKPMPL-YAHRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKNVVIAAGDTFRAAAVEQL 197

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LAY+A  +AQ +  D+L+IDTAGRL N + LM  + K+
Sbjct: 198 QVWGDRAGVPVLTAPEGSDPASLAYDAMTRAQEEGADLLMIDTAGRLQNRADLMEELSKI 257

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           IRV+++ D  APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 258 IRVIRKKDETAPHNTLLVLDATTGQNALSQVETFQKLADVSGLVMTKLDGTAKGGVLVAL 317

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 318 ADKFALPIHAIGVGEQIDDLAPFDPEEFAAALTGL 352


>gi|56696224|ref|YP_166581.1| signal recognition particle-docking protein FtsY [Ruegeria pomeroyi
           DSS-3]
 gi|56677961|gb|AAV94627.1| signal recognition particle-docking protein FtsY [Ruegeria pomeroyi
           DSS-3]
          Length = 390

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 190/274 (69%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R  + +S Q +   +++ I +++ P
Sbjct: 114 RTLDDDMLEQLEELLIAADMGVDTALRVTANMAEGRIGRKLSTQEIKALLAQEITRIMEP 173

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 174 VARPMPL-YPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQL 232

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ    D+L+IDTAGRL N + LM  + K+
Sbjct: 233 QVWGDRAGVPVLTAPEGSDPASLAFDAMTRAQEDGADLLLIDTAGRLQNRADLMEELAKI 292

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNA+ QVE F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 293 VRVIRKKDDTAPHNTLLVLDATTGQNAISQVETFQKLADVSGLVMTKLDGTAKGGILVSL 352

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 353 ADRFGLPIHAIGVGEQIDDLAPFDPEDFAAALTG 386


>gi|77462389|ref|YP_351893.1| Signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides 2.4.1]
 gi|77386807|gb|ABA77992.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides 2.4.1]
          Length = 393

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 191/277 (68%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE++LI++D+GV  A ++   +   RY + VS + +   ++  I ++L P
Sbjct: 118 RILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSAREIKEALAAEIARILEP 177

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 178 VARPMPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 236

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N + LM  + K+
Sbjct: 237 QVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSKI 296

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE+F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 297 VRVIRKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLVAL 356

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL PF  ++F+  + G  D
Sbjct: 357 ADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD 393


>gi|326388652|ref|ZP_08210245.1| signal recognition particle-docking protein FtsY [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206903|gb|EGD57727.1| signal recognition particle-docking protein FtsY [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 308

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 189/305 (61%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           S +W  +L  G   T  +L   +  ++ + RL D   +++ED LI SD+G   A +I E 
Sbjct: 3   SDTWSDRLLGGLRKTQERLSGNLAGLVGANRLSDEQLDDIEDALIASDLGPRAAARIRER 62

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           L + R+ K +    +   V+E I  +L P+++P +     RP VILV+GVNG GKTT I 
Sbjct: 63  LASGRFEKGLDEATLREAVAEEIAAILRPVARPLDIVAFPRPQVILVIGVNGSGKTTTIA 122

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+    +    VMLAAGDTFR+AAI QL++WA+R     V    G D A++ ++A KQA
Sbjct: 123 KLAHLFQELDYSVMLAAGDTFRAAAIGQLRVWAERLGVPIVSGAEGGDPASIVFDAVKQA 182

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
                DVLI+DTAGRL N   LM  + K+ RVL RL+P APH V+ VLDAT GQNAL+Q+
Sbjct: 183 TDAGTDVLIVDTAGRLQNKRELMDELAKIRRVLGRLNPEAPHDVVLVLDATNGQNALQQI 242

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E+F  VAG TGL+MTK+DGTARGG L+     + +P++ +GVGE I+DL PF     + V
Sbjct: 243 EIFREVAGVTGLVMTKLDGTARGGVLVAAAEQYGLPIHAIGVGEKIDDLRPFDPDLVAKV 302

Query: 310 ITGCL 314
           I G  
Sbjct: 303 IAGVF 307


>gi|163796739|ref|ZP_02190697.1| Signal recognition particle GTPase [alpha proteobacterium BAL199]
 gi|159177993|gb|EDP62540.1| Signal recognition particle GTPase [alpha proteobacterium BAL199]
          Length = 316

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 208/313 (66%), Gaps = 1/313 (0%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           MS +  + E   W  +L  G A +S +L +GIT +   RRLD    EELEDLLI +D+GV
Sbjct: 1   MSAEPASPERKGWFARLRDGLAKSSRRLADGITSLFVKRRLDAATLEELEDLLITADLGV 60

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFN-WDFSHRPHVILVVGV 119
             A K+   L  +++ K+V+   V    +  I  +L P++ P    + +++P V+L+VGV
Sbjct: 61  ETAAKLTANLAREKFDKEVTGDEVRAAFAADIAAILAPVAVPLEPREIANKPFVVLMVGV 120

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NG GKTT IGKL+++ +DAG  V+LAAGDTFR+AA++QL++W +R+    +    G+DAA
Sbjct: 121 NGSGKTTTIGKLARQWTDAGKSVVLAAGDTFRAAAVEQLRVWGERSGCPVIEKPHGADAA 180

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           ALA++A  +A+ +K DVLIIDTAGRL N + LM  + K+IRVLK+ DP APH+ + VLD 
Sbjct: 181 ALAFDALVEARERKADVLIIDTAGRLQNKAGLMEELAKVIRVLKKQDPEAPHATVLVLDG 240

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
           T GQNA  QV+ F  +   TGLI+TK+DG+ARGG ++ +  +  +PV+ +GVGEGI+DL 
Sbjct: 241 TVGQNAHAQVKTFREMVNVTGLIVTKLDGSARGGIVVALAQSQGLPVHAVGVGEGIDDLH 300

Query: 300 PFVAKDFSAVITG 312
           PF    F+  + G
Sbjct: 301 PFEPDAFARSLMG 313


>gi|259416345|ref|ZP_05740265.1| cell division protein FtsY [Silicibacter sp. TrichCH4B]
 gi|259347784|gb|EEW59561.1| cell division protein FtsY [Silicibacter sp. TrichCH4B]
          Length = 388

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 191/277 (68%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE++LI SD+GV  A ++   +   R  + VS + +   +++ I +++ P
Sbjct: 111 RVLDDDMLESLEEMLIASDMGVDTALRVTANIAEGRMGRRVSGREIRELLAQEIARVMEP 170

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 171 VARPMPL-YPSKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKTVVIAAGDTFRAAAVEQL 229

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +A+A   D+L+IDTAGRL N + LM  + K+
Sbjct: 230 QVWGDRAGVPVLTAPEGSDPASLAFDAMTKAEADGADLLMIDTAGRLQNRADLMEELAKI 289

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 290 VRVIRKKDPEAPHNTLLVLDATTGQNALSQVETFRQLADVSGLVMTKLDGTAKGGVLVAL 349

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL PF  ++F+A +TG  D
Sbjct: 350 ADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGLED 386


>gi|332560273|ref|ZP_08414595.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides WS8N]
 gi|332277985|gb|EGJ23300.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides WS8N]
          Length = 376

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 191/277 (68%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE++LI++D+GV  A ++   +   RY + VS + +   ++  I ++L P
Sbjct: 101 RILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSAREIKEALAAEIARILEP 160

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 161 VARPMPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 219

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N + LM  + K+
Sbjct: 220 QVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSKI 279

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE+F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 280 VRVIRKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLVAL 339

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL PF  ++F+  + G  D
Sbjct: 340 ADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD 376


>gi|221638249|ref|YP_002524511.1| Signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides KD131]
 gi|221159030|gb|ACM00010.1| Signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides KD131]
          Length = 381

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 191/277 (68%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE++LI++D+GV  A ++   +   RY + VS + +   ++  I ++L P
Sbjct: 106 RILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSAREIKEALAAEIARILEP 165

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 166 VARPMPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 224

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N + LM  + K+
Sbjct: 225 QVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSKI 284

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE+F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 285 VRVIRKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLVAL 344

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL PF  ++F+  + G  D
Sbjct: 345 ADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD 381


>gi|254463678|ref|ZP_05077089.1| signal recognition particle-docking protein FtsY [Rhodobacterales
           bacterium Y4I]
 gi|206684586|gb|EDZ45068.1| signal recognition particle-docking protein FtsY [Rhodobacterales
           bacterium Y4I]
          Length = 396

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 190/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   L   R  K VS + +   +++ + +++ P
Sbjct: 120 RALDDDMLEQLEELLIAADMGVDTALRVTANLAEGRMGKKVSSREIKELLAQEVARIMEP 179

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    ++ RP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 180 VAKPLPI-YAKRPQVVLVVGVNGSGKTTTIGKLASQFKGAGKKVVIAAGDTFRAAAVEQL 238

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ    D+L+IDTAGRL N + LM  + K+
Sbjct: 239 QVWGDRAGVPVLTAPEGSDPASLAFDAMTKAQEDGADLLMIDTAGRLQNRADLMEELAKI 298

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QV  F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 299 VRVIRKKDETAPHNTLLVLDATTGQNALSQVGTFQQLADVSGLVMTKLDGTAKGGVLVAL 358

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 359 ADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGL 393


>gi|71065494|ref|YP_264221.1| signal recognition particle-docking protein FtsY [Psychrobacter
           arcticus 273-4]
 gi|71038479|gb|AAZ18787.1| signal recognition particle-docking protein FtsY [Psychrobacter
           arcticus 273-4]
          Length = 478

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 4/302 (1%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           SW  ++  G + +   L EG+  I I  + +DD + EE+ED L+ +DIGV    +I++ L
Sbjct: 171 SWFNRMKTGLSKSRKNLAEGMVGILIGGKEIDDELLEEVEDQLLVADIGVNATNRIIKSL 230

Query: 71  LTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
             +    D+     LY    +EL+  +L P   P   D S +P VILVVGVNGVGKTT I
Sbjct: 231 TEQTDRGDLIYAHSLYKALQTELVD-ILTPKVAPLIIDTSKQPFVILVVGVNGVGKTTTI 289

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+K++   G  VMLAAGDTFR+AA +QL+IW +R +   V    GSD+A++ ++A + 
Sbjct: 290 GKLAKRLQGEGKSVMLAAGDTFRAAATEQLQIWGERNNIPVVAQGHGSDSASVIFDAMQS 349

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+AK +DVLI DTAGRL N + LMA + K++RV+++ D  APH  + VLDA TGQNA+ Q
Sbjct: 350 AKAKNIDVLIADTAGRLQNKTHLMAELEKVVRVMRKADSSAPHEGMIVLDAGTGQNAINQ 409

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
           VE+F+ V   TG+ +TK+DGTA+GG +  I  T  +P+ ++GVGE I+DL  F  K F A
Sbjct: 410 VELFNKVVPLTGITITKLDGTAKGGVVFNIAETTDVPIRYIGVGESIDDLRAFSPKQFVA 469

Query: 309 VI 310
            +
Sbjct: 470 AL 471


>gi|146276684|ref|YP_001166843.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554925|gb|ABP69538.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 410

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 191/277 (68%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE++LI++D+GV  A ++   +   RY + VS + +   ++  I ++L P
Sbjct: 135 RILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSSREIKEALATEIARILEP 194

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 195 VARPMPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 253

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N + LM  + K+
Sbjct: 254 QVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRTDLMEELSKI 313

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE+F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 314 VRVIRKKDPDAPHNTLLVLDATTGQNALSQVEIFRKLADVSGLVMTKLDGTAKGGVLVAL 373

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL PF  ++F+  + G  D
Sbjct: 374 ADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD 410


>gi|37527951|ref|NP_931296.1| cell division protein [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|36787387|emb|CAE16476.1| cell division protein [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 424

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/295 (43%), Positives = 193/295 (65%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 122 FFSRLKRSLVKTRQNLGSGFLSLFSGKKIDDDLFDELEEQLLIADVGVDTTRKIISSLTE 181

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L  ++KP + +    P+VIL+VGVNGVGKTT IGKL
Sbjct: 182 HASRKELKDAEALYAKLKEEMSGILTKVNKPLDIE-GKTPYVILMVGVNGVGKTTTIGKL 240

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D A++ ++A + A+A
Sbjct: 241 ARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQHTGADPASVIFDAIQSAKA 300

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N S LM  + K++RV+K+LD +APH ++ +LDA+TGQNA+ Q ++
Sbjct: 301 KSVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDENAPHEIMLILDASTGQNAISQAKL 360

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A DF
Sbjct: 361 FHEAVGLTGISLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADDF 415


>gi|119473191|ref|ZP_01614888.1| Cell division transporter substrate-binding protein FtsY
           [Alteromonadales bacterium TW-7]
 gi|119444555|gb|EAW25870.1| Cell division transporter substrate-binding protein FtsY
           [Alteromonadales bacterium TW-7]
          Length = 750

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T + +  G + I S +++DD + EELE  L+ +D+GV    K+++ L  
Sbjct: 444 FFSRLKKGLLKTRVNIGAGFSSIFSGKKIDDDLFEELETQLLTADLGVDTTMKLIDRLTD 503

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY++  + +  ML    +P       +P VIL+VGVNGVGKTT IGKL
Sbjct: 504 GANRKQLKDGDALYELMKQEMAAMLKTAEQPLTIPAEKKPFVILMVGVNGVGKTTTIGKL 563

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+  + G  VMLAAGDTFR+AA++QL++W +R S   +    G+D+A++ ++AF+ A+A
Sbjct: 564 AKQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVVFDAFQAAKA 623

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N   LM  + K+ RV+K++DP APH V+  +DA TGQNA+ QV +
Sbjct: 624 RNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQNAISQVNL 683

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ ++K+DGTA+GG +  +     IP+ ++GVGEGI+DL  F + DF
Sbjct: 684 FNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGEGIDDLRSFKSDDF 738


>gi|99081783|ref|YP_613937.1| signal recognition particle-docking protein FtsY [Ruegeria sp.
           TM1040]
 gi|99038063|gb|ABF64675.1| signal recognition particle-docking protein FtsY [Ruegeria sp.
           TM1040]
          Length = 386

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 193/284 (67%), Gaps = 2/284 (0%)

Query: 31  GITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS 89
           G T     RR LDD + E LE++LI SD+GV  A ++   +   R  + VS + +   ++
Sbjct: 100 GRTKPSEPRRVLDDDMLESLEEMLIASDMGVDTALRVTANIAEGRMGRRVSGREIRELLA 159

Query: 90  ELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT 149
             I +++ P+++P    +  +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDT
Sbjct: 160 AEIARVMEPVARPMPL-YPSKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDT 218

Query: 150 FRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNS 209
           FR+AA++QL++W DR     + +  GSD A+LA++A  +A+A   D+L+IDTAGRL N +
Sbjct: 219 FRAAAVEQLQVWGDRAGVPVLTAPEGSDPASLAFDAMTKAEADGADLLMIDTAGRLQNRA 278

Query: 210 ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGT 269
            LM  + K++RV+++ DP+APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGT
Sbjct: 279 DLMEELAKIVRVIRKKDPNAPHNTLLVLDATTGQNALSQVETFRQLADVSGLVMTKLDGT 338

Query: 270 ARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           A+GG L+ +     +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 339 AKGGVLVALADKFGLPIHAIGVGEQIDDLSPFDPEEFAAALTGL 382


>gi|159045265|ref|YP_001534059.1| hypothetical protein Dshi_2725 [Dinoroseobacter shibae DFL 12]
 gi|157913025|gb|ABV94458.1| hypothetical protein Dshi_2725 [Dinoroseobacter shibae DFL 12]
          Length = 499

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 189/274 (68%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R +DD + E LE++LI +D+GV  A ++   +   R  + VS   +   +++ I +++ P
Sbjct: 224 RVMDDAMLESLEEVLIAADMGVDTALRVSANIAEGRMGRKVSTNEIKRILADEIARIMEP 283

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 284 VAKPLPI-YPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKSVVIAAGDTFRAAAVEQL 342

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A KQAQA   D+L+IDTAGRL N + LM  + K+
Sbjct: 343 QVWGDRAGVPVLTAPEGSDPASLAFDAIKQAQASGADLLMIDTAGRLQNRADLMEELAKI 402

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV++++D  APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 403 VRVIRKVDETAPHNTLLVLDATTGQNALSQVETFRKLADVSGLVMTKLDGTAKGGVLVAL 462

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL PF  ++F+  +TG
Sbjct: 463 ADKFGLPIHAIGVGEQIDDLAPFDPEEFADALTG 496


>gi|197336427|ref|YP_002157238.1| cell division protein FtsY [Vibrio fischeri MJ11]
 gi|197317917|gb|ACH67364.1| cell division protein FtsY [Vibrio fischeri MJ11]
          Length = 412

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 198/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +    T   +  G   + S +++DD + EELE+ L+ +D+G+    +I++ L 
Sbjct: 108 SFFARLKRSLQRTKENIGAGFFGLFSGKKIDDELFEELEEQLLIADVGMDTTVRIIDSLT 167

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +D+     LY +  E + ++L  + +P   D  + PHVIL+VGVNGVGKTT IGK
Sbjct: 168 EKASKQDLKDGEALYGLLKEEMAEILAKVEQPLEIDEKNMPHVILMVGVNGVGKTTTIGK 227

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+  + G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ Y+A + A+
Sbjct: 228 LAKQFQNEGKSVMLAAGDTFRAAAVEQLQVWGQRNDVPVIAQHTGADSASVIYDAIEAAR 287

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+KVDV+I DTAGRL N S LM  + K++RV+K++DP APH ++  LDA TGQNA+ Q +
Sbjct: 288 ARKVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDPSAPHEIMLTLDAGTGQNAISQAK 347

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ F+GVGEGI+DL PFVA+DF
Sbjct: 348 LFSDVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRFIGVGEGIDDLRPFVAQDF 403


>gi|149914432|ref|ZP_01902963.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           AzwK-3b]
 gi|149811951|gb|EDM71784.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           AzwK-3b]
          Length = 439

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 196/294 (66%), Gaps = 3/294 (1%)

Query: 20  GFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDV 79
           G     L  KEG T  +  R LDD + E+LE+LLI +D+GV  A ++   +   R  + +
Sbjct: 146 GLLGRLLGRKEGKT--VVRRVLDDDMLEQLEELLISADMGVDTALRVTANMAEGRMGRKL 203

Query: 80  SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAG 139
           S Q +   +++ I +++ P+++P    +   P V+LVVGVNG GKTT IGKL+ +   AG
Sbjct: 204 SGQEIKELLAQEITRIMEPVARPMPI-YPKTPQVVLVVGVNGSGKTTTIGKLASQFKAAG 262

Query: 140 LKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLII 199
             V++AAGDTFR+AA++QL+IW  R     + +  GSD A+LA++A ++AQA   D+L+I
Sbjct: 263 KSVVIAAGDTFRAAAVEQLQIWGGRAGVPVLTAPEGSDPASLAFDAIEKAQADGADLLMI 322

Query: 200 DTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTT 259
           DTAGRL N + LM  + K++RV+++ DP APH+ L VLDATTGQNAL QVE F  +A  +
Sbjct: 323 DTAGRLQNRADLMEELAKIVRVIRKKDPGAPHNTLLVLDATTGQNALSQVETFQKLADVS 382

Query: 260 GLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           GL+MTK+DGTA+GG L+ +     +P++ +GVGE I+DL PF  +DF+A + G 
Sbjct: 383 GLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEDFAAALIGL 436


>gi|114771713|ref|ZP_01449117.1| signal recognition particle-docking protein FtsY [alpha
           proteobacterium HTCC2255]
 gi|114547785|gb|EAU50675.1| signal recognition particle-docking protein FtsY [alpha
           proteobacterium HTCC2255]
          Length = 502

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 185/273 (67%), Gaps = 1/273 (0%)

Query: 41  LDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLS 100
            DD + E LE+LLI +D+GV  + ++   +      K VSV  V   +   + ++L P++
Sbjct: 229 FDDNMLESLEELLISADMGVDTSLRVSANMADGNLGKKVSVNEVKILLGNEVARILEPVA 288

Query: 101 KPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKI 160
           KP    +S +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL++
Sbjct: 289 KPMPL-YSQKPQVVLVVGVNGSGKTTTIGKLASQFRSAGKSVVIAAGDTFRAAAVEQLQV 347

Query: 161 WADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIR 220
           W +R     + +  GSD A+LA++A  + +   VD+L+IDTAGRL N   LM  + K++R
Sbjct: 348 WGERAGVPVLTAPEGSDPASLAFDAMNKCKNDNVDLLMIDTAGRLQNRKDLMEELDKIVR 407

Query: 221 VLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVV 280
           V+++ DP APH+ L VLDATTGQNA+RQVE+F  V+  TGL+MTK+DGTA+GG L+ +  
Sbjct: 408 VIQKNDPSAPHNTLLVLDATTGQNAIRQVEVFQEVSKVTGLVMTKLDGTAKGGVLVALAD 467

Query: 281 THKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
              +P++ +GVGE I+DL+ F  KDF+  +TG 
Sbjct: 468 KFGLPIHAIGVGEQIDDLQAFDPKDFAKALTGS 500


>gi|126461266|ref|YP_001042380.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126102930|gb|ABN75608.1| signal recognition particle-docking protein FtsY [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 379

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 190/277 (68%), Gaps = 1/277 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE++LI++D+GV  A ++   +   RY + VS + +   ++  I ++L P
Sbjct: 104 RILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSAREIKEALAAEIARILEP 163

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 164 VARPMPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 222

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N + LM  + K+
Sbjct: 223 QVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSKI 282

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+ + DP APH+ L VLDATTGQNAL QVE+F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 283 VRVIHKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLVAL 342

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
                +P++ +GVGE I+DL PF  ++F+  + G  D
Sbjct: 343 ADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD 379


>gi|296284752|ref|ZP_06862750.1| signal recognition particle-docking protein FtsY [Citromicrobium
           bathyomarinum JL354]
          Length = 313

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 137/301 (45%), Positives = 190/301 (63%), Gaps = 3/301 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSR---RLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +L  GF  TS +L E I  +  +R   RLDD   +E+ED LI SD+G   A ++ E L  
Sbjct: 12  RLLGGFRKTSDRLSENIAPVSQTRGNTRLDDATLDEIEDALIMSDLGPEAAGRVREALRE 71

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
           +R+  +++ +++   V++ I  +L P++KP       RP VILV+GVNG GKTT I KL+
Sbjct: 72  QRFGAEITERQLREAVADEIAAILRPVAKPLEVTAFPRPQVILVIGVNGSGKTTTIAKLA 131

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
               +   +VMLAAGDTFR+AAI QL+ WADR     V    G D A++ ++A K+   +
Sbjct: 132 HLFMEDDYEVMLAAGDTFRAAAIGQLQTWADRVGVPLVRGPEGGDPASIVFDAVKRGTDE 191

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             D LI+DTAGRL N   LM  + K+ +VL RL+P APH V+ VLDAT GQNAL Q+++F
Sbjct: 192 GTDALIVDTAGRLQNKRELMDELAKIRKVLGRLNPEAPHDVVLVLDATNGQNALSQIDVF 251

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             VAG TGLIMTK+DGTARGG L+     + +P++ +GVGE ++DL PF     + VI G
Sbjct: 252 QEVAGVTGLIMTKLDGTARGGILVAAAQKYGLPIHAIGVGEQLDDLRPFDPDLVARVIAG 311

Query: 313 C 313
            
Sbjct: 312 V 312


>gi|329891229|ref|ZP_08269572.1| signal recognition particle-docking protein FtsY [Brevundimonas
           diminuta ATCC 11568]
 gi|328846530|gb|EGF96094.1| signal recognition particle-docking protein FtsY [Brevundimonas
           diminuta ATCC 11568]
          Length = 311

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 193/303 (63%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++L++G + +S ++ + +        L +   E LE+ LI SD+G A + +IVE    
Sbjct: 9   WFQRLSEGLSRSSKQMTDQVVSTFVKEPLSEEALERLEEHLIESDLGPAASARIVERFRE 68

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K    + +   ++E +   L P    F+     +P+V+L VGVNG GKTT +GK++
Sbjct: 69  LRFGKTSDEREIKQALAEAVAAELTPRQATFDPLSGPKPYVVLFVGVNGSGKTTTLGKIA 128

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             ++  G KVM+ AGDTFR+AA +QLK+WADR  A F     G+DAA LA++AF +A+ +
Sbjct: 129 SDLTAKGAKVMIVAGDTFRAAAREQLKVWADRAGAHFESRRDGADAAGLAFDAFAKAKEE 188

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DV++IDTAGRL N S LM  + K++RVLK++DP APH  L VLDAT G+NAL Q ++F
Sbjct: 189 GFDVVLIDTAGRLQNKSTLMDELLKIVRVLKKVDPDAPHETLLVLDATVGRNALEQEKIF 248

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              A  +G++MTK+DGTARGG L+P+      P+  +GVGEG+ DL+PF A+ FS  + G
Sbjct: 249 GRTAYVSGVVMTKLDGTARGGVLVPVAQASDAPIKLIGVGEGVEDLQPFDARAFSRSLVG 308

Query: 313 CLD 315
             D
Sbjct: 309 LED 311


>gi|294677911|ref|YP_003578526.1| cell division protein FtsY [Rhodobacter capsulatus SB 1003]
 gi|294476731|gb|ADE86119.1| cell division protein FtsY [Rhodobacter capsulatus SB 1003]
          Length = 479

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 191/278 (68%), Gaps = 1/278 (0%)

Query: 36  ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKM 95
           +  R LDD + E +EDLLI +D+GV  A ++   L   R  + +SV  +   ++  + ++
Sbjct: 200 VPRRVLDDAMLESIEDLLIAADMGVDTALRVTANLAEGRMGRKLSVPELKDILAAEVARI 259

Query: 96  LMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI 155
           + P+++P    ++ RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA+
Sbjct: 260 MEPVARPMPL-YARRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVIIAAGDTFRAAAV 318

Query: 156 DQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGI 215
           +QLK+W DR     + +  G+D A+ AY+A  +A A+ VD+L+IDTAGRL N + LM  +
Sbjct: 319 EQLKVWGDRAGVPVMTAPEGADPASFAYDALTRAAAEGVDLLMIDTAGRLQNRADLMEEL 378

Query: 216 GKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGL 275
            K++RV++++D  APH+ L VLDATTGQNAL QVE+F  ++  +GL+MTK+DGTA+GG L
Sbjct: 379 AKIVRVIRKIDESAPHNTLLVLDATTGQNALAQVEVFRKISDVSGLVMTKLDGTAKGGVL 438

Query: 276 IPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           + +     +P++ +GVGE I+DL PF  ++F+A + G 
Sbjct: 439 VALADKFGLPIHAIGVGEQIDDLSPFDPEEFAAALVGI 476


>gi|258543517|ref|YP_003188950.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-01]
 gi|256634595|dbj|BAI00571.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-01]
 gi|256637651|dbj|BAI03620.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-03]
 gi|256640705|dbj|BAI06667.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-07]
 gi|256643760|dbj|BAI09715.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-22]
 gi|256646815|dbj|BAI12763.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-26]
 gi|256649868|dbj|BAI15809.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-32]
 gi|256652858|dbj|BAI18792.1| cell division protein FtsY [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655912|dbj|BAI21839.1| cell division protein FtsY [Acetobacter pasteurianus IFO 3283-12]
          Length = 309

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 146/306 (47%), Positives = 215/306 (70%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +L +  +L +G + ++ KL  GIT I + R+LDD   EELEDLLI +D+G AVA++I+E 
Sbjct: 2   ALGFFSRLKQGLSRSTQKLGGGITGIFTKRKLDDEALEELEDLLITADMGPAVAERIIES 61

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             + R+  +V+ + +   +++ I  +L P++KPF  D +H+PHV+LVVGVNGVGKTT IG
Sbjct: 62  FRSSRFGTEVTDEEIRNTLADEIATILEPVAKPFEPDPAHKPHVVLVVGVNGVGKTTTIG 121

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K+++  ++ G KVM+ AGDTFR+AA++QL+IW +RT    +    G+DAA LA+EA K+ 
Sbjct: 122 KMARFFTEEGKKVMMVAGDTFRAAAVEQLQIWGERTGCPVIAGPPGADAAGLAFEALKRG 181

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+  D+L +DTAGRLHN S LM  + K+IRV+++ D  APHSVL VLDATTGQNA+ QV
Sbjct: 182 KAEGADLLFVDTAGRLHNKSALMEELAKIIRVMRKFDETAPHSVLLVLDATTGQNAVEQV 241

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
            +F  +   TGL++TK+DG+ARGG ++ +     +PV+ +GVGE   DL PF A D++  
Sbjct: 242 RVFRELVNVTGLVVTKLDGSARGGIVVALADQFGLPVHAVGVGEQAEDLRPFSAVDYARG 301

Query: 310 ITGCLD 315
           + G  D
Sbjct: 302 LVGVAD 307


>gi|126728988|ref|ZP_01744803.1| Signal recognition particle-docking protein FtsY [Sagittula
           stellata E-37]
 gi|126710918|gb|EBA09969.1| Signal recognition particle-docking protein FtsY [Sagittula
           stellata E-37]
          Length = 357

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 193/284 (67%), Gaps = 2/284 (0%)

Query: 31  GITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS 89
           G  D    RR LDD + E LE+LLI SD+GV  A ++   +   R  + VS + +   ++
Sbjct: 73  GQPDSAEPRRVLDDDMLESLEELLIASDMGVDTALRVTSNIAEGRMGRRVSAREIKELLA 132

Query: 90  ELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT 149
           E I +++  +++P    +  +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDT
Sbjct: 133 EEIARVMESVARPLPI-YPKKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDT 191

Query: 150 FRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNS 209
           FR+AA++QL++W +R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N +
Sbjct: 192 FRAAAVEQLQVWGERAGVPVLTAPEGSDPASLAFDAMGKAQAEGADLLMIDTAGRLQNRA 251

Query: 210 ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGT 269
            LM  + K++RV+++ DP APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGT
Sbjct: 252 DLMEELAKIVRVIRKKDPDAPHNTLLVLDATTGQNALIQVEAFRQLADVSGLVMTKLDGT 311

Query: 270 ARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           A+GG L+ +     +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 312 AKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGL 355


>gi|126740023|ref|ZP_01755713.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           SK209-2-6]
 gi|126718842|gb|EBA15554.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           SK209-2-6]
          Length = 378

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 191/275 (69%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R  K +S + +   ++  + +++  
Sbjct: 102 RVLDDDMLEQLEELLIAADMGVDTALRVTSNMAEGRLGKKLSAREIKELLAAEVARVMET 161

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    ++HRP V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 162 VAKPMPI-YAHRPQVVLVVGVNGSGKTTTIGKLASQFKGAGKKVVIAAGDTFRAAAVEQL 220

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W +R     + +  GSD A+LA++A  +AQ +  D+L+IDTAGRL N + LM  + K+
Sbjct: 221 QVWGERAGVPVLTAPEGSDPASLAFDAMTKAQEEGADLLMIDTAGRLQNRADLMEELAKI 280

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QVE F  ++  +GL+MTK+DGTA+GG L+ +
Sbjct: 281 VRVIRKKDETAPHNTLLVLDATTGQNALSQVETFRKISDVSGLVMTKLDGTAKGGVLVAL 340

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+A +TG 
Sbjct: 341 ADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALTGL 375


>gi|59713060|ref|YP_205836.1| fused Signal recognition particle (SRP) receptor: membrane binding
           protein/ protein [Vibrio fischeri ES114]
 gi|59481161|gb|AAW86948.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Vibrio fischeri ES114]
          Length = 412

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 198/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +    T   +  G   + S +++DD + EELE+ L+ +D+G+    +I++ L 
Sbjct: 108 SFFARLKRSLQRTKENIGAGFFGLFSGKKIDDELFEELEEQLLIADVGMDTTVRIIDSLT 167

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +D+     LY +  E + ++L  + +P   +  + PHVIL+VGVNGVGKTT IGK
Sbjct: 168 EKASKQDLKDGEALYGLLKEEMAEILAKVEQPLEINEKNMPHVILMVGVNGVGKTTTIGK 227

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+  + G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ Y+A + A+
Sbjct: 228 LAKQFQNEGKSVMLAAGDTFRAAAVEQLQVWGQRNDVPVIAQHTGADSASVIYDAIEAAR 287

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+KVDV+I DTAGRL N S LM  + K++RV+K++DP APH ++  LDA TGQNA+ Q +
Sbjct: 288 ARKVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDPSAPHEIMLTLDAGTGQNAISQAK 347

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ F+GVGEGI+DL PFVA+DF
Sbjct: 348 LFSDVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRFIGVGEGIDDLRPFVAQDF 403


>gi|255319577|ref|ZP_05360790.1| signal recognition particle-docking protein FtsY [Acinetobacter
           radioresistens SK82]
 gi|255303375|gb|EET82579.1| signal recognition particle-docking protein FtsY [Acinetobacter
           radioresistens SK82]
          Length = 366

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 198/301 (65%), Gaps = 2/301 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           S+  ++ +G   T   L +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L
Sbjct: 61  SFFSRMKQGLTKTRKNLADGMVNILIGGKEIDDELLEEVEEQLLVADIGVEATKTIINNL 120

Query: 71  LTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             +    D+     LY  + E +  +L P  KP + D +  P+VILVVGVNGVGKTT IG
Sbjct: 121 TERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKNPYVILVVGVNGVGKTTTIG 180

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A
Sbjct: 181 KLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDVQVVAQGHGADSASVIFDAFESA 240

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV
Sbjct: 241 RAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQV 300

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           +MF    G TGL +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A 
Sbjct: 301 QMFDEAVGLTGLTITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKAFVAA 360

Query: 310 I 310
           +
Sbjct: 361 L 361


>gi|315497314|ref|YP_004086118.1| signal recognition particle-docking protein ftsy [Asticcacaulis
           excentricus CB 48]
 gi|315415326|gb|ADU11967.1| signal recognition particle-docking protein FtsY [Asticcacaulis
           excentricus CB 48]
          Length = 313

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 201/313 (64%), Gaps = 14/313 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W  +LT+G + TS +L E +T + ++++ LD    E LED+LI SD G  +A  I  ++ 
Sbjct: 8   WFSRLTQGLSKTSQQLTEQVTSVFVANKTLDAAAVEALEDMLIESDFGPHIAASIAGKMA 67

Query: 72  TKRYAK--DVSVQRVLYDVSELIHK----MLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
            K++A   D +V+  L +      K       PLS P       +P+++L VGVNG GKT
Sbjct: 68  AKKFASTDDYAVKEALAEAIAEELKGREDRFDPLSGP-------KPYIVLFVGVNGSGKT 120

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T +GK++  ++  G KV++ AGDTFR+AA++QLK+WA+R  ADF+  + G+DAA LAY+A
Sbjct: 121 TTLGKIAAALTTKGAKVLIVAGDTFRAAAVEQLKVWAERAKADFMGRKTGADAAGLAYDA 180

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
             +A+ +  DV++IDTAGRL N   LM  + K++RV+K++DP APH  L VLDAT G+NA
Sbjct: 181 TVRAKEEGYDVVLIDTAGRLQNKQQLMDELLKIVRVIKKVDPDAPHETLLVLDATVGRNA 240

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q ++F   A  +GL+MTK+DGTARGG L+PI      P+  +GVGE I+DL+PF A  
Sbjct: 241 LSQEQIFGRQAFVSGLVMTKLDGTARGGILVPIAKASDAPIKLIGVGEDIDDLQPFRASA 300

Query: 306 FSAVITGCLDYGE 318
           F+  + G    G+
Sbjct: 301 FARSMVGLEPLGD 313


>gi|262370504|ref|ZP_06063830.1| cell division protein [Acinetobacter johnsonii SH046]
 gi|262314846|gb|EEY95887.1| cell division protein [Acinetobacter johnsonii SH046]
          Length = 368

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 201/311 (64%), Gaps = 2/311 (0%)

Query: 2   SNQKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGV 60
           S +  ASE   +  ++  G   T   L +G+ +I I  + +DD + EE+E+ L+ +DIGV
Sbjct: 53  SEETEASERGGFFSRMKVGLTKTRKNLADGMVNILIGGKEIDDELLEEVEEQLLVADIGV 112

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
              + I+  L  +    D+     LY  + E +  +L P  KP + D +  P+VILVVGV
Sbjct: 113 DATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKTPYVILVVGV 172

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NGVGKTT IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R +   V    G+D+A
Sbjct: 173 NGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNNIAVVAQGHGADSA 232

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           ++ ++AF+ A+AK VDVLI DTAGRLHN   LM  + K+ RV++++D  APH V+ V+DA
Sbjct: 233 SVIFDAFESARAKGVDVLIADTAGRLHNKGHLMQELTKVKRVMQKIDATAPHEVMLVVDA 292

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
            TGQNA+ QVEMF    G TGL +TK+DGTA+GG L  I     +P+ F+GVGE I+DL 
Sbjct: 293 GTGQNAINQVEMFDEAVGLTGLTITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLR 352

Query: 300 PFVAKDFSAVI 310
           PF AK F A +
Sbjct: 353 PFSAKSFVAAL 363


>gi|332975302|gb|EGK12201.1| cell division protein FtsY [Psychrobacter sp. 1501(2011)]
          Length = 407

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 135/301 (44%), Positives = 193/301 (64%), Gaps = 4/301 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W  ++  G   +   L EG+ +I I  + +DD + EE+ED L+ +DIGV    KI++ L 
Sbjct: 103 WFSRMKSGLTKSRKNLAEGVANILIGGKEIDDELLEEVEDQLLVADIGVEATDKIIKSLT 162

Query: 72  TKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
            +    D+     LY     EL+  +L P   P   D S +P VILVVGVNGVGKTT IG
Sbjct: 163 EQTARGDLIYSHSLYKALQKELVE-ILEPKVAPLIIDTSKKPFVILVVGVNGVGKTTTIG 221

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+K++   G  VMLAAGDTFR+AA +QL+IW +R +   V    G+D+A++ ++A + A
Sbjct: 222 KLAKRLQAEGKSVMLAAGDTFRAAATEQLQIWGERNNIPVVAQGHGADSASVVFDAMQSA 281

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +AK +DVLI DTAGRL N + LMA + K++R++++ DP APH  + VLDA TGQNA+ QV
Sbjct: 282 KAKNIDVLIADTAGRLQNKTHLMAELEKVVRIMRKSDPTAPHEGMIVLDAGTGQNAINQV 341

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           ++F+     TG+ +TK+DGTA+GG +  I  T  IP+ ++GVGE I+DL  F  K F A 
Sbjct: 342 KIFNDAVPLTGITITKLDGTAKGGVVFNIANTTDIPIRYIGVGESIDDLRAFSPKQFVAA 401

Query: 310 I 310
           +
Sbjct: 402 L 402


>gi|148652808|ref|YP_001279901.1| signal recognition particle-docking protein FtsY [Psychrobacter sp.
           PRwf-1]
 gi|148571892|gb|ABQ93951.1| signal recognition particle-docking protein FtsY [Psychrobacter sp.
           PRwf-1]
          Length = 397

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 198/310 (63%), Gaps = 4/310 (1%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           QK   +   W  ++  G + +   L EG+ +I I  + +DD + EE+ED L+ +DIGV  
Sbjct: 84  QKEDKKRGGWFSRMKSGLSKSRKNLAEGVANILIGGKEIDDELLEEVEDQLLVADIGVEA 143

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
             KI++ L  +    D+     LY     EL+ ++L P   P   D S +P VILVVGVN
Sbjct: 144 TDKIIKSLTEQTARGDLIYSHSLYKALQKELV-EILEPKVAPLIIDTSKKPFVILVVGVN 202

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           GVGKTT IGKL+K++   G  VMLAAGDTFR+AA +QL++W +R +   V    G+D+A+
Sbjct: 203 GVGKTTTIGKLAKRLQGEGKSVMLAAGDTFRAAATEQLQVWGERNNIPVVAQGHGADSAS 262

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           + ++A + A+AK +DVLI DTAGRL N + LMA + K++R++++ DP APH  + VLDA 
Sbjct: 263 VVFDAMQSAKAKNIDVLIADTAGRLQNKTHLMAELEKVVRIMRKSDPTAPHEGMIVLDAG 322

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNA+ QV++F+     TG+ +TK+DGTA+GG +  I  T  IP+ ++GVGE I+DL  
Sbjct: 323 TGQNAINQVKIFNDAVPLTGITITKLDGTAKGGVVFNIANTTDIPIRYIGVGESIDDLRA 382

Query: 301 FVAKDFSAVI 310
           F  K F A +
Sbjct: 383 FSPKQFVAAL 392


>gi|85708148|ref|ZP_01039214.1| signal recognition particle GTPase [Erythrobacter sp. NAP1]
 gi|85689682|gb|EAQ29685.1| signal recognition particle GTPase [Erythrobacter sp. NAP1]
          Length = 304

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 191/304 (62%), Gaps = 2/304 (0%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           S SW  +L  GF  TS +L   +T + +  RLD+   +++ED LI SD+G A A +I  +
Sbjct: 2   STSWSDRLLGGFRKTSERLGANLTGVAT--RLDEATLDDVEDALIISDLGPAAAARIRAK 59

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           L  K +  +++ + +   V+E I ++L P++KP       RP VILV+GVNG GKTT I 
Sbjct: 60  LKEKSFGLEITQRELKEAVAEEIAEILRPVAKPLEITAFPRPQVILVIGVNGSGKTTTIA 119

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+   ++    V+LAAGDTFR+AAI QL  WA+R   D V    G D A++ ++A KQA
Sbjct: 120 KLAHLFTEDDYGVLLAAGDTFRAAAIGQLATWAERAGVDLVRGPEGGDPASIVFDAVKQA 179

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
               +D L++DTAGRL N   LM  + K+ RVL RL+  APH V+ VLDAT GQNAL Q+
Sbjct: 180 TDTGIDALVVDTAGRLQNKKELMEELAKIRRVLGRLNEEAPHDVVLVLDATNGQNALSQI 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           ++F  VAG TGLIMTK+DGTARGG L+     + +P++ +GVGE + DL PF     + V
Sbjct: 240 DVFQEVAGVTGLIMTKLDGTARGGVLVAAAEQYGLPIHAIGVGEKMEDLRPFDPDLVARV 299

Query: 310 ITGC 313
           I G 
Sbjct: 300 IAGV 303


>gi|300114349|ref|YP_003760924.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           watsonii C-113]
 gi|299540286|gb|ADJ28603.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           watsonii C-113]
          Length = 352

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 196/302 (64%), Gaps = 2/302 (0%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQK 65
           A E  S  ++L +    T   L  GI D++  ++ +DD + EE+E  L+ +D+GV   Q 
Sbjct: 27  AREKQSLFKRLRERLGRTRNNLTGGIADLMLGKKSIDDELLEEIEAQLLIADVGVEATQA 86

Query: 66  IVEELLTKRYAKDVS-VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           I+++L  +   K +   + ++  + E +  +L P ++P     + +P VIL+VGVNGVGK
Sbjct: 87  IIKDLTVRTSRKQLQDAEALMAALRENMQALLTPCNQPLIIPAAIQPFVILMVGVNGVGK 146

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+KK    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++
Sbjct: 147 TTTIGKLAKKFQAEGRSVMLAAGDTFRAAAVEQLQVWGERNQVPVMAQHGGADSASVIFD 206

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + AQA+ +DVLI DTAGRLH    LM  + K+ RV+ +++PHAPH ++  +DA TGQN
Sbjct: 207 AVQSAQARGIDVLIADTAGRLHTQINLMEELKKIKRVMGKVNPHAPHEIMLTVDAGTGQN 266

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           AL Q + FH   G TG+I+TK+DGTA+GG +  I     IP+ F+GVGEGI+DL PF A+
Sbjct: 267 ALNQAKQFHEAVGLTGIILTKLDGTAKGGVIFAIAKKMGIPIRFIGVGEGIDDLRPFNAE 326

Query: 305 DF 306
           +F
Sbjct: 327 EF 328


>gi|332995325|gb|AEF05380.1| signal recognition particle GTPase [Alteromonas sp. SN2]
          Length = 530

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 132/316 (41%), Positives = 197/316 (62%), Gaps = 6/316 (1%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           E  S   +L +  + T   L  G+  +   + +DD + E+LE  L+ +D+G+   QKI+ 
Sbjct: 215 EKKSLFSRLKESLSRTKANLGSGLVSLFKGKAIDDELYEDLETQLLVADVGMDTTQKIIT 274

Query: 69  ELLTKRYAKDVSVQRVLYDV-----SELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGV 122
            L      KD+     L D+     + ++ K+  PLS   N   S   P VIL+VGVNGV
Sbjct: 275 HLTDSASRKDLKDAEALLDILKQQMAGMLSKVNEPLSDAINAHNSDEGPFVILMVGVNGV 334

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R S   +    G+D+A++ 
Sbjct: 335 GKTTTIGKLAKQFQQQGKKVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVL 394

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+++K D+LI DTAGRL N   LM  + K++RV+K+L+P+APH V+  LDA TG
Sbjct: 395 YDALEAAKSRKTDILIADTAGRLQNKDNLMEELKKVVRVMKKLNPNAPHEVMLTLDAGTG 454

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI+DL  F 
Sbjct: 455 QNAISQAKLFNQAVGLTGITLTKLDGTAKGGVIFSIADKFGIPIRYIGVGEGIDDLRQFD 514

Query: 303 AKDFSAVITGCLDYGE 318
            ++F   +   +D GE
Sbjct: 515 GQEFIDALFSEIDSGE 530


>gi|330831384|ref|YP_004394336.1| ABC transporter permease [Aeromonas veronii B565]
 gi|328806520|gb|AEB51719.1| ABC transporter permease component [Aeromonas veronii B565]
          Length = 557

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   +  G   +   +++DD + EELE  L+ +D+GV    +I+E L+ 
Sbjct: 254 FFARLKRSLVRTKENIGSGFFGLFRGKKIDDELFEELETQLLTADLGVDTTTRIIEGLVQ 313

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + +ML  + +P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 314 HADRKQLKDAEALYGLLKQDMGEMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKL 373

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ Y+A + A++
Sbjct: 374 AKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAARS 433

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVLI DTAGRL N S LM  + K++RV+K+LD  APH ++  LDA TGQNAL Q ++
Sbjct: 434 RGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDEEAPHEIMLTLDAGTGQNALSQAKL 493

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PFVA DF
Sbjct: 494 FSEAVGLTGITLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDF 548


>gi|83950639|ref|ZP_00959372.1| signal recognition particle-docking protein FtsY [Roseovarius
           nubinhibens ISM]
 gi|83838538|gb|EAP77834.1| signal recognition particle-docking protein FtsY [Roseovarius
           nubinhibens ISM]
          Length = 489

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 188/274 (68%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R  K +S Q +   ++  I +++ P
Sbjct: 214 RALDDDMLEQLEELLITADMGVDTALRVTANMAEGRMGKRLSTQEIKELLAAEIARIMEP 273

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    ++  P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 274 VARPMPL-YTKSPQVVLVVGVNGSGKTTTIGKLASQFKAAGKSVVIAAGDTFRAAAVEQL 332

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ    D+L+IDTAGRL N + LM  + K+
Sbjct: 333 QVWGDRAGVPVLTAPEGSDPASLAFDAMDRAQRDGADLLMIDTAGRLQNRADLMEELAKI 392

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QV+ F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 393 VRVIRKKDETAPHNTLLVLDATTGQNALSQVKTFQELADVSGLVMTKLDGTAKGGVLVAL 452

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL PF  +DF+A +TG
Sbjct: 453 ADKFGLPIHAIGVGEQIDDLAPFDPEDFAAALTG 486


>gi|332531762|ref|ZP_08407647.1| signal recognition particle receptor protein FtsY
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038738|gb|EGI75180.1| signal recognition particle receptor protein FtsY
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 432

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T + +  G   I S +++DD + E+LE  L+ +D+GV    K+++ L  
Sbjct: 126 FFSRLKKGLLKTRVNIGSGFASIFSGKKIDDELFEDLETQLLTADLGVDTTMKLIDRLTD 185

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY++  + +  ML    +P       +P VIL+VGVNGVGKTT IGK+
Sbjct: 186 AANRKQLKDGDALYELMKQEMAAMLKTAEQPLVISEDKKPFVILMVGVNGVGKTTTIGKM 245

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+  + G  VMLAAGDTFR+AA++QL++W +R S   +    G+D+A++ ++AF+ A+A
Sbjct: 246 AKQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVVFDAFQAAKA 305

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N   LM  + K+ RV+K++DP APH V+  +DA TGQNA+ QV +
Sbjct: 306 RNIDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQNAISQVNL 365

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ ++K+DGTA+GG +  +     IP+ ++GVGEGI+DL  F + DF
Sbjct: 366 FNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGEGIDDLRAFKSDDF 420


>gi|315127796|ref|YP_004069799.1| cell division transporter substrate-binding protein
           [Pseudoalteromonas sp. SM9913]
 gi|315016310|gb|ADT69648.1| cell division transporter substrate-binding protein
           [Pseudoalteromonas sp. SM9913]
          Length = 498

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T + +  G   I S +++DD + EELE  L+ +D+GV    K+++ L  
Sbjct: 192 FFSRLKKGLLKTRVNIGSGFASIFSGKKIDDELFEELETQLLTADLGVDTTMKLIDSLTD 251

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY++  + +  ML    +P       +P VIL+VGVNGVGKTT IGK+
Sbjct: 252 AADRKQLKDGDALYELMKQEMATMLKTAEQPLEIPADKKPFVILMVGVNGVGKTTTIGKM 311

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+  + G  VMLAAGDTFR+AA++QL++W +R S   +    G+D+A++ ++AF+ A+A
Sbjct: 312 AKQFQNQGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVVFDAFQAAKA 371

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N   LM  + K+ RV+K++DP APH V+  +DA TGQNA+ QV +
Sbjct: 372 RNVDVLIADTAGRLQNKDNLMQELEKIARVMKKVDPDAPHEVMLTIDAGTGQNAISQVNL 431

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ ++K+DGTA+GG +  +     IP+ ++GVGE I+DL  F + DF
Sbjct: 432 FNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGESIDDLRTFKSDDF 486


>gi|58039892|ref|YP_191856.1| cell division protein FtsY-like protein [Gluconobacter oxydans
           621H]
 gi|58002306|gb|AAW61200.1| Cell division protein FtsY-like protein [Gluconobacter oxydans
           621H]
          Length = 319

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 203/300 (67%), Gaps = 4/300 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G + +S +L      + + R+LD+   EELED LI +D+G AVA++++E   +
Sbjct: 4   FFSRLKQGLSRSSSRLGA----VFTHRKLDETALEELEDELIAADLGPAVAERVIENFRS 59

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ KDV+   +   ++  I ++L P++ PF  D   +PHV+LVVGVNGVGKTT IGK++
Sbjct: 60  TRFGKDVTSDEIRETLATEIARVLEPVAIPFEPDPKKKPHVVLVVGVNGVGKTTTIGKMA 119

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
           +  ++ G  VML AGDTFR+AA++QL++W  R +   +  + G+DAA LAY+  K+A   
Sbjct: 120 RHYTEEGKSVMLVAGDTFRAAAVEQLEVWGKRANVPVIAGKHGADAAGLAYDGLKRATEA 179

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             D+L+IDTAGRLHN   LM  + K+IRV+++ D  APHSVL VLDATTGQNA+ QV +F
Sbjct: 180 GTDLLLIDTAGRLHNKGALMEELAKIIRVMRKFDETAPHSVLLVLDATTGQNAIEQVRVF 239

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
             +   TGLI+TK+DG+ARGG ++ +    K+PV+ +GVGE   DL PF A++++  + G
Sbjct: 240 RELVNVTGLIVTKLDGSARGGIVVALAEQFKLPVHMVGVGEQAEDLRPFSAQEYAKGLVG 299


>gi|262379876|ref|ZP_06073032.1| signal recognition particle-docking protein FtsY [Acinetobacter
           radioresistens SH164]
 gi|262299333|gb|EEY87246.1| signal recognition particle-docking protein FtsY [Acinetobacter
           radioresistens SH164]
          Length = 366

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 197/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G   T   L +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 62  FFSRMKQGLTKTRKNLADGMVNILIGGKEIDDELLEEVEEQLLVADIGVEATKTIINNLT 121

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VILVVGVNGVGKTT IGK
Sbjct: 122 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKNPYVILVVGVNGVGKTTTIGK 181

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A+
Sbjct: 182 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDVQVVAQGHGADSASVIFDAFESAR 241

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 242 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 301

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           MF    G TGL +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 302 MFDEAVGLTGLTITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKAFVAAL 361


>gi|90023237|ref|YP_529064.1| signal recognition particle-docking protein FtsY [Saccharophagus
           degradans 2-40]
 gi|89952837|gb|ABD82852.1| signal recognition particle-docking protein FtsY [Saccharophagus
           degradans 2-40]
          Length = 375

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 137/314 (43%), Positives = 207/314 (65%), Gaps = 6/314 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           SE L    ++ +G + TS +   G+++++  ++ +DD + EE+E LL+ +D+G+     I
Sbjct: 62  SEKLGVFARIKRGLSRTSNQFANGLSNLLLGKKAIDDELLEEIETLLLMADVGMDATTDI 121

Query: 67  VEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSH----RPHVILVVGVNG 121
           +E+L  +   K ++    LYD + E + K+L  +  PF+ + SH     P+VILVVGVNG
Sbjct: 122 IEDLTDRVARKQLNDSEALYDALRESLAKLLQQVEVPFDLEQSHAPLPSPYVILVVGVNG 181

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
           VGKTT IGKL+K+  + G  V+LAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 182 VGKTTTIGKLAKRYQNQGKSVILAAGDTFRAAAVEQLQVWGERNKVPVIAQHSGADSASV 241

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + AQA+ +DVLI DTAGRLHN S LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 242 IFDAVQSAQARGIDVLIADTAGRLHNKSNLMEELAKVKRVMGKLDNTAPHEVLLVLDAGT 301

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F   A  TGL++TK+DGTA+GG +  +   H IPV ++GVGE ++DL+PF
Sbjct: 302 GQNAVSQADHFKKAADVTGLVLTKLDGTAKGGIIFALSKKHNIPVRYIGVGESVDDLQPF 361

Query: 302 VAKDFSAVITGCLD 315
            AK F+  +    D
Sbjct: 362 DAKKFTEALFSTSD 375


>gi|260577029|ref|ZP_05845009.1| signal recognition particle-docking protein FtsY [Rhodobacter sp.
           SW2]
 gi|259020785|gb|EEW24101.1| signal recognition particle-docking protein FtsY [Rhodobacter sp.
           SW2]
          Length = 339

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 187/276 (67%), Gaps = 1/276 (0%)

Query: 37  SSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKML 96
           S R LDD + E LE++LI +D+GV  A ++   +   R  K VS   +   ++  I +++
Sbjct: 62  SRRVLDDAMLERLEEVLIEADMGVDCALRVTANIAEGRMGKRVSTAELKEALATEIARIM 121

Query: 97  MPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAID 156
            P+++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++
Sbjct: 122 TPVARPLPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKSVVIAAGDTFRAAAVE 180

Query: 157 QLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIG 216
           QL++W  R     + +  GSD A+LA++A  +AQA   D+L+IDTAGRL N + LM  + 
Sbjct: 181 QLQVWGQRAGVPVLTAPEGSDPASLAFDAMTKAQADGADLLMIDTAGRLQNRADLMEELS 240

Query: 217 KMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLI 276
           K++RV+++ DP APH+ + VLDATTGQNA+ QVE+F  +A  +GL+MTK+DGTA+GG L+
Sbjct: 241 KIVRVIRKKDPDAPHNTILVLDATTGQNAINQVEIFRKLADVSGLVMTKLDGTAKGGILV 300

Query: 277 PIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
            +     +P++ +GVGE I+DL PF  +DF+  + G
Sbjct: 301 ALADKFGLPIHAIGVGEQIDDLAPFDPEDFARALVG 336


>gi|302877705|ref|YP_003846269.1| signal recognition particle-docking protein FtsY [Gallionella
           capsiferriformans ES-2]
 gi|302580494|gb|ADL54505.1| signal recognition particle-docking protein FtsY [Gallionella
           capsiferriformans ES-2]
          Length = 321

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/313 (44%), Positives = 205/313 (65%), Gaps = 12/313 (3%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAV 62
           ++  +E  SWI +L  G + T  +L     D+ S   ++DD + EELE +LI +D+G+  
Sbjct: 14  EETVAEKRSWIDRLKAGLSRTGNQL----ADLFSRGGKIDDDLYEELETILITADVGMDA 69

Query: 63  AQKIVEELLTKRYAKD---VSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
              ++ +L  +R+ ++   V  + +   ++  + K+L PL+ P + + +H+P VI++VGV
Sbjct: 70  TNTLLADL--RRHVREHKLVEAEELKAGLAHCLLKLLGPLAVPLHAE-THKPFVIMMVGV 126

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NG GKTT IGKL+K +   GL VMLAAGDTFR+AA +QL  W +R +   +  + G DAA
Sbjct: 127 NGAGKTTSIGKLAKYLQSQGLSVMLAAGDTFRAAAREQLMTWGERNNVTVIAQQSG-DAA 185

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           A+ Y+A + AQA+K+DV++ DTAGRL   + LM  I K+ RV+ ++ P APH VL VLDA
Sbjct: 186 AVIYDAVQAAQARKIDVVLADTAGRLTTQAHLMEEIKKVKRVIAKVLPDAPHEVLLVLDA 245

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
            TGQNAL QV+ F A  G TGLI+TK+DGTA+GG +  I   H IPV F+GVGEG++DL 
Sbjct: 246 NTGQNALSQVKAFDAALGVTGLILTKLDGTAKGGVIAAIAKAHPIPVRFIGVGEGLDDLR 305

Query: 300 PFVAKDFSAVITG 312
           PF A++F   + G
Sbjct: 306 PFDAQEFIDALLG 318


>gi|110835427|ref|YP_694286.1| cell division protein FtsY [Alcanivorax borkumensis SK2]
 gi|110648538|emb|CAL18014.1| Cell division protein FtsY [Alcanivorax borkumensis SK2]
          Length = 397

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 193/296 (65%), Gaps = 3/296 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W R + +G + T   L +G+ D+ + ++ +DD + EE+E  L+ +D+GV     IV+ L 
Sbjct: 93  WTR-MKQGMSKTRKGLGKGLADLLVGAKEIDDEIFEEIETQLLVADVGVEATDVIVQALT 151

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   +++     LY+ +   + K+L+P+ +P   D S +P+VIL+VGVNGVGKTT IGK
Sbjct: 152 DQVSREELVDADALYESLQNELRKLLVPVDQPMQIDSSKKPYVILMVGVNGVGKTTTIGK 211

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ +    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A + AQ
Sbjct: 212 LACRFKAEGKSVMLAAGDTFRAAAVEQLQVWGERNDIPVVAQHTGADSASVVYDAVQAAQ 271

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           ++  D+LI DTAGRLH    LM  + K+ RV+K+L P APH VL VLDA TGQNA+ Q E
Sbjct: 272 SRGADILIADTAGRLHTRGNLMDELTKVTRVMKKLIPDAPHEVLLVLDAGTGQNAINQAE 331

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F   AG TGL +TK+DGTA+GG L  +     +P+ F+GVGE + DL PF A++F
Sbjct: 332 QFRDAAGVTGLALTKLDGTAKGGILFALAKRTGLPIRFIGVGEQLEDLRPFHAEEF 387


>gi|163733314|ref|ZP_02140757.1| signal recognition particle-docking protein FtsY [Roseobacter
           litoralis Och 149]
 gi|161393102|gb|EDQ17428.1| signal recognition particle-docking protein FtsY [Roseobacter
           litoralis Och 149]
          Length = 485

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 127/279 (45%), Positives = 191/279 (68%), Gaps = 1/279 (0%)

Query: 35  IISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHK 94
           I+  R LDD + E+LE+LLI +D+GV  A ++V  +   R  K +SVQ +   ++  I +
Sbjct: 205 IVVRRTLDDDMLEQLEELLIAADMGVDTALRVVANMAEGRVGKKLSVQEIKELLASEIAQ 264

Query: 95  MLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA 154
           ++ P++KP    +   P V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA
Sbjct: 265 IMEPVAKPLPL-YPRTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAA 323

Query: 155 IDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAG 214
           ++QL++W DR     + +  GSD A+LA++A  +AQ    D+L+IDTAGRL N + LM  
Sbjct: 324 VEQLQVWGDRAGVPVLTAPEGSDPASLAFDAMVKAQQDGADLLLIDTAGRLQNRTDLMEE 383

Query: 215 IGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGG 274
           + K++RV+++ D  APH+ L VLDATTGQNAL QV++F  ++  +GL+MTK+DGTA+GG 
Sbjct: 384 LAKIVRVIRKKDETAPHNTLLVLDATTGQNALNQVKVFSDISDVSGLVMTKLDGTAKGGV 443

Query: 275 LIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
           L+ +     +P++ +GVGE I+DL+ F  +DF+  + G 
Sbjct: 444 LVALADKFGLPIHAIGVGEQIDDLDAFDPEDFADALMGL 482


>gi|23008862|ref|ZP_00050130.1| COG0552: Signal recognition particle GTPase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 218

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 157/215 (73%)

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++ P   D + +P+VIL VGVNG GKTT IGKLS K    G  VMLAAGDTFR+ AI+QL
Sbjct: 1   MALPITIDSAKKPYVILTVGVNGAGKTTTIGKLSLKFKAEGRSVMLAAGDTFRAPAIEQL 60

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W +RT    +    GSDAA LA++AFK+A+    DVL+IDTAGRL N + LMA + K+
Sbjct: 61  RVWGERTGTPVISRAQGSDAAGLAFDAFKEARENGTDVLLIDTAGRLQNKAGLMAELEKI 120

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++LDP APH+ L VLDAT GQNAL QVE+F   A  +GL+MTK+DGTARGG L+ +
Sbjct: 121 VRVIRKLDPEAPHATLLVLDATVGQNALSQVELFSQAAPVSGLVMTKLDGTARGGILVAL 180

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +PV+F+GVGEG+ DLEPF A+DF+  ITG 
Sbjct: 181 AAKFGLPVHFIGVGEGVEDLEPFAARDFARAITGL 215


>gi|145300820|ref|YP_001143661.1| cell division protein FtsY [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853592|gb|ABO91913.1| cell division protein FtsY [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 631

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   +  G   + S +++DD + EELE  L+ +D+GV   ++I++ L+ 
Sbjct: 328 FFARLKRSLVRTKENIGSGFFGLFSGKKIDDDLFEELETQLLTADLGVDTTRRIIDGLVQ 387

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + +  ML  + +P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 388 HADRKQLKDAEALYGLLKQDMGAMLAQVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKL 447

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ Y+A + A++
Sbjct: 448 AKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAARS 507

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVLI DTAGRL N S LM  + K++RV+K+LD  APH ++  LDA TGQNAL Q ++
Sbjct: 508 RGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDEEAPHEIMLTLDAGTGQNALSQAKL 567

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G  G+++TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PFVA DF
Sbjct: 568 FSEAVGLDGIVLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDF 622


>gi|13377875|gb|AAK20880.1|AF334761_1 cell division protein FtsY [Aeromonas hydrophila]
          Length = 333

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +  +    T   +  G   + S +++DD + EELE  L+ +D+GV   ++I++ L+ 
Sbjct: 30  FFARFKRSMVRTKENIGSGFFGLFSGKKIDDELFEELETQLLTADLGVDTTRRIIDGLVQ 89

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + +  ML  + +P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 90  HADRKQLKDAEALYGLLKQDMGAMLAQVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKL 149

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ Y+A + A++
Sbjct: 150 AKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAARS 209

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA TGQNAL Q ++
Sbjct: 210 RGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDEEAPHEVMLTLDAGTGQNALSQAKL 269

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G  G+++TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PFVA DF
Sbjct: 270 FSEAVGLDGIVLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDF 324


>gi|237809748|ref|YP_002894188.1| signal recognition particle-docking protein FtsY [Tolumonas auensis
           DSM 9187]
 gi|237502009|gb|ACQ94602.1| signal recognition particle-docking protein FtsY [Tolumonas auensis
           DSM 9187]
          Length = 435

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 187/296 (63%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S   +L KG   T   +  G   +   ++LDD + +ELE  L+ +D+GV   Q+I++ L+
Sbjct: 130 SLFGRLVKGLMRTRESIGAGFMALFRGKKLDDDLFDELETQLLTADLGVETTQRIMQGLI 189

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +     +     LYD+  + +  +L P+S+P   D S  P+VIL++GVNGVGKTT IGK
Sbjct: 190 KQAKFHQLKDAEALYDLLKQEMAAILQPVSQPLQIDSSKTPYVILMIGVNGVGKTTTIGK 249

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K     G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+
Sbjct: 250 LAKHFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNHIPVIAQHTGADSASVIFDAIQAAK 309

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           ++ +D+LI DTAGRL N   LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q +
Sbjct: 310 SRNIDILIADTAGRLQNKGHLMEELKKIVRVMKKLDDSAPHEVMLTLDASTGQNAISQAK 369

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G  G+ +TK+DGTA+GG +  I     IP+ ++GVGE I DL PF A DF
Sbjct: 370 LFGEAVGVNGITLTKLDGTAKGGVIFAIANQFGIPIRYIGVGEAIEDLRPFEANDF 425


>gi|332308276|ref|YP_004436127.1| signal recognition particle-docking protein FtsY [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332175605|gb|AEE24859.1| signal recognition particle-docking protein FtsY [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 483

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/297 (41%), Positives = 194/297 (65%), Gaps = 1/297 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +  + KL +  + T + L  G   +   + +DD + EELE  L+ +D+G+    KI+++L
Sbjct: 169 MGLLAKLRQSLSRTKVNLGSGFVSLFRGKAIDDDLYEELETQLLVADVGMDTTNKIIKKL 228

Query: 71  LTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
                   +     LY +  + + ++L  +S+P   +    P VIL+VGVNGVGKTT IG
Sbjct: 229 TDGAKRNQLKDGDALYQLLKQQMSEILQEVSQPLVPEADEGPFVILMVGVNGVGKTTTIG 288

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++K+    G KVMLAAGDTFR+AA++QL++W +R +   +  + GSD+A++ Y+A + A
Sbjct: 289 KMAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQKTGSDSASVIYDALESA 348

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N   LM  + K++RV+++++P+APH V+  LDA TGQNA+ Q 
Sbjct: 349 KARNVDVLIADTAGRLQNKEHLMEELKKVLRVMRKINPNAPHEVMLTLDAATGQNAVSQT 408

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G +G+ +TK+DGTA+GG +  +    KIP+ ++GVGEGI+DL PF + +F
Sbjct: 409 KLFNQAVGLSGITLTKLDGTAKGGVIFALADQFKIPIRYIGVGEGIDDLRPFASDEF 465


>gi|117620356|ref|YP_854900.1| cell division protein FtsY [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117561763|gb|ABK38711.1| cell division protein FtsY [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 633

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   +  G   +   +++DD + EELE  L+ +D+GV    +I+E L+ 
Sbjct: 330 FFARLKRSLVRTRENIGSGFFGLFRGKKIDDELFEELETQLLTADLGVDTTSRIIEGLVQ 389

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + +ML  + +P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 390 HADRKQLKDAEALYGLLKQDMGEMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKL 449

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ Y+A + A++
Sbjct: 450 AKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAARS 509

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVLI DTAGRL N S LM  + K++RV+K+LD  APH ++  LDA TGQNAL Q ++
Sbjct: 510 RGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDDAAPHEIMLTLDAGTGQNALSQAKL 569

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PFVA DF
Sbjct: 570 FSEAVGLTGITLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDF 624


>gi|262277881|ref|ZP_06055674.1| signal recognition particle-docking protein FtsY [alpha
           proteobacterium HIMB114]
 gi|262224984|gb|EEY75443.1| signal recognition particle-docking protein FtsY [alpha
           proteobacterium HIMB114]
          Length = 305

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +   +K+++G   TS     GI DI    +  + + ++L D +I SDIG+ + +KI++ +
Sbjct: 1   MQIFKKISEGLKKTSKNFGNGINDIFKKSKPSNEILQDLGDFMISSDIGLPLTEKIIQNI 60

Query: 71  LTKRYAKDVSVQRVLYDV--SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
             K+++ +   Q+   ++  +E++  +L P+ +   ++ S+    ILV GVNG GKTT I
Sbjct: 61  KNKKFSDEELNQKNFLEILTNEMLE-ILEPVEENI-FNKSNGLKTILVCGVNGTGKTTTI 118

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL K + D   KV++ A DTFR+AAI+QL  W  + S D   S+ G+D AA+A++  ++
Sbjct: 119 GKLCKILKDNNSKVIVGAADTFRAAAIEQLDNWCQKNSIDIEKSDPGADPAAVAFKTLEK 178

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+    D  IIDTAGRLHN   LM    K+IRV+K++D +AP   + VLDATTGQNAL Q
Sbjct: 179 AKLNNYDYCIIDTAGRLHNKKNLMDEFSKIIRVMKKIDENAPEKTIIVLDATTGQNALNQ 238

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +E F+ ++  +GLIMTK+DGTA+GG L+ I   +K+P+Y +GVGE ++DL+PFVAKDF
Sbjct: 239 IEEFNKISKLSGLIMTKLDGTAKGGVLLSITEKYKLPIYAIGVGEQVDDLQPFVAKDF 296


>gi|238921553|ref|YP_002935068.1| cell division protein FtsY, [Edwardsiella ictaluri 93-146]
 gi|238871122|gb|ACR70833.1| cell division protein FtsY, putative [Edwardsiella ictaluri 93-146]
          Length = 557

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 192/300 (64%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ LI +D+GV   +KI++ L  
Sbjct: 255 FFARLKRSLVKTRQNLGSGFFSLFRGKKIDDDLFDELEEQLIVADVGVETTRKIIDSLTA 314

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFS-HRPHVILVVGVNGVGKTT 126
               K++     LY     ++ E++ K+  PL      D S H+P VIL+VGVNGVGKTT
Sbjct: 315 HASRKELKDAEALYGKLKEEMGEILQKVDAPL------DISGHQPFVILMVGVNGVGKTT 368

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A 
Sbjct: 369 TIGKLARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNHISVIAQHTGADSASVIFDAI 428

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+KVDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 429 QAAKARKVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEQAPHEVMLTIDASTGQNAV 488

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q  +F+   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A DF
Sbjct: 489 SQARLFNEAVGLTGITLTKLDGTAKGGVIFSVADRFGIPIRYIGVGEGIEDLRPFKADDF 548


>gi|77165401|ref|YP_343926.1| cell division transporter substrate-binding protein FtsY
           [Nitrosococcus oceani ATCC 19707]
 gi|254433367|ref|ZP_05046875.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           oceani AFC27]
 gi|76883715|gb|ABA58396.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           oceani ATCC 19707]
 gi|207089700|gb|EDZ66971.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           oceani AFC27]
          Length = 362

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 201/313 (64%), Gaps = 3/313 (0%)

Query: 2   SNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGV 60
           S++  A E  S  ++L      T   L  GI D++  ++ +DD + EE+E  L+ +D+GV
Sbjct: 32  SSETGAGEKQSLFKRLRDRLGRTRGNLTGGIADLMLGKKSIDDELLEEIETQLLIADLGV 91

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
              Q I+E+L  +   + +     L + + E + ++L P ++P     + +P VIL+VGV
Sbjct: 92  EATQAIIEDLTIRTSREQLQDAEALMEALRENMQELLTPCNQPLIIPAAIKPFVILMVGV 151

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NGVGKTT IGKL+KK    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A
Sbjct: 152 NGVGKTTTIGKLAKKFQAEGRSVMLAAGDTFRAAAVEQLQVWGERNQVPVMAQHSGADSA 211

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           ++ ++A + AQ + +DVLI DTAGRLH  + LM  + K+ RV+ +++PHAPH ++  +DA
Sbjct: 212 SVIFDAVQSAQVRGIDVLIADTAGRLHTQTNLMEELKKVKRVMGKVNPHAPHEIMLTVDA 271

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
            TGQNAL Q   FH     TG+I+TK+DGTA+GG +  I     +P+ F+GVGEGI+DL 
Sbjct: 272 GTGQNALNQARQFHEAVDLTGIILTKLDGTAKGGVIFAIAKKMGLPIRFIGVGEGIDDLR 331

Query: 300 PFVAKDF-SAVIT 311
           PF A++F +A++T
Sbjct: 332 PFNAEEFVNALLT 344


>gi|109900243|ref|YP_663498.1| signal recognition particle-docking protein FtsY [Pseudoalteromonas
           atlantica T6c]
 gi|109702524|gb|ABG42444.1| signal recognition particle-docking protein FtsY [Pseudoalteromonas
           atlantica T6c]
          Length = 485

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 187/292 (64%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           KL +  + T   L  G   +   + +DD + EELE  L+ +D+G+    KI+  L     
Sbjct: 176 KLRQSLSRTKENLGSGFISLFRGKAIDDDLFEELETQLLVADVGIDTTSKIISRLTDSAK 235

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
              +     LY +  + +  +L  +S+P        P VIL+VGVNGVGKTT IGK++K+
Sbjct: 236 RNQLKDGEALYQLLKQQMSNILQEVSQPLEPKSEDGPFVILMVGVNGVGKTTTIGKMAKQ 295

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G KVMLAAGDTFR+AA++QL++W +R +   +  + GSD+A++ Y+A + A+A+ V
Sbjct: 296 FQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQKTGSDSASVIYDALESAKARNV 355

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N   LM  + K++RV+++++P+APH V+  LDA TGQNA+ Q ++F+ 
Sbjct: 356 DVLIADTAGRLQNKDHLMEELKKVVRVMRKINPNAPHEVMLTLDAATGQNAVSQTKLFNQ 415

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ +TK+DGTA+GG +  +    KIP+ ++GVGEGI+DL PF + +F
Sbjct: 416 AVGLTGITLTKLDGTAKGGVIFALADQFKIPIRYIGVGEGIDDLRPFASDEF 467


>gi|254427512|ref|ZP_05041219.1| signal recognition particle-docking protein FtsY, putative
           [Alcanivorax sp. DG881]
 gi|196193681|gb|EDX88640.1| signal recognition particle-docking protein FtsY, putative
           [Alcanivorax sp. DG881]
          Length = 394

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 193/296 (65%), Gaps = 3/296 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W R + +G + T   L +G+ D+ + ++ +DD + EE+E  L+ +D+GV     IV+ L 
Sbjct: 90  WTR-MKQGMSKTRKGLGKGLADLLVGAKEIDDEIFEEIETQLLVADVGVEATDVIVQALT 148

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   +++     LY+ +   + K+L+P+ +P   D S +P+VIL+VGVNGVGKTT IGK
Sbjct: 149 DQVTREELVDADALYESLQNELRKLLVPVDQPMQIDGSKKPYVILMVGVNGVGKTTTIGK 208

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ +    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A + AQ
Sbjct: 209 LACRFKAEGKSVMLAAGDTFRAAAVEQLQVWGERNDIPVVAQHTGADSASVVYDAVQAAQ 268

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           ++  D+LI DTAGRLH    LM  + K+ RV+K+L P APH VL VLDA TGQNA+ Q E
Sbjct: 269 SRGADILIADTAGRLHTRGNLMEELTKVTRVMKKLIPDAPHEVLLVLDAGTGQNAINQAE 328

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F   AG TGL +TK+DGTA+GG L  +     +P+ F+GVGE + DL PF A++F
Sbjct: 329 QFRDAAGVTGLALTKLDGTAKGGILFALAKRTGLPIRFIGVGERLEDLRPFHAEEF 384


>gi|212711016|ref|ZP_03319144.1| hypothetical protein PROVALCAL_02085 [Providencia alcalifaciens DSM
           30120]
 gi|212686184|gb|EEB45712.1| hypothetical protein PROVALCAL_02085 [Providencia alcalifaciens DSM
           30120]
          Length = 601

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 189/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI++ L  
Sbjct: 299 FFSRLKKGLLKTRQNLGSGFLGLFKGKKIDDDLFDELEEQLLIADVGVETTRKIIDNLTH 358

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L  + KP   +   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 359 HASRKELKDAEALYGKLREEMSDILSTVDKPLVIE-GKKPYVILMVGVNGVGKTTTIGKL 417

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D A++ Y+A + AQA
Sbjct: 418 ARQYQSEGKSVMLAAGDTFRAAAVEQLQVWGERNKISVVAQHTGADPASVIYDAIQSAQA 477

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K  DVLI DTAGRL N + LM  + K++RV+K+LD  APH ++  LDA+TGQNA+ Q ++
Sbjct: 478 KGADVLIADTAGRLQNKAHLMEELKKIVRVMKKLDESAPHEIMLTLDASTGQNAVSQAKI 537

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++G+GEGI DL PF A DF
Sbjct: 538 FNDAVGLTGITLTKLDGTAKGGVIFSIADQFGIPIRYIGIGEGIEDLRPFKADDF 592


>gi|254490588|ref|ZP_05103774.1| signal recognition particle-docking protein FtsY [Methylophaga
           thiooxidans DMS010]
 gi|224464332|gb|EEF80595.1| signal recognition particle-docking protein FtsY [Methylophaga
           thiooxydans DMS010]
          Length = 354

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 197/309 (63%), Gaps = 2/309 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIV 67
           E   +  +L +G + TS KL EG   +I  R+ +DD + EELE  LI +D+G+    +I+
Sbjct: 45  EKTGFFGRLKQGLSRTSNKLTEGFASLILGRKTIDDDLLEELETQLITADLGIDATNRII 104

Query: 68  EELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126
            +L  +   K +S    L+D + + +  +L P S+P        P+VIL+VG+NGVGKTT
Sbjct: 105 SDLTQRVARKQLSDVEALFDAMRDDMVTILQPSSQPLTVPDKPGPYVILMVGINGVGKTT 164

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+K+    G  VMLAAGDTFR+AA++QL++W +R S   +    G+D+A++ ++A 
Sbjct: 165 TIGKLAKQFQQQGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQPKGADSASVIFDAL 224

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+++  D+LI DTAGRLH  S LM  + K+ RV+ ++D  APH ++ VLDA TGQNAL
Sbjct: 225 QAAKSRGADILIADTAGRLHTQSNLMEELKKVKRVMGKIDETAPHEIMLVLDAGTGQNAL 284

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +Q + F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I+DL PF A DF
Sbjct: 285 QQAQQFNDAVGVTGITLTKLDGTAKGGIIFAIADKTGLPIRYIGVGEKIDDLRPFDAADF 344

Query: 307 SAVITGCLD 315
              + G  D
Sbjct: 345 VDALLGRED 353


>gi|269140670|ref|YP_003297371.1| cell division protein [Edwardsiella tarda EIB202]
 gi|267986331|gb|ACY86160.1| cell division protein [Edwardsiella tarda EIB202]
 gi|304560455|gb|ADM43119.1| Signal recognition particle receptor protein FtsY [Edwardsiella
           tarda FL6-60]
          Length = 589

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 192/300 (64%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ LI +D+GV   +KI++ L  
Sbjct: 287 FFARLKRSLVKTRQNLGSGFFGLFRGKKIDDDLFDELEEQLIVADVGVETTRKIIDSLTA 346

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFS-HRPHVILVVGVNGVGKTT 126
               K++     LY     ++ E++ K+  PL      D S H+P VIL+VGVNGVGKTT
Sbjct: 347 HASRKELKDAEALYGKLKEEMGEILQKVDAPL------DISGHQPFVILMVGVNGVGKTT 400

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A 
Sbjct: 401 TIGKLARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAI 460

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+KVDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 461 QAAKARKVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEQAPHEVMLTIDASTGQNAV 520

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q  +F+   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A DF
Sbjct: 521 SQARLFNEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGEGIEDLRPFKADDF 580


>gi|254461979|ref|ZP_05075395.1| signal recognition particle-docking protein FtsY [Rhodobacterales
           bacterium HTCC2083]
 gi|206678568|gb|EDZ43055.1| signal recognition particle-docking protein FtsY [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 399

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 189/277 (68%), Gaps = 1/277 (0%)

Query: 36  ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKM 95
           ++ R LDD + E+LE+LLI SD+GV  A ++   +   R  + +S + +   ++  I ++
Sbjct: 121 VTRRVLDDDMLEQLEELLISSDMGVDTALRVSANMAEGRMGRKLSTEEIKDLLAAEIARI 180

Query: 96  LMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI 155
           + P++KP    +  +P V+LVVGVNG GKTT IGKL+ +   +G  V++AAGDTFR+AA+
Sbjct: 181 MEPVAKPLPI-YPKKPQVVLVVGVNGSGKTTTIGKLASQFKASGKNVVIAAGDTFRAAAV 239

Query: 156 DQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGI 215
           +QL++W  R     + +  GSD A+LA++A  QA+    D+L+IDTAGRL N + LM  +
Sbjct: 240 EQLQVWGTRAGVPVLTAPEGSDPASLAFDAMAQAEEDGADLLMIDTAGRLQNRADLMEEL 299

Query: 216 GKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGL 275
            K++RV+++ DP APH+ L VLDATTGQNAL QVE F  +A  +GL+MTK+DGTA+GG L
Sbjct: 300 SKIVRVIQKKDPSAPHNTLLVLDATTGQNALNQVETFQKLADVSGLVMTKLDGTAKGGVL 359

Query: 276 IPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
           + +     +P++ +GVGE I+DL+ F  +DF+  +TG
Sbjct: 360 VALADKFGLPIHAIGVGEQIDDLDAFDPEDFANALTG 396


>gi|77359320|ref|YP_338895.1| cell division transporter substrate-binding protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76874231|emb|CAI85452.1| Cell division transporter substrate-binding protein FtsY
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 651

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T + +  G   I S +++DD + EELE  L+ +D+GV    K+++ L  
Sbjct: 345 FFSRLKKGLLKTRVNIGSGFASIFSGKKIDDDLFEELETQLLTADLGVDTTMKLIDRLTD 404

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY++  + +  ML    +P       +P VIL+VGVNGVGKTT IGKL
Sbjct: 405 AANRKQLKDGDALYELMKQEMAVMLKTAEQPLVIPADKKPFVILMVGVNGVGKTTTIGKL 464

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W +R S   +    G+D+A++ ++AF+ A+A
Sbjct: 465 AKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVIFDAFQAAKA 524

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N   LM  + K+ RV+K++DP APH V+  +DA TGQNA+ QV +
Sbjct: 525 RNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQNAISQVNL 584

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ ++K+DGTA+GG +  +     IP+ ++GVGE I+DL  F + DF
Sbjct: 585 FNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGESIDDLRAFKSDDF 639


>gi|169633653|ref|YP_001707389.1| cell division protein [Acinetobacter baumannii SDF]
 gi|169152445|emb|CAP01410.1| cell division protein [Acinetobacter baumannii]
          Length = 368

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 194/300 (64%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G + T     +G+ +I I  + +DD + EE+E  L+ +DIGV   + I+  L 
Sbjct: 64  FFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEGQLLVADIGVDATKTIITNLT 123

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 124 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGK 183

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++A + A+
Sbjct: 184 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDASESAR 243

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 244 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 303

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 304 EFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 363


>gi|253991203|ref|YP_003042559.1| cell division protein ftsy [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782653|emb|CAQ85817.1| cell division protein ftsy [Photorhabdus asymbiotica]
          Length = 494

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 192 FFTRLKRSLVKTRQNLGSGFLSLFRGKKIDDDLFDELEEQLLIADVGVDTTRKIIGSLTA 251

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L+ + KP + +    P+VIL+VGVNGVGKTT IGKL
Sbjct: 252 HASRKELKDAEALYAKLKEEMSGILVKVDKPLDIE-GKTPYVILMVGVNGVGKTTTIGKL 310

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D A++ ++A + A+A
Sbjct: 311 ARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQHTGADPASVIFDAMQSAKA 370

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N S LM  + K++RV+K+LD  APH ++  LDA+TGQNA+ Q ++
Sbjct: 371 KGIDILIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEIMLTLDASTGQNAISQAKL 430

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A DF
Sbjct: 431 FHEAVGLTGISLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADDF 485


>gi|110679220|ref|YP_682227.1| signal recognition particle-docking protein FtsY [Roseobacter
           denitrificans OCh 114]
 gi|109455336|gb|ABG31541.1| signal recognition particle-docking protein FtsY [Roseobacter
           denitrificans OCh 114]
          Length = 512

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 189/274 (68%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++V  +   R  K +SVQ +   ++  I +++ P
Sbjct: 236 RTLDDDMLEQLEELLISADMGVDTALRVVANMAEGRVGKKLSVQEIKELLASEIAQIMEP 295

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    +   P V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 296 VAKPLPL-YPRTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAAVEQL 354

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  +AQ    D+L+IDTAGRL N + LM  + K+
Sbjct: 355 QVWGDRAGVPVLTAPEGSDPASLAFDAMLKAQRDGADLLLIDTAGRLQNRTDLMEELAKI 414

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QV++F  ++  +GL+MTK+DGTA+GG L+ +
Sbjct: 415 VRVIRKNDETAPHNTLLVLDATTGQNALNQVKVFSDISDVSGLVMTKLDGTAKGGVLVAL 474

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL+ F  +DF+  + G
Sbjct: 475 ADKFGLPIHAIGVGEQIDDLDAFDPEDFADALMG 508


>gi|269103876|ref|ZP_06156573.1| signal recognition particle receptor protein FtsY [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163774|gb|EEZ42270.1| signal recognition particle receptor protein FtsY [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 462

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/294 (43%), Positives = 196/294 (66%), Gaps = 8/294 (2%)

Query: 14  IRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTK 73
           +RK  + F S+   L +G       +++DD + EELE+ L+ +D+G+    KI+E L  K
Sbjct: 167 LRKTKENFGSSFFSLFKG-------KKIDDELFEELEEQLLIADVGMDTTVKIIENLTEK 219

Query: 74  RYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
              K++     LY +  + + +ML  + +PF  D S +P+VIL+VGVNGVGKTT IGKL+
Sbjct: 220 ASRKELKDGEALYGLLKDELAEMLAKVEQPFEIDTSKKPYVILMVGVNGVGKTTTIGKLA 279

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
           KK    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+AK
Sbjct: 280 KKFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIFDAIESAKAK 339

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
            +DV+I DTAGRL N + LM  + K++RV+K++DP APH ++  LDA TGQNA+ Q ++F
Sbjct: 340 NIDVIIADTAGRLQNKANLMEELRKIVRVMKKIDPDAPHEIMLTLDAGTGQNAISQAKLF 399

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             VA  +G+ +TK+DGTA+GG +  I     IP+ ++G+GEGI+DL PF A +F
Sbjct: 400 SEVAPVSGITLTKLDGTAKGGVIFAIADQFHIPIRYIGIGEGIDDLRPFAADEF 453


>gi|292492241|ref|YP_003527680.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           halophilus Nc4]
 gi|291580836|gb|ADE15293.1| signal recognition particle-docking protein FtsY [Nitrosococcus
           halophilus Nc4]
          Length = 356

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 193/301 (64%), Gaps = 6/301 (1%)

Query: 14  IRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL-- 70
            ++L      T   L  GI D+ +  + +DD + EE+E  L+ +D+GV   Q I++ L  
Sbjct: 45  FKRLRNRLGRTRGNLTGGIADLMLGKKNIDDELLEEIETQLLVADVGVEATQSIIDNLTV 104

Query: 71  -LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
            ++++  KD +   ++  + E + ++L+P S P       +P VIL+VGVNGVGKTT IG
Sbjct: 105 RVSRKQLKDPAA--LMAALRENMQELLLPSSHPLVIPEGIKPFVILMVGVNGVGKTTTIG 162

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK    G  VMLAAGDTFR+AA++QL+ W +R     +    G+D+A++ ++A + A
Sbjct: 163 KLAKKFQAEGRSVMLAAGDTFRAAAVEQLQAWGERNQVPVIAQRSGADSASVIFDALQSA 222

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           QA+ +DVLI DTAGRLH  + LM  + K+ RV+ ++DP APH ++  +DA TGQNAL Q 
Sbjct: 223 QARGIDVLIADTAGRLHTQANLMEELKKVKRVMGKVDPQAPHEIMLTVDAGTGQNALNQA 282

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           + FH   G TG+ +TK+DGTA+GG +  I     +P+ F+GVGEGI+DL PF A++F A 
Sbjct: 283 KQFHEAVGLTGITLTKLDGTAKGGVIFAIAKKMALPIRFIGVGEGIDDLRPFDAEEFVAA 342

Query: 310 I 310
           +
Sbjct: 343 L 343


>gi|183598034|ref|ZP_02959527.1| hypothetical protein PROSTU_01390 [Providencia stuartii ATCC 25827]
 gi|188022813|gb|EDU60853.1| hypothetical protein PROSTU_01390 [Providencia stuartii ATCC 25827]
          Length = 640

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 191/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   + + +++DD + +ELE+ L+ +D+GV   +KI++ L  
Sbjct: 338 FFARLKKGLLKTRQNLGSGFLGLFTGKKIDDDLFDELEEQLLIADVGVDTTRKIIDNLTA 397

Query: 73  KRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L  + KP   +   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 398 HASRKELKDAEALYSKLREEMSDILAGVDKPLVIE-DKKPYVILMVGVNGVGKTTTIGKL 456

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D A++ ++A + A+A
Sbjct: 457 ARQYQSEGKTVMLAAGDTFRAAAVEQLQVWGERNRIPVVAQHTGADPASVIFDAIQSAKA 516

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N + LM  + K++RV+K+LD  APH ++  LDA+TGQNA+ Q ++
Sbjct: 517 KGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEEAPHEIMLTLDASTGQNAVSQAKL 576

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++G+GEGI DL PF A DF
Sbjct: 577 FNDAVGLTGITLTKLDGTAKGGVIFSIADQFGIPIRYIGIGEGIEDLRPFKADDF 631


>gi|329847629|ref|ZP_08262657.1| signal recognition particle-docking protein FtsY [Asticcacaulis
           biprosthecum C19]
 gi|328842692|gb|EGF92261.1| signal recognition particle-docking protein FtsY [Asticcacaulis
           biprosthecum C19]
          Length = 326

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 196/311 (63%), Gaps = 19/311 (6%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W  +LT G + TS  L E +T + S +  L D   E LEDLLI SD+G  ++  I  ++ 
Sbjct: 21  WFERLTHGLSRTSQTLTEQVTQVFSQKESLSDSDLEALEDLLIESDLGPQISANISAKMA 80

Query: 72  TKRYA--KDVSVQR-----VLYDVSELIHK--MLMPLSKPFNWDFSHRPHVILVVGVNGV 122
             +++  KD +  R      L D  EL++      PL  P       +P+++L VGVNG 
Sbjct: 81  QAKFSSSKDSTAVREALASALAD--ELVNHEGTFEPLGGP-------KPYIVLFVGVNGS 131

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT +GK++  ++  G KV++ AGDTFR+AA++QLK+W++R  ADF+  + G+DAA LA
Sbjct: 132 GKTTTLGKIAASLTAKGAKVLIVAGDTFRAAAVEQLKVWSERAKADFMGRKTGADAAGLA 191

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y++  +A+ +  DV++IDTAGRL N   LM  + K++RV+KR+DP APH  L VLDAT G
Sbjct: 192 YDSVVKAKEEGYDVVLIDTAGRLQNKQALMDELLKIVRVIKRVDPDAPHETLLVLDATVG 251

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           +NAL Q ++F   A  +GL+MTK+DGTARGG LIPI      P+  +GVGE I DL  F 
Sbjct: 252 RNALSQEQIFGRQAFVSGLVMTKLDGTARGGILIPIAKASDAPIKLIGVGEDIEDLHAFK 311

Query: 303 AKDFSAVITGC 313
           A+DF+  + G 
Sbjct: 312 ARDFARSMVGL 322


>gi|325275629|ref|ZP_08141529.1| signal recognition particle-docking protein FtsY [Pseudomonas sp.
           TJI-51]
 gi|324099236|gb|EGB97182.1| signal recognition particle-docking protein FtsY [Pseudomonas sp.
           TJI-51]
          Length = 329

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 25  FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSTIVQNLT 84

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P      ++P+VILVVGVNG GKTT IGK
Sbjct: 85  QKVARKQLADADALYKSLQEELAALLRPVEQPLKVQAQNKPYVILVVGVNGAGKTTTIGK 144

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 145 LAKKLQQEGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 204

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 205 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAK 264

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +    K+P+ F+GVGEGI+DL  F A+ F
Sbjct: 265 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFKLPIRFIGVGEGIDDLRTFEAEPF 320


>gi|313501087|gb|ADR62453.1| Signal recognition particle-docking protein FtsY [Pseudomonas
           putida BIRD-1]
          Length = 372

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 68  FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLT 127

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P N    ++P+VILVVGVNG GKTT IGK
Sbjct: 128 QKVARKQLADADALYKSLQEELAALLRPVEQPLNVQAQNKPYVILVVGVNGAGKTTTIGK 187

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 188 LAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 247

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 248 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAK 307

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A+ F
Sbjct: 308 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPF 363


>gi|114571392|ref|YP_758072.1| signal recognition particle-docking protein FtsY [Maricaulis maris
           MCS10]
 gi|114341854|gb|ABI67134.1| signal recognition particle-docking protein FtsY [Maricaulis maris
           MCS10]
          Length = 309

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 197/301 (65%), Gaps = 1/301 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   +S KL + ++ I + R+LD    EELED+LI +D+G A A ++ E L  
Sbjct: 8   FFSRLAQGLKRSSSKLGDSVSAIFTKRKLDREALEELEDVLIAADLGAAAAMQVTERLAK 67

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K+VS + V   ++E++ + L PL +  +     RP V+L VGVNG GKTT +GK++
Sbjct: 68  DRFDKEVSDEEVREALAEVVAETLTPLEQGLDLS-GARPQVVLFVGVNGSGKTTTLGKIA 126

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
            K+   G   +LAAGDTFR+AAI+Q+ +W +R  +  +  EIG+DAA LA++A  QA   
Sbjct: 127 VKLKREGRNPILAAGDTFRAAAIEQVSVWGERAKSPVIKREIGADAAGLAFDAIDQADRD 186

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DV++IDTAGRL N + LM  + K++RV+K+  P APH V+ VLD T G NA+ Q + F
Sbjct: 187 GHDVVLIDTAGRLQNKAELMDELRKVVRVIKKRMPDAPHHVVLVLDGTVGSNAVSQAQAF 246

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              +  TG++MTK+DGTA+GG L+ +    ++P++++G+GEG  DL+PF A+DFS  + G
Sbjct: 247 LEASEVTGVVMTKLDGTAKGGALVQVAEKFQLPIHYIGIGEGEEDLQPFSARDFSRALAG 306

Query: 313 C 313
            
Sbjct: 307 L 307


>gi|260427997|ref|ZP_05781976.1| cell division protein FtsY [Citreicella sp. SE45]
 gi|260422489|gb|EEX15740.1| cell division protein FtsY [Citreicella sp. SE45]
          Length = 441

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 193/279 (69%), Gaps = 2/279 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE+LLI +D+GV  A ++   +   R+ K VS Q +   ++  + +++ P
Sbjct: 165 RVLDDEMLESLEELLIAADMGVDTALRVSANIAEGRFGKRVSTQEIKQALAGEVARIMEP 224

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  +P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 225 VARPLPL-YPRKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL 283

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W  R     + +  GSD A+LA++A  +AQA+  D+L+IDTAGRL N   LM  + K+
Sbjct: 284 QVWGQRAGVPVLTAPEGSDPASLAFDAMSKAQAEGADLLMIDTAGRLQNRQDLMEELAKI 343

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QVE+F  VA  +GL+MTK+DGTA+GG L+ +
Sbjct: 344 VRVIRKKDPDAPHNTLLVLDATTGQNALNQVEIFRQVADVSGLVMTKLDGTAKGGVLVAL 403

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYG 317
                +P++ +GVGE I+DL PF  ++F+A +TG LD G
Sbjct: 404 ADRFGLPIHAIGVGEQIDDLAPFDPEEFAAALTG-LDNG 441


>gi|163746083|ref|ZP_02153442.1| signal recognition particle-docking protein FtsY [Oceanibulbus
           indolifex HEL-45]
 gi|161380828|gb|EDQ05238.1| signal recognition particle-docking protein FtsY [Oceanibulbus
           indolifex HEL-45]
          Length = 461

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 189/275 (68%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R+ K +SV  +   ++  + +++ P
Sbjct: 186 RTLDDDMLEQLEELLISADMGVDTALRVTANMAEGRFGKKLSVGEIKQLLATEVSRIMEP 245

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +S  P V+LVVGVNG GKTT IGKL+ +   AG KV++AAGDTFR+AA++QL
Sbjct: 246 VARPLPI-YSKTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAAVEQL 304

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W +R     + +  GSD A+LA++A  +AQ +  D+L+IDTAGRL N   LM  + K+
Sbjct: 305 QVWGERAGVPVLTAAHGSDPASLAFDAMGRAQEEGADLLLIDTAGRLQNRGDLMEELAKI 364

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QV++F  ++  +GL+MTK+DGTA+GG L+ +
Sbjct: 365 VRVIRKKDETAPHNTLLVLDATTGQNALNQVKVFQEISDVSGLVMTKLDGTAKGGVLVAL 424

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF   +F+A + G 
Sbjct: 425 ADRFGLPIHAVGVGEQIDDLSPFDPDEFAAALVGI 459


>gi|291279724|ref|YP_003496559.1| signal recognition particle receptor FtsY [Deferribacter
           desulfuricans SSM1]
 gi|290754426|dbj|BAI80803.1| signal recognition particle receptor FtsY [Deferribacter
           desulfuricans SSM1]
          Length = 388

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 201/300 (67%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           ++++L  G + TS KL  GI  I +  + +D+ + EELE+L + SDIG+    KI++ + 
Sbjct: 86  FLKRLRNGLSKTSNKLVGGIETIFLGKKEIDEELLEELEELFVTSDIGINTTLKIIDAV- 144

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFS-----HRPHVILVVGVNGVGKTT 126
                +D   ++VL +  +L + +   + +  N D S      +P+VILVVGVNGVGKTT
Sbjct: 145 -----RDEVSRKVLKNPEDLKNSIKNKIFEILNIDNSLKQVDEKPYVILVVGVNGVGKTT 199

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            I K++K   D GLK MLAAGDTFR+AAIDQL++WADR     V  + GSD AA+ Y+A 
Sbjct: 200 TIAKIAKMFKDNGLKTMLAAGDTFRAAAIDQLQVWADRVDVPIVKQQEGSDPAAVIYDAV 259

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
             A+AK  DVLI DTAGRLH    LM  + K++RV+K+  P+APH +L VLDAT+GQNA+
Sbjct: 260 VSAKAKGYDVLIADTAGRLHTKYNLMNELKKIVRVVKKEMPNAPHEILLVLDATSGQNAI 319

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++F+   G TG+++TK+DGTA+GG ++ IV   KIPV F+G GEG++DL+PF AK F
Sbjct: 320 NQAKIFNEAVGVTGIVLTKLDGTAKGGVIVGIVDELKIPVKFIGFGEGMDDLKPFDAKTF 379


>gi|302381440|ref|YP_003817263.1| signal recognition particle-docking protein FtsY [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192068|gb|ADK99639.1| signal recognition particle-docking protein FtsY [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 312

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 130/304 (42%), Positives = 193/304 (63%), Gaps = 1/304 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++L+ G A +S ++ E +        L +   + LE+ L+ SD+G A   +IV     
Sbjct: 9   WFQRLSAGLARSSQQMTETVVGTFVKEPLSEAALDRLEEHLLESDLGPAATDRIVARFRE 68

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFN-WDFSHRPHVILVVGVNGVGKTTVIGKL 131
            R+ K    + V   ++E +   L+P    F+      +P+V+L VGVNG GKTT +GK+
Sbjct: 69  LRFGKVSDEREVKEALAEAVAAELLPRQATFDPLSEGIKPYVVLFVGVNGSGKTTTLGKI 128

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +  ++  G +VM+ AGDTFR+AA +QLK+WA+R  ADF     G+D A LA++A+ +A+A
Sbjct: 129 AADLTGKGARVMIVAGDTFRAAAREQLKVWAERAGADFESRRDGADPAGLAFDAYTKARA 188

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DV++IDTAGRL N S LM  + K++RVLK++DP APH  L VLDAT G+NAL Q ++
Sbjct: 189 ENYDVILIDTAGRLQNKSALMDELLKIVRVLKKIDPDAPHETLLVLDATVGRNALAQEQI 248

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F   A  +GL+MTK+DGTARGG L+P+      P+  +GVGEGI+DL+PF A+ F+  + 
Sbjct: 249 FGRTAFVSGLVMTKLDGTARGGVLVPVAQASDAPIKLIGVGEGIDDLQPFDARAFARSLV 308

Query: 312 GCLD 315
           G  D
Sbjct: 309 GLED 312


>gi|262375215|ref|ZP_06068448.1| signal recognition particle-docking protein FtsY [Acinetobacter
           lwoffii SH145]
 gi|262309469|gb|EEY90599.1| signal recognition particle-docking protein FtsY [Acinetobacter
           lwoffii SH145]
          Length = 367

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 195/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++  G   T   L +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 63  FFSRMKVGLTKTRKNLADGMVNILIGGKEIDDELLEEVEEQLLVADIGVEATKTIIANLT 122

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VILVVGVNGVGKTT IGK
Sbjct: 123 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILVVGVNGVGKTTTIGK 182

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G  VMLAAGDTFR+AA +QL+IW +R +   V    G+D+A++ ++AF+ A+
Sbjct: 183 LAKRLQGEGKTVMLAAGDTFRAAATEQLQIWGERNNIAVVAQGHGADSASVIFDAFESAR 242

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDVLI DTAGRLHN   LM  + K+ RV++++D  APH V+ V+DA TGQNA+ QVE
Sbjct: 243 AKGVDVLIADTAGRLHNKGHLMQELTKVKRVMQKIDATAPHEVMLVVDAGTGQNAINQVE 302

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           MF    G TGL +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 303 MFDEAVGLTGLTITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 362


>gi|26991787|ref|NP_747212.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida KT2440]
 gi|24986898|gb|AAN70676.1|AE016711_4 signal recognition particle receptor FtsY [Pseudomonas putida
           KT2440]
          Length = 494

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 190 FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLT 249

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P N    ++P+VILVVGVNG GKTT IGK
Sbjct: 250 QKVARKQLADADALYKSLQEELAALLRPVEQPLNVQAQNKPYVILVVGVNGAGKTTTIGK 309

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 310 LAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 369

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 370 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDVEAPHEVLLVLDAGTGQNAISQAK 429

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A+ F
Sbjct: 430 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPF 485


>gi|226329396|ref|ZP_03804914.1| hypothetical protein PROPEN_03301 [Proteus penneri ATCC 35198]
 gi|225202582|gb|EEG84936.1| hypothetical protein PROPEN_03301 [Proteus penneri ATCC 35198]
          Length = 541

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   +   +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 239 FFSRLKKGLLKTRQNLGSGFIGLFRGKKIDDELFEELEEQLLIADVGMETTTKIITSLTK 298

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               KD+     LY  + E + ++L  + KP N +   +P VIL+VGVNGVGKTT IGKL
Sbjct: 299 HATHKDLKDAEALYGKLREEMGEILTKVDKPLNIE-GKKPFVILMVGVNGVGKTTTIGKL 357

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D A++ ++A + AQA
Sbjct: 358 ARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQHTGADPASVIFDAIQSAQA 417

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 418 KGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTLDASTGQNAVSQAKL 477

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TGL +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 478 FNETVGLTGLTLTKLDGTAKGGVIFSIADQFSIPIRYIGVGEGIEDLRPFKADDF 532


>gi|220936146|ref|YP_002515045.1| signal recognition particle-docking protein FtsY [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219997456|gb|ACL74058.1| signal recognition particle-docking protein FtsY [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 329

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 135/301 (44%), Positives = 198/301 (65%), Gaps = 2/301 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           ++S     +L KG + T   L EG+  ++  R+ +DD + EELE  L+ +D+GV   Q+I
Sbjct: 19  AQSEGLFSRLRKGLSKTGQALTEGMATLVMGRKAIDDELLEELETRLLMADVGVEATQRI 78

Query: 67  VEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           ++ L  +   K+++    L+  + E + ++L+P++ P   D S +P VILVVG+NG GKT
Sbjct: 79  LDGLTRRVARKELTDADALFKALHEAMTEILVPVAHPLQIDASKKPFVILVVGINGAGKT 138

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+K++ + G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A
Sbjct: 139 TTIGKLAKRLQNEGRSVMLAAGDTFRAAAVEQLQVWGERNRIPVITQGKGADSASVIYDA 198

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + A+A+ VDVLI DTAGRLH  + LM  + K+ RV++RLDP APH  L V+DA TGQNA
Sbjct: 199 VQAAKARGVDVLIADTAGRLHTQTNLMEEMKKVRRVIQRLDPDAPHETLLVVDAGTGQNA 258

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q   FH     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A D
Sbjct: 259 LNQAREFHQAVNLTGLAVTKLDGTAKGGIVFAMAERMGIPIRFIGVGEGIDDLRTFRADD 318

Query: 306 F 306
           F
Sbjct: 319 F 319


>gi|88858436|ref|ZP_01133078.1| Cell division transporter substrate-binding protein FtsY
           [Pseudoalteromonas tunicata D2]
 gi|88820053|gb|EAR29866.1| Cell division transporter substrate-binding protein FtsY
           [Pseudoalteromonas tunicata D2]
          Length = 565

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 189/296 (63%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L K    T   +  G  +I S +++DD + EELE  L+ +D+GV    K++  L 
Sbjct: 260 SFFSRLKKSLIKTKQSIGSGFINIFSGKKIDDELFEELETQLLTADLGVDTTLKLIARLT 319

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                K +     LYD+  + + +ML    +  + + +  P VIL+VGVNGVGKTT IGK
Sbjct: 320 EAADRKQLKDGDALYDLLKQEMAQMLKSAEQALDTEKATGPFVILMVGVNGVGKTTTIGK 379

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++AF+ A+
Sbjct: 380 LAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVIAQHTGADSASVIFDAFQAAK 439

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+KVD+LI DTAGRL N   LM  + K+ RV+K+LDP APH V+  +DA TGQNA+ QV+
Sbjct: 440 ARKVDILIADTAGRLQNKDNLMQELEKIARVMKKLDPDAPHEVMLTIDAGTGQNAISQVD 499

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F+   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI+DL  F + +F
Sbjct: 500 LFNKAVGLTGISLTKLDGTAKGGVIFAVADKFNIPIRYIGVGEGIDDLRAFKSDEF 555


>gi|239994821|ref|ZP_04715345.1| signal recognition particle GTPase [Alteromonas macleodii ATCC
           27126]
          Length = 382

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/313 (40%), Positives = 196/313 (62%), Gaps = 6/313 (1%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S   +L +  + T   L  GI  +   + +DD + E+LE  L+ +D+G+   QKI++ L 
Sbjct: 69  SLFARLKESLSRTKENLGSGIVSLFKGKTIDDELYEDLETQLLVADVGMDTTQKIIDHLT 128

Query: 72  TKRYAKDVSVQRVLYDV-----SELIHKMLMPLSKPFN-WDFSHRPHVILVVGVNGVGKT 125
                KD+     L D+     S ++ ++  PLS+     D S  P VIL+VGVNGVGKT
Sbjct: 129 DSASRKDLKDAEALLDIMKQQMSGMLSQVNQPLSEVMQAHDSSEGPFVILMVGVNGVGKT 188

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A
Sbjct: 189 TTIGKLAKQFQQEGKKVMLAAGDTFRAAAVEQLQVWGERNDIPVIAQHTGADSASVLYDA 248

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + A+++  D+LI DTAGRL N + LM  + K++RV+K+++P+APH V+  LDA TGQNA
Sbjct: 249 LEAAKSRGTDILIADTAGRLQNKNNLMEELKKVVRVMKKINPNAPHEVMLTLDAGTGQNA 308

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           + Q ++F+   G TG+ +TK+DGTA+GG +  I    KIP+ ++GVGE I+DL  F  ++
Sbjct: 309 ISQAKLFNEAVGLTGITLTKLDGTAKGGVIFSIADKFKIPIRYIGVGESIDDLRQFDGQE 368

Query: 306 FSAVITGCLDYGE 318
           F   +   +D  E
Sbjct: 369 FIDALFSEMDTPE 381


>gi|149378431|ref|ZP_01896125.1| signal recognition particle-docking protein FtsY [Marinobacter
           algicola DG893]
 gi|149357281|gb|EDM45809.1| signal recognition particle-docking protein FtsY [Marinobacter
           algicola DG893]
          Length = 400

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 197/302 (65%), Gaps = 8/302 (2%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
            +S   ++ KG   T   L  G  D+ S  +++D+ + EE+E  L+ +D+GV    +I+E
Sbjct: 91  QVSVFERIRKGLGKTRANLTGGFADLFSIGKKVDEDLLEEIETTLLMADVGVTATSEIIE 150

Query: 69  EL---LTKRYAKD-VSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
            L   L +   KD  ++++ L D    +H +L  ++KP   D S +P+VIL+VGVNGVGK
Sbjct: 151 SLTDKLERNQLKDGEALRKALRDE---LHGLLADVTKPLEIDASKKPYVILMVGVNGVGK 207

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K     G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++
Sbjct: 208 TTTIGKLTKLFQRDGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIFD 267

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + AQ++ VDV+I DTAGRL N   LM+ + K++RV+K+LD  APH V+ VLDA TGQN
Sbjct: 268 AVQSAQSRGVDVVIADTAGRLQNKDNLMSELEKVVRVMKKLDESAPHEVMLVLDAGTGQN 327

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           AL Q ++F    G +G+ +TK+DGTA+GG +  I    ++P+ ++GVGE ++DL  F A+
Sbjct: 328 ALSQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRYIGVGEQVDDLRSFDAR 387

Query: 305 DF 306
            F
Sbjct: 388 TF 389


>gi|114049331|ref|YP_739881.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           MR-7]
 gi|113890773|gb|ABI44824.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           MR-7]
          Length = 584

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 196/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L 
Sbjct: 277 SFFARLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTSRLIQSLT 336

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                K +     LYD+  + + K L P++ P   + ++ P+VIL+VGVNGVGKTT IGK
Sbjct: 337 EHASRKQLKDAEALYDLLRDEMQKTLDPVAIPLVPENANGPYVILMVGVNGVGKTTTIGK 396

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A+
Sbjct: 397 LAKQYQRQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVLFDALQAAK 456

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+K+DVLI DTAGRL N S LM  + K++RV+K+LDP APH V+  LDA+TGQNA+ Q +
Sbjct: 457 ARKIDVLIADTAGRLQNKSHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQ 516

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G TG+ ++K+DGTA+GG +  I    KIP+ ++GVGE I+DL  F +K+F
Sbjct: 517 LFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEF 572


>gi|83944907|ref|ZP_00957273.1| probable cell division protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851689|gb|EAP89544.1| probable cell division protein [Oceanicaulis alexandrii HTCC2633]
          Length = 437

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/291 (43%), Positives = 193/291 (66%), Gaps = 1/291 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           E   +  +L  G   +S +L +G++ + + R+LD    +ELE+LLI +DIG   A K+V 
Sbjct: 132 EKKGFFARLAAGLKKSSSRLSDGLSSLFTQRKLDQEALDELEELLIAADIGAPTAAKVVA 191

Query: 69  ELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
            L   R+ KDVS   +   +++++ + L P  +P +      P V++ VGVNG GKTT +
Sbjct: 192 RLAKDRFDKDVSDLEIREALADVVAETLQPYEQPLDM-TGATPSVVVFVGVNGSGKTTTL 250

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GK++ KM+  G  V+ AAGDTFR+AA++QL++W++R  A F+  E+G+DAA LAY+A +Q
Sbjct: 251 GKIAVKMTREGADVITAAGDTFRAAAVEQLQVWSERAGAKFLSRELGADAAGLAYDAIQQ 310

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
            + +K D ++IDTAGRL N + LM  + K+IRV++++D  APH VL VLD T G NA+ Q
Sbjct: 311 GRTEKSDAVLIDTAGRLQNKAELMDELRKIIRVIRKIDDTAPHHVLLVLDGTVGSNAISQ 370

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
            E F   A  TG+IMTK+DGTA+GG L+ +    K+P++F+GVGEG  DL+
Sbjct: 371 AEAFMETAHVTGVIMTKLDGTAKGGALVQVAERFKLPIHFIGVGEGEADLQ 421


>gi|50085394|ref|YP_046904.1| cell division protein [Acinetobacter sp. ADP1]
 gi|49531370|emb|CAG69082.1| cell division protein [Acinetobacter sp. ADP1]
          Length = 373

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 197/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G   T   L +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 69  FFSRMKQGLTKTRRNLADGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLT 128

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 129 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKTPYVILMVGVNGVGKTTTIGK 188

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R +   V    G+D+A++ ++AF+ A+
Sbjct: 189 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNNISVVAQGHGADSASVIFDAFESAR 248

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 249 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 308

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 309 EFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 368


>gi|104779581|ref|YP_606079.1| cell division protein FtsY [Pseudomonas entomophila L48]
 gi|95108568|emb|CAK13262.1| cell division protein FtsY [Pseudomonas entomophila L48]
          Length = 524

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 218 FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSTIVQNLT 277

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P   +  ++P+VILVVGVNG GKTT IGK
Sbjct: 278 QKVARKQLADADALYKSLQEELAALLRPVEQPLKIEAQNKPYVILVVGVNGAGKTTTIGK 337

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 338 LAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 397

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 398 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAK 457

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A+ F
Sbjct: 458 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPF 513


>gi|91794852|ref|YP_564503.1| signal recognition particle-docking protein FtsY [Shewanella
           denitrificans OS217]
 gi|91716854|gb|ABE56780.1| signal recognition particle-docking protein FtsY [Shewanella
           denitrificans OS217]
          Length = 487

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 195/305 (63%), Gaps = 3/305 (0%)

Query: 3   NQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAV 62
            QK   E L    +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV  
Sbjct: 158 QQKPVKEGL--FARLKRGLMRTSENIGSGFIGLFKGKKIDDDLFEELEEQLLIADVGVET 215

Query: 63  AQKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
             K++ +L      + +     LYD+  + + KML P++ P   D S  P VIL+VGVNG
Sbjct: 216 TTKLIAKLTEHASRRQLKDAEALYDLMRDEMQKMLEPVAIPLVPDNSEGPFVILMVGVNG 275

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
           VGKTT IGKL+K+    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++
Sbjct: 276 VGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASV 335

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++AF+ A+++KVDVLI DTAGRL N S LM  + K++RV+K+LD +APH V+  LDA+T
Sbjct: 336 LFDAFQAAKSRKVDVLIADTAGRLQNKSHLMEELKKVVRVMKKLDANAPHEVMLTLDAST 395

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q ++F    G TG+ +TK+DGTA+GG +  I     IP+  +GVGE I+DL  F
Sbjct: 396 GQNAISQAQLFQEAVGVTGITLTKLDGTAKGGVIFAIADKFSIPIRHIGVGEQIDDLRTF 455

Query: 302 VAKDF 306
            A DF
Sbjct: 456 NAADF 460


>gi|170719541|ref|YP_001747229.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida W619]
 gi|169757544|gb|ACA70860.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida W619]
          Length = 514

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 190/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 208 FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSTIVQNLT 267

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P      ++P+VILVVGVNG GKTT IGK
Sbjct: 268 QKVARKQLADADALYKSLQEELAALLRPVEQPLKIQAQNKPYVILVVGVNGAGKTTTIGK 327

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 328 LAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 387

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 388 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAK 447

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A+ F
Sbjct: 448 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPF 503


>gi|326797249|ref|YP_004315069.1| signal recognition particle-docking protein FtsY [Marinomonas
           mediterranea MMB-1]
 gi|326548013|gb|ADZ93233.1| signal recognition particle-docking protein FtsY [Marinomonas
           mediterranea MMB-1]
          Length = 434

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 203/310 (65%), Gaps = 8/310 (2%)

Query: 3   NQKVASE--SLSWIRKLTKGFASTSLKLKEGITDII-SSRRLDDGVREELEDLLIRSDIG 59
           NQ+V  E  +LSW  ++  G A T   L  G++ ++  S+++DD + EELE  L+ +D+G
Sbjct: 119 NQEVPDEKPTLSWRERIQSGLARTRSGLGNGLSSLVLGSKKVDDDLLEELETQLLTADVG 178

Query: 60  VAVAQKIVE---ELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILV 116
           +   Q +++   E L ++  KD +   ++  +   ++ +L    KP + D +  P VIL+
Sbjct: 179 IDATQTLIDGLTEKLNRKELKDSNA--LMSSLKADMNDILEISEKPLSLDKADGPFVILM 236

Query: 117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGS 176
           VGVNGVGKTT IGKL+KK    G  VMLAAGDTFR+AA++QL++W DR     V    G+
Sbjct: 237 VGVNGVGKTTTIGKLAKKYQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNQVPVVAQHTGA 296

Query: 177 DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV 236
           D+A++ Y+A + A+AK VDV+I DTAGRL N + LM+ + K++RV+K+LD  APH V+ V
Sbjct: 297 DSASVIYDAIESAKAKSVDVVIADTAGRLQNKANLMSELEKVVRVMKKLDVSAPHEVMLV 356

Query: 237 LDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGIN 296
           LDA TGQNAL Q ++F    G +G+ +TK+DGTA+GG +  I     +P+ ++GVGE   
Sbjct: 357 LDAGTGQNALSQAKLFTEAVGVSGITLTKLDGTAKGGIIFAIAKQFGLPIRYIGVGEQAE 416

Query: 297 DLEPFVAKDF 306
           DL PFVA++F
Sbjct: 417 DLRPFVAQEF 426


>gi|209696302|ref|YP_002264233.1| cell division protein FtsY [Aliivibrio salmonicida LFI1238]
 gi|208010256|emb|CAQ80587.1| cell division protein FtsY [Aliivibrio salmonicida LFI1238]
          Length = 410

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 198/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +    T   +  G   + S +++D+ + EELE+ L+ +D+G+    KI+  L 
Sbjct: 106 SFFARLKRSLQRTKENIGAGFFGLFSGKKIDEDLFEELEEQLLIADVGMDTTVKIINSLT 165

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +D+     LY +  E + ++L+ + +P   D  + PHVIL+VGVNGVGKTT IGK
Sbjct: 166 EKASKRDLKDGEALYGLLKEEMAEILVKVEQPLVIDEKNSPHVILMVGVNGVGKTTTIGK 225

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+  + G  V+LAAGDTFR+AA++QL++W  R     +    G+D+A++ Y+A + A+
Sbjct: 226 LAKQFQNDGKSVILAAGDTFRAAAVEQLQVWGQRNDVPVIAQHTGADSASVIYDAIEAAK 285

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+KVDV+I DTAGRL N S LM  + K++RV++++DP APH V+  LDA TGQNA+ Q +
Sbjct: 286 ARKVDVVIADTAGRLQNKSNLMEELRKIVRVMQKIDPSAPHEVMLTLDAGTGQNAISQAK 345

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI+DL PFVA+DF
Sbjct: 346 LFSDVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRYIGVGEGIDDLRPFVAQDF 401


>gi|330813436|ref|YP_004357675.1| signal recognition particle receptor protein FtsY (alpha subunit)
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486531|gb|AEA80936.1| signal recognition particle receptor protein FtsY (alpha subunit)
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 302

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 191/304 (62%), Gaps = 8/304 (2%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           + +++ L +G   +S  + EG+++I    + ++ + EE+ED +I+ D G+ VA K    L
Sbjct: 1   MGFLKNLKEGLFKSSSNISEGVSNIFLKSKPNEKILEEIEDFMIQCDFGIDVASKFKLIL 60

Query: 71  LTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPF---NWDFSHRPHVILVVGVNGVGKTT 126
             K+++++   +   Y++ SE + K+L PL K       DF      I+V GVNG GKTT
Sbjct: 61  ANKKFSEEELKKENFYNIFSEEVIKILQPLEKKIVNTESDF----KTIIVCGVNGTGKTT 116

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKLSK   +   KV++ A DTFR+AAIDQLK+W D+ + + + SE+G+D A++A++  
Sbjct: 117 TIGKLSKLFKNHNKKVVVGAADTFRAAAIDQLKVWCDKNNTEMIQSEVGADPASVAFKTL 176

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+    D+ IIDTAGRL N   LM    K++RVLK++DP AP     VLDATTGQNA+
Sbjct: 177 EYAKNNNKDLCIIDTAGRLQNKKNLMEEFAKIVRVLKKIDPDAPQETWIVLDATTGQNAI 236

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q+E F  +   TG++MTK+DGTA+GG L+ I    KIP+  +GVGE   DL  F+A ++
Sbjct: 237 TQIEEFQKITPLTGIVMTKLDGTAKGGILVAIADRFKIPIVAIGVGEKEEDLNQFIASEY 296

Query: 307 SAVI 310
           S  +
Sbjct: 297 SQAL 300


>gi|148978744|ref|ZP_01815124.1| cell division protein FtsY [Vibrionales bacterium SWAT-3]
 gi|145962165|gb|EDK27449.1| cell division protein FtsY [Vibrionales bacterium SWAT-3]
          Length = 411

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 194/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+E L 
Sbjct: 107 SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMNTTVKIIENLT 166

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K    D+     LY +  E +  +L  + +P   D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 167 EKASRNDLKDGEALYGLLKEEMADILSQVEQPLVVDTTKTPYVILMVGVNGVGKTTTIGK 226

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+  + G KVMLAAGDTFR+AA++QL++W  R     +    G+D+A++ Y+A + A+
Sbjct: 227 LAKQFQNEGKKVMLAAGDTFRAAAVEQLQVWGQRNDVPVIAQHTGADSASVIYDAIEAAK 286

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 287 ARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 346

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI+DL PF +KDF
Sbjct: 347 LFSEVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRYIGVGEGIDDLRPFESKDF 402


>gi|327482688|gb|AEA85998.1| signal recognition particle receptor FtsY [Pseudomonas stutzeri DSM
           4166]
          Length = 442

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 192/302 (63%), Gaps = 2/302 (0%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           A   L +  +L +G + TS  + EG+  + +  + +DD + +ELE  L+ +D+GV     
Sbjct: 130 APAKLGFFARLRQGLSKTSASIGEGMASLFLGKKAIDDDLLDELETRLLTADVGVEATTA 189

Query: 66  IVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           I++ L  +   K+++    LY  + E +  +L P+ +P   D S RP+VILVVGVNGVGK
Sbjct: 190 IMQNLTRRVSRKELADSGALYTALQEELVGLLKPVEQPLAVDASKRPYVILVVGVNGVGK 249

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++
Sbjct: 250 TTTIGKLAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNGIPVIAQHTGADSASVIFD 309

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQN
Sbjct: 310 AVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVMGKLDESAPHEVLLVLDAGTGQN 369

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ Q   F+     TGL +TK+DGTA+GG +  +      P+ ++GVGEGI+DL  F A 
Sbjct: 370 AINQTRQFNQAVELTGLALTKLDGTAKGGVIFALAKQFGTPIRYIGVGEGIDDLRTFEAD 429

Query: 305 DF 306
            F
Sbjct: 430 AF 431


>gi|238789411|ref|ZP_04633197.1| Cell division protein ftsY [Yersinia frederiksenii ATCC 33641]
 gi|238722554|gb|EEQ14208.1| Cell division protein ftsY [Yersinia frederiksenii ATCC 33641]
          Length = 520

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 191/296 (64%), Gaps = 4/296 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 218 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFDELEEQLLIADVGVETTRKIITSLTE 277

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTTVIGK 130
               K +     LY  + E + ++L  + KP   D S + P+VIL+VGVNGVGKTT IGK
Sbjct: 278 HASRKQLKDAEALYGKLKEEMSEILSKVDKPL--DVSGKSPYVILMVGVNGVGKTTTIGK 335

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+++    G  VMLAAGDTFR+AA++QL++W DR     V    G+D+A++ ++A + A+
Sbjct: 336 LARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNKIAVVAQHTGADSASVIFDAIQAAK 395

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q +
Sbjct: 396 ARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAK 455

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 456 LFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 511


>gi|303250568|ref|ZP_07336765.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307252987|ref|ZP_07534874.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650556|gb|EFL80715.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859516|gb|EFM91542.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 581

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 192/295 (65%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    K++  L  
Sbjct: 278 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLVADLGMPTTTKVINNLTQ 337

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   +L + ++L P+S+P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 338 HASKKQLKDADLLYQQLKLELGEVLKPVSQPLEIDTSKKPYVILMVGVNGVGKTTTIGKL 397

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A +
Sbjct: 398 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAS 457

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 458 KGIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 517

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 518 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 572


>gi|126664539|ref|ZP_01735523.1| signal recognition particle-docking protein FtsY [Marinobacter sp.
           ELB17]
 gi|126630865|gb|EBA01479.1| signal recognition particle-docking protein FtsY [Marinobacter sp.
           ELB17]
          Length = 406

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 199/303 (65%), Gaps = 10/303 (3%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISS-RRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
            +S + ++ +G   T      G+ D+ S+ +++D  + EE+E  L+ +D+GV    +I+E
Sbjct: 102 QISVLERIRRGLGKTRASFTGGLADMFSAGKKIDADLLEEIETTLLMADVGVTATTEIIE 161

Query: 69  ELLTKRYAKDV-----SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVG 123
            L T++  +D      ++++ L D    +H +L  +SKP   D   +P+VIL+VGVNGVG
Sbjct: 162 SL-TEKLKRDQLKDGEALRQALRD---QLHGLLKDVSKPLVIDAQTKPYVILMVGVNGVG 217

Query: 124 KTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY 183
           KTT IGKL+KK  D G+ V+LAAGDTFR+AA++QL++W DR     +    G+D+A++ +
Sbjct: 218 KTTTIGKLTKKFQDEGMSVLLAAGDTFRAAAMEQLQVWGDRNKVPVIAQHTGADSASVIF 277

Query: 184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ 243
           +A + A+++ +DV+I DTAGRL N   LM+ + K++RV+K+LD  APH V+ VLDA TGQ
Sbjct: 278 DAIQSAKSRGIDVVIADTAGRLQNKDNLMSELEKVVRVMKKLDTAAPHEVMLVLDAGTGQ 337

Query: 244 NALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVA 303
           NAL Q ++F    G +G+ +TK+DGTA+GG +  I    ++P+ F+G+GE + DL  F A
Sbjct: 338 NALNQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRFIGIGEQVEDLRSFDA 397

Query: 304 KDF 306
           + F
Sbjct: 398 RAF 400


>gi|146284304|ref|YP_001174457.1| signal recognition particle receptor FtsY [Pseudomonas stutzeri
           A1501]
 gi|145572509|gb|ABP81615.1| signal recognition particle receptor FtsY [Pseudomonas stutzeri
           A1501]
          Length = 477

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 192/302 (63%), Gaps = 2/302 (0%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           A   L +  +L +G + TS  + EG+  + +  + +DD + +ELE  L+ +D+GV     
Sbjct: 165 APAKLGFFARLRQGLSKTSASIGEGMASLFLGKKAIDDDLLDELETRLLTADVGVEATTA 224

Query: 66  IVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           I++ L  +   K+++    LY  + E +  +L P+ +P   D S RP+VILVVGVNGVGK
Sbjct: 225 IMQNLTRRVSRKELADSGALYTALQEELVGLLKPVEQPLAIDASKRPYVILVVGVNGVGK 284

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++
Sbjct: 285 TTTIGKLAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNGIPVIAQHTGADSASVIFD 344

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQN
Sbjct: 345 AVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVMGKLDESAPHEVLLVLDAGTGQN 404

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ Q   F+     TGL +TK+DGTA+GG +  +      P+ ++GVGEGI+DL  F A 
Sbjct: 405 AINQTRQFNQAVELTGLALTKLDGTAKGGVIFALAKQFGTPIRYIGVGEGIDDLRTFEAD 464

Query: 305 DF 306
            F
Sbjct: 465 AF 466


>gi|167036150|ref|YP_001671381.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida GB-1]
 gi|166862638|gb|ABZ01046.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida GB-1]
          Length = 510

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 190/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 206 FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLT 265

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P      ++P+VILVVGVNG GKTT IGK
Sbjct: 266 QKVARKQLADADALYKSLQEELAALLRPVEQPLKVQAQNKPYVILVVGVNGAGKTTTIGK 325

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 326 LAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 385

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 386 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAK 445

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A+ F
Sbjct: 446 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPF 501


>gi|261819462|ref|YP_003257568.1| cell division protein FtsY [Pectobacterium wasabiae WPP163]
 gi|261603475|gb|ACX85961.1| signal recognition particle-docking protein FtsY [Pectobacterium
           wasabiae WPP163]
          Length = 471

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 191/297 (64%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL-- 70
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 169 FFARLKRSLVKTRQNLGSGFIGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIISSLTE 228

Query: 71  -LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
            +++R  KD     +   + E + ++L  +  P N +    P+VIL+VGVNGVGKTT IG
Sbjct: 229 HVSRRQLKDADT--LFVKLKEEMAEILAKVDAPLNIE-GKTPYVILMVGVNGVGKTTTIG 285

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A
Sbjct: 286 KMARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVAVVAQHTGADSASVIFDAIQAA 345

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q 
Sbjct: 346 KARGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQA 405

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 406 KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDF 462


>gi|320154974|ref|YP_004187353.1| signal recognition particle receptor protein FtsY subunit alpha
           [Vibrio vulnificus MO6-24/O]
 gi|319930286|gb|ADV85150.1| signal recognition particle receptor protein FtsY (alpha subunit)
           [Vibrio vulnificus MO6-24/O]
          Length = 395

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 198/304 (65%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+   
Sbjct: 83  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTT 142

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+E L  K   +D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 143 LKIIENLTEKASRRDLKDGEALYGLLKEEMAEILSKVEQPLQVDSSKTPYVILMVGVNGV 202

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+  + G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 203 GKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 262

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 263 YDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 322

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 323 QNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFNIPIRYIGVGEGIEDLRPFE 382

Query: 303 AKDF 306
            ++F
Sbjct: 383 TQEF 386


>gi|218198435|gb|EEC80862.1| hypothetical protein OsI_23481 [Oryza sativa Indica Group]
          Length = 473

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/299 (42%), Positives = 189/299 (63%), Gaps = 10/299 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 171 FFARLKRSLLKTKQNLGSGFMGLFRGKKIDDDLFDELEEQLLIADVGVDTTRKIITSLTQ 230

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
               K +     LY     ++SE++ K+  PL    N      P+VIL+VGVNGVGKTT 
Sbjct: 231 HASRKQLKDAEALYGKLKEEMSEILAKVDQPLDVSGN-----TPYVILMVGVNGVGKTTT 285

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A +
Sbjct: 286 IGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVVAQHTGADSASVIFDAVQ 345

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+A+ +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ 
Sbjct: 346 AAKARGIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDDQAPHEVMLTLDASTGQNAVS 405

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 406 QAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 464


>gi|332142894|ref|YP_004428632.1| signal recognition particle GTPase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|332143061|ref|YP_004428799.1| signal recognition particle GTPase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327552916|gb|AEA99634.1| signal recognition particle GTPase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327553083|gb|AEA99801.1| signal recognition particle GTPase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 541

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 193/309 (62%), Gaps = 6/309 (1%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q    E  S   +L +  + T   L  GI  +   + +DD + E+LE  L+ +D+G+   
Sbjct: 220 QDKPKEKKSLFARLRESLSRTKENLGSGIVSLFKGKAIDDELYEDLETQLLVADVGMDTT 279

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFN-----WDFSHRPHVILVV 117
           QKI+  L      KD+     L ++  + +  ML  +++P +      D S  P VIL+V
Sbjct: 280 QKIITHLTDSASRKDLKDAEALLEILKQRMSGMLSEVNQPLSDVMQAHDASEGPFVILMV 339

Query: 118 GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSD 177
           GVNGVGKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D
Sbjct: 340 GVNGVGKTTTIGKLAKQFQQQGKKVMLAAGDTFRAAAVEQLQVWGERNDIPVIAQHTGAD 399

Query: 178 AAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVL 237
           +A++ Y+A + A+++  D+LI DTAGRL N + LM  + K++RV+K+++P+APH V+  L
Sbjct: 400 SASVLYDALEAAKSRGTDILIADTAGRLQNKNNLMEELKKVVRVMKKINPNAPHEVMLTL 459

Query: 238 DATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGIND 297
           DA TGQNA+ Q ++F+   G TG+ +TK+DGTA+GG +  I    KIP+ ++GVGE I+D
Sbjct: 460 DAGTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFSIADKFKIPIRYIGVGESIDD 519

Query: 298 LEPFVAKDF 306
           L  F  ++F
Sbjct: 520 LRQFDGQEF 528


>gi|190150667|ref|YP_001969192.1| cell division protein FtsY [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|307264015|ref|ZP_07545615.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915798|gb|ACE62050.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306870626|gb|EFN02370.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 577

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 192/295 (65%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    K++  L  
Sbjct: 274 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLVADLGMPTTTKVINNLTQ 333

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   +L + ++L P+S+P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 334 HASKKQLKDADLLYQQLKLELGEVLKPVSQPLEIDTSKKPYVILMVGVNGVGKTTTIGKL 393

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A +
Sbjct: 394 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAS 453

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 454 KGIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 513

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 514 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 568


>gi|322513516|ref|ZP_08066617.1| cell division protein FtsY [Actinobacillus ureae ATCC 25976]
 gi|322120669|gb|EFX92560.1| cell division protein FtsY [Actinobacillus ureae ATCC 25976]
          Length = 575

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 195/299 (65%), Gaps = 9/299 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 272 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLIADLGMPTTTKIINSLTQ 331

Query: 72  --TKRYAKDVSV--QRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
             TK+  KD  +  Q++  ++ E+    L P+S+P   D S +P+VIL+VGVNGVGKTT 
Sbjct: 332 HATKQQLKDADLLYQQLKVELGEV----LKPVSQPLEIDTSKKPYVILMVGVNGVGKTTT 387

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A +
Sbjct: 388 IGKLARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQ 447

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A +K +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ 
Sbjct: 448 SAASKGIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAIS 507

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 508 QAKLFNEAVGLTGITLTKLDGTAKGGMIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 566


>gi|51473943|ref|YP_067700.1| cell division protein FtsY [Rickettsia typhi str. Wilmington]
 gi|81389950|sp|Q68VX4|FTSY_RICTY RecName: Full=Cell division protein ftsY homolog
 gi|51460255|gb|AAU04218.1| cell division protein FtsY [Rickettsia typhi str. Wilmington]
          Length = 303

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 129/303 (42%), Positives = 190/303 (62%), Gaps = 3/303 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           ++   KL +  + TS  +  GI  I   ++LD     ELE+LLI SDI + V   I+E+ 
Sbjct: 2   ITIFNKLKQSLSKTSNTISTGIDKIFYKKKLDQTTLNELEELLISSDISITVVTHIIEKF 61

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              ++ K +    V   +++LI + L     PF     ++ ++IL+ GVNGVGKTT IGK
Sbjct: 62  KNVKFDKTIDSDTVKEAIAKLIEQQLSKSEIPFTLS-ENKLNIILICGVNGVGKTTTIGK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           LS   S  G KV +AA DTFR+AAI+QL  W DR +A  +  E+ +D A++AY A +++ 
Sbjct: 121 LSALYSAQGKKVAVAACDTFRAAAINQLSSWVDRANALLITGEVSADPASVAYRAIQESI 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP-HSVLQVLDATTGQNALRQV 249
            + +D+L IDTAGRLHNN  LM  + K+++V+K+LD +AP HS+L ++DA TGQN   Q+
Sbjct: 181 KQNIDILFIDTAGRLHNNKNLMDELSKIVKVIKKLDENAPTHSIL-IIDAVTGQNTYNQI 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F+ V   TGLI+TK+DG+A+ G L+  V    +P+YF+G+GE I DL+ F   DFS  
Sbjct: 240 EYFNDVTNLTGLIITKLDGSAKAGVLVGAVQKFNLPIYFIGIGEQIEDLKIFNRHDFSRS 299

Query: 310 ITG 312
           + G
Sbjct: 300 LVG 302


>gi|326423803|ref|NP_760099.2| signal recognition particle-docking protein FtsY [Vibrio vulnificus
           CMCP6]
 gi|319999171|gb|AAO09626.2| signal recognition particle-docking protein FtsY [Vibrio vulnificus
           CMCP6]
          Length = 395

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 198/304 (65%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+   
Sbjct: 83  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTT 142

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+E L  K   +D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 143 LKIIENLTEKASRRDLKDGEALYGLLKEEMAEILSKVEQPLQVDSSKTPYVILMVGVNGV 202

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+  + G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 203 GKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 262

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 263 YDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 322

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 323 QNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFNIPIRYIGVGEGIEDLRPFE 382

Query: 303 AKDF 306
            ++F
Sbjct: 383 TQEF 386


>gi|301155326|emb|CBW14792.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Haemophilus parainfluenzae
           T3T1]
          Length = 485

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + +ELE+ L+ +DIGV    KI++ L  
Sbjct: 180 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDDLFDELEEQLLIADIGVPTTNKIIKNLTE 239

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   ++ + ++L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 240 HASRKQLQDAELLYQQLKVEMVEILKPVAQPLVIDTTKKPYVILMVGVNGVGKTTTIGKL 299

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K  + G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A A
Sbjct: 300 ARKFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAA 359

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+++ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 360 RNIDILIADTAGRLQNKNNLMDELKKIVRVMRKYDETAPHEIMLTLDAGTGQNAISQAKL 419

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A++F
Sbjct: 420 FDEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEF 474


>gi|78486281|ref|YP_392206.1| signal recognition particle-docking protein FtsY [Thiomicrospira
           crunogena XCL-2]
 gi|78364567|gb|ABB42532.1| signal recognition particle-docking protein FtsY [Thiomicrospira
           crunogena XCL-2]
          Length = 373

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 195/312 (62%), Gaps = 7/312 (2%)

Query: 6   VASESLSWIR-----KLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIG 59
           V++ES    R     +L    + T     E +  ++  R+ +DD + +ELE +L+ +D+G
Sbjct: 55  VSTESQKTTRPGLFSRLKNSLSKTRKGFTENLATLVMGRKEIDDDLLDELEMILLTADVG 114

Query: 60  VAVAQKIVEELLTKRYAKDV-SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVG 118
           V     I++ L  +   K++   ++++  + + +  +L P+++P        P VIL+VG
Sbjct: 115 VEATDTIIQNLTGQVSRKELKEPEKLIQALKQQLETLLEPVTQPLVLPEKEGPFVILMVG 174

Query: 119 VNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA 178
           VNGVGKTT IGKL+KK  + G  VMLAAGDTFR+AA++QL+ W +R     V  + G+D+
Sbjct: 175 VNGVGKTTTIGKLAKKFQNEGKSVMLAAGDTFRAAAVEQLQTWGERNQVPVVAQKTGADS 234

Query: 179 AALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD 238
           AA+ ++A + A AK +DVLI DTAGRLH  S LM  + K+ RV++++D  APH V+ VLD
Sbjct: 235 AAVIFDAIQSATAKNIDVLIADTAGRLHTQSNLMEELKKVKRVIQKVDSSAPHEVMLVLD 294

Query: 239 ATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDL 298
           A TGQNAL Q + F+     TGL +TK+DGTA+GG +  +     IPV F+GVGE I+DL
Sbjct: 295 AGTGQNALSQAQQFYEAVEITGLTLTKLDGTAKGGIIFALAEKLGIPVRFIGVGEAIDDL 354

Query: 299 EPFVAKDFSAVI 310
            PF A +FS  +
Sbjct: 355 RPFDANEFSEAL 366


>gi|254419772|ref|ZP_05033496.1| signal recognition particle-docking protein FtsY [Brevundimonas sp.
           BAL3]
 gi|196185949|gb|EDX80925.1| signal recognition particle-docking protein FtsY [Brevundimonas sp.
           BAL3]
          Length = 311

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 194/303 (64%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++L+ G + +S ++ + +        L +   E LE+ L+ SD+G A + +IVE    
Sbjct: 9   WFQRLSAGLSRSSKQMTDQVVASFVKEPLSEAALERLEEHLLESDLGPAASARIVERFRA 68

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            ++ KD     V   ++E +   L P    F+     +P+V+L VGVNG GKTT +GK++
Sbjct: 69  LKFGKDAQEHEVKEALAEAVAAELSPRQAAFDPLSGPKPYVVLFVGVNGSGKTTTLGKIA 128

Query: 133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK 192
             ++  G KVM+ AGDTFR+AA +QLK+WADR  A+F     G+DAA L ++A+ +A+A+
Sbjct: 129 ADLTAKGAKVMIVAGDTFRAAAREQLKVWADRAGAEFESRRDGADAAGLVFDAYAKARAE 188

Query: 193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMF 252
             DV+++DTAGRL N S LM  + K++RVLK++DP APH  L VLDAT G+NAL Q ++F
Sbjct: 189 GFDVVLVDTAGRLQNKSALMDELLKIVRVLKKIDPAAPHDTLLVLDATVGRNALAQEQIF 248

Query: 253 HAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
              A  TG++MTK+DGTARGG L+P+      P+  +GVGEGI+DL+PF A+ FS  + G
Sbjct: 249 GRTAFVTGIVMTKLDGTARGGVLVPVAQASDAPLMLIGVGEGIDDLQPFDARAFSRSLVG 308

Query: 313 CLD 315
             D
Sbjct: 309 LED 311


>gi|92115105|ref|YP_575033.1| signal recognition particle-docking protein FtsY [Chromohalobacter
           salexigens DSM 3043]
 gi|91798195|gb|ABE60334.1| signal recognition particle-docking protein FtsY [Chromohalobacter
           salexigens DSM 3043]
          Length = 501

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 189/301 (62%), Gaps = 3/301 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W  ++  G   T     EG+  + +  +++DD + E+LE  L+ +D+G+    +I++ L 
Sbjct: 192 WFARIKAGLGKTRANFTEGLAGLFLGKKQIDDDLMEDLETQLLMADVGIEATTEIIDRLT 251

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTTVIG 129
            +   K++   + LY  + E +  +L P+++P       + P VIL+VGVNGVGKTT IG
Sbjct: 252 ERVSRKELKDPQALYSALQEELQDLLDPVAQPLALPPKGQGPFVILMVGVNGVGKTTTIG 311

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+++    G  VMLAAGDTFR+AA++QLK+W +R     V    G+D+A++ Y+A   A
Sbjct: 312 KLTQRFQREGRSVMLAAGDTFRAAAVEQLKVWGERNHVPVVAQHTGADSASVIYDALSAA 371

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRLHN S LM  + K+ RV+ +LD  APH V+ VLDA TGQNAL Q 
Sbjct: 372 KARGVDVLIADTAGRLHNKSHLMEELKKVRRVMAKLDEQAPHEVMLVLDAGTGQNALSQA 431

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
             F+     TG+ +TK+DGTA+GG +  +      P+ F+GVGE ++DL PF A+DF + 
Sbjct: 432 STFNEAVPVTGITLTKLDGTAKGGIIFALAKQLGTPIRFIGVGETLDDLRPFAAEDFVSA 491

Query: 310 I 310
           +
Sbjct: 492 L 492


>gi|90412727|ref|ZP_01220728.1| putative cell division protein FtsY [Photobacterium profundum 3TCK]
 gi|90326302|gb|EAS42721.1| putative cell division protein FtsY [Photobacterium profundum 3TCK]
          Length = 438

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 128/299 (42%), Positives = 194/299 (64%), Gaps = 1/299 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           +S  +  +L +G   T      G   + S +++DD + EELE+ L+ +D+G+    KI+E
Sbjct: 131 QSDGFFARLMRGLKKTKTNFGSGFFGLFSGKKIDDELFEELEEQLLIADVGMDTTLKIIE 190

Query: 69  ELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            L  K   K++     LY +  E +  ML  + +P   D S +P VIL+VGVNGVGKTT 
Sbjct: 191 NLTDKANRKELKDGEALYGLLKEELADMLSTVEQPLIVDTSQKPFVILMVGVNGVGKTTT 250

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+K+    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A +
Sbjct: 251 IGKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNGVPVVAQHTGADSASVIFDAIE 310

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+A+ VDV+I DTAGRL N   LM  + K++RV+K++DP APH ++  +DA TGQNA+ 
Sbjct: 311 SAKARNVDVVIADTAGRLQNKGHLMEELRKIVRVMKKVDPAAPHEIMLTVDAGTGQNAIS 370

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F  VA  +G+ ++K+DGTA+GG +  I     IP+ ++G+GEGI+DL PFVA +F
Sbjct: 371 QAKLFSEVAPVSGITISKLDGTAKGGVIFAIADQFSIPIRYIGIGEGIDDLRPFVADEF 429


>gi|299769869|ref|YP_003731895.1| signal recognition particle-docking protein FtsY [Acinetobacter sp.
           DR1]
 gi|298699957|gb|ADI90522.1| signal recognition particle-docking protein FtsY [Acinetobacter sp.
           DR1]
          Length = 370

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/307 (43%), Positives = 196/307 (63%), Gaps = 2/307 (0%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQ 64
           V      +  ++ +G   T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   +
Sbjct: 59  VEQPKTGFFGRMKEGLTKTRRNFADGMVNILIGGKEIDDELLEEVEEQLLVADIGVEATK 118

Query: 65  KIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVG 123
            I+  L  +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVG
Sbjct: 119 TIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVG 178

Query: 124 KTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY 183
           KTT IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ +
Sbjct: 179 KTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDISVVAQGHGADSASVIF 238

Query: 184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ 243
           +AF+ A+AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQ
Sbjct: 239 DAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQ 298

Query: 244 NALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVA 303
           NA+ QV+ F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF A
Sbjct: 299 NAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSA 358

Query: 304 KDFSAVI 310
           K F A +
Sbjct: 359 KSFVAAL 365


>gi|24376059|ref|NP_720102.1| cell division protein FtsY [Shewanella oneidensis MR-1]
 gi|24351075|gb|AAN57546.1|AE015890_7 cell division protein FtsY [Shewanella oneidensis MR-1]
          Length = 510

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 195/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L 
Sbjct: 203 SFFARLKRGLMRTSENIGSGFIGLFRGKKIDDELFEELEEQLLIADVGVETTGRLIKSLT 262

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                K +     LYD+  + + K L P++ P   + ++ P VIL+VGVNGVGKTT IGK
Sbjct: 263 EHASRKQLKDAEALYDLLRDEMQKTLDPVAIPLVPENANGPFVILMVGVNGVGKTTTIGK 322

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A+
Sbjct: 323 LAKQYQRQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVLFDALQAAK 382

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+K+DVLI DTAGRL N S LM  + K++RV+K+LDP APH V+  LDA+TGQNA+ Q +
Sbjct: 383 ARKIDVLIADTAGRLQNKSHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQ 442

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G TG+ ++K+DGTA+GG +  I    KIP+ ++GVGE I+DL  F +K+F
Sbjct: 443 LFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEF 498


>gi|148550186|ref|YP_001270288.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida F1]
 gi|148514244|gb|ABQ81104.1| signal recognition particle-docking protein FtsY [Pseudomonas
           putida F1]
          Length = 497

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 190/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + +E+E  L+ +D+GV     IV+ L 
Sbjct: 193 FFARLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLT 252

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  + E +  +L P+ +P      ++P+VILVVGVNG GKTT IGK
Sbjct: 253 QKVARKQLADADALYKSLQEELAALLRPVEQPLKVQAQNKPYVILVVGVNGAGKTTTIGK 312

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 313 LAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAK 372

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 373 ARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDVEAPHEVLLVLDAGTGQNAISQAK 432

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     IP+ F+GVGEGI+DL  F A+ F
Sbjct: 433 YFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPF 488


>gi|293607882|ref|ZP_06690185.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828455|gb|EFF86817.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122473|gb|ADY81996.1| cell division protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 370

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/307 (43%), Positives = 196/307 (63%), Gaps = 2/307 (0%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQ 64
           V      +  ++ +G   T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   +
Sbjct: 59  VEQPKTGFFGRMKEGLTKTRRNFADGMVNILIGGKEIDDELLEEVEEQLLVADIGVEATK 118

Query: 65  KIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVG 123
            I+  L  +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVG
Sbjct: 119 TIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVG 178

Query: 124 KTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY 183
           KTT IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ +
Sbjct: 179 KTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDISVVAQGHGADSASVIF 238

Query: 184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ 243
           +AF+ A+AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQ
Sbjct: 239 DAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQ 298

Query: 244 NALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVA 303
           NA+ QV+ F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF A
Sbjct: 299 NAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSA 358

Query: 304 KDFSAVI 310
           K F A +
Sbjct: 359 KSFVAAL 365


>gi|21672318|ref|NP_660385.1| cell division protein FtsY [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25090363|sp|Q8KA77|FTSY_BUCAP RecName: Full=Cell division protein ftsY homolog
 gi|21622918|gb|AAM67596.1| cell division protein FtsY [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 351

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 192/304 (63%), Gaps = 2/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q + ++ + ++ KL      T     + I+ I  S+++DD   EELED ++ SDIGV   
Sbjct: 42  QNIDNKKIDFLFKLKNSLNKTKQFFGDSISRIFLSKKIDDAFFEELEDTMLLSDIGVHTT 101

Query: 64  QKIVEELLTKRYAKDV-SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            +I+ +L+     K++ + ++V + + E ++ +L  + KP     +H P VILVVG+NG 
Sbjct: 102 DQIISKLINDATHKELKNPEKVYFLLKEHMYSILNRVEKPLKIS-NHTPFVILVVGINGT 160

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT + KL+KK   AG  VMLAA DTFR+A I+QL+I   R +   +    GSD A++A
Sbjct: 161 GKTTTVSKLAKKYKLAGKSVMLAAADTFRAAGIEQLQILGKRNNIPVISQSSGSDPASVA 220

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           ++A K A +KK+DVLIIDTAGRLHN   L+  + KM+RV+K+L+  APH ++ ++DA  G
Sbjct: 221 FDAVKSAISKKIDVLIIDTAGRLHNKLHLLEELKKMVRVIKKLNLSAPHEIMLIIDACNG 280

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QN ++Q EMFH     TGL++TK+DGTA+GG +  +     IP+ ++G+GE   DL  F 
Sbjct: 281 QNTIKQTEMFHKAINLTGLVITKLDGTAKGGVIFSLANQFLIPIRYIGIGEKTTDLVVFN 340

Query: 303 AKDF 306
           + DF
Sbjct: 341 SNDF 344


>gi|260771642|ref|ZP_05880562.1| signal recognition particle receptor protein FtsY [Vibrio
           metschnikovii CIP 69.14]
 gi|260613419|gb|EEX38618.1| signal recognition particle receptor protein FtsY [Vibrio
           metschnikovii CIP 69.14]
          Length = 388

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    S S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+   
Sbjct: 76  QEQEKPSESFFVRLKRSLSRTKANIGAGFFGLFQGKKIDDQLFEELEEQLLMADVGMETT 135

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K   + +     LY +  + + +ML  + KP   D    P+VIL+VGVNGV
Sbjct: 136 VKIITSLTEKASRQQLRDGEALYALLKQEMAEMLAKVEKPLQIDSQTMPYVILMVGVNGV 195

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ 
Sbjct: 196 GKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNHVPVIAQHTGADSASVI 255

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ +DV+I DTAGRL N + LM  + K++RV+K++DP APH ++  LDA TG
Sbjct: 256 YDAIEAAKARGIDVVIADTAGRLQNKANLMEELKKIVRVMKKIDPQAPHEIMLTLDAGTG 315

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F   A  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI+DL PFV
Sbjct: 316 QNAISQAKLFSQAAPLTGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEGIDDLRPFV 375

Query: 303 AKDF 306
            ++F
Sbjct: 376 TQEF 379


>gi|303253508|ref|ZP_07339647.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248379|ref|ZP_07530402.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307257413|ref|ZP_07539182.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307261833|ref|ZP_07543497.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|302647618|gb|EFL77835.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855117|gb|EFM87297.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306864065|gb|EFM95979.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306868450|gb|EFN00263.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 576

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    K++  L  
Sbjct: 273 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLVADLGMPTTTKVINNLTQ 332

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   +L + ++L P+S+P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 333 HASKKQLKDADLLYQQLKLELGEVLKPVSQPLEIDTSKKPYVILMVGVNGVGKTTTIGKL 392

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A +
Sbjct: 393 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAS 452

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 453 KGIDILIADTAGRLQNKNNLMDELKKIVRVTKKYDESAPHEIMLTLDAGTGQNAISQAKL 512

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 513 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 567


>gi|165976771|ref|YP_001652364.1| cell division protein [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|165876872|gb|ABY69920.1| cell division protein [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
          Length = 573

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    K++  L  
Sbjct: 270 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLVADLGMPTTTKVINNLTQ 329

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   +L + ++L P+S+P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 330 HASKKQLKDADLLYQQLKLELGEVLKPVSQPLEIDTSKKPYVILMVGVNGVGKTTTIGKL 389

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A +
Sbjct: 390 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAS 449

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 450 KGIDILIADTAGRLQNKNNLMDELKKIVRVTKKYDESAPHEIMLTLDAGTGQNAISQAKL 509

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 510 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 564


>gi|117922404|ref|YP_871596.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           ANA-3]
 gi|117614736|gb|ABK50190.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           ANA-3]
          Length = 562

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 196/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L 
Sbjct: 255 SFFARLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTSRLIKSLT 314

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                K +     LY++  + + K L P++ P   + ++ P+VIL+VGVNGVGKTT IGK
Sbjct: 315 EHASRKQLKDAEALYELLRDEMQKTLDPVAIPLVPENANGPYVILMVGVNGVGKTTTIGK 374

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A+
Sbjct: 375 LAKQYQRQGKTVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVLFDALQAAK 434

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+K+D+LI DTAGRL N S LM  + K++RV+K+LDP APH V+  LDA+TGQNA+ Q +
Sbjct: 435 ARKIDILIADTAGRLQNKSHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQ 494

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G TG+ ++K+DGTA+GG +  I    KIP+ ++GVGE I+DL  F +K+F
Sbjct: 495 LFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEF 550


>gi|37678296|ref|NP_932905.1| signal recognition particle GTPase [Vibrio vulnificus YJ016]
 gi|37197035|dbj|BAC92876.1| signal recognition particle GTPase [Vibrio vulnificus YJ016]
          Length = 437

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 198/304 (65%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+   
Sbjct: 125 QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTT 184

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+E L  K   +D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 185 LKIIENLTEKASRRDLKDGEALYGLLKEEMAEILSKVEQPLQVDSSKTPYVILMVGVNGV 244

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+  + G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 245 GKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 304

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 305 YDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 364

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 365 QNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFNIPIRYIGVGEGIEDLRPFE 424

Query: 303 AKDF 306
            ++F
Sbjct: 425 TQEF 428


>gi|53728959|ref|ZP_00134416.2| COG0552: Signal recognition particle GTPase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208810|ref|YP_001054035.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae L20]
 gi|126097602|gb|ABN74430.1| cell division protein FtsY-like protein [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 577

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    K++  L  
Sbjct: 274 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLVADLGMPTTTKVINNLTQ 333

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   +L + ++L P+S+P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 334 HASKKQLKDADLLYQQLKLELGEVLKPVSQPLEIDTSKKPYVILMVGVNGVGKTTTIGKL 393

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A +
Sbjct: 394 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAS 453

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 454 KGIDILIADTAGRLQNKNNLMDELKKIVRVTKKYDESAPHEIMLTLDAGTGQNAISQAKL 513

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 514 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 568


>gi|50123266|ref|YP_052433.1| cell division protein FtsY [Pectobacterium atrosepticum SCRI1043]
 gi|49613792|emb|CAG77243.1| cell division protein [Pectobacterium atrosepticum SCRI1043]
          Length = 469

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 124/297 (41%), Positives = 191/297 (64%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI++ L  
Sbjct: 167 FFARLKRSLVKTRENLGSGFIGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIDSLTE 226

Query: 72  --TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             ++R  KD     +   + E + ++L  +  P N +    P+VIL+VGVNGVGKTT IG
Sbjct: 227 HASRRQLKDADT--LFVKLKEEMAEILAKVDVPLNIE-GKTPYVILMVGVNGVGKTTTIG 283

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A
Sbjct: 284 KMARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVPVIAQHTGADSASVIFDAIQAA 343

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q 
Sbjct: 344 KARGVDVLIADTAGRLQNKAYLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQA 403

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 404 KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDF 460


>gi|330891336|gb|EGH23997.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 354

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 194/305 (63%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 39  QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLPADVGVEA 98

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 99  TSVIIKSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNG 158

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 159 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 218

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 219 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 278

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P++++GVGEGI+DL  F
Sbjct: 279 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIHYIGVGEGIDDLRTF 338

Query: 302 VAKDF 306
            A+ F
Sbjct: 339 EAEPF 343


>gi|307246266|ref|ZP_07528347.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307250606|ref|ZP_07532547.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307255250|ref|ZP_07537065.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259685|ref|ZP_07541408.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852875|gb|EFM85099.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306857347|gb|EFM89462.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306861799|gb|EFM93778.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866225|gb|EFM98090.1| Signal recognition particle-docking protein FtsY [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 577

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G  +  S +++DD + EELE+ L+ +D+G+    K++  L  
Sbjct: 274 FFSRLLKGLVKTKQSIGSGFRNFFSGKKIDDDLFEELEEQLLVADLGMPTTTKVINNLTQ 333

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   +L + ++L P+S+P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 334 HASKKQLKDADLLYQQLKLELGEVLKPVSQPLEIDTSKKPYVILMVGVNGVGKTTTIGKL 393

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A +
Sbjct: 394 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAS 453

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 454 KGIDILIADTAGRLQNKNNLMDELKKIVRVTKKYDESAPHEIMLTLDAGTGQNAISQAKL 513

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 514 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 568


>gi|289672445|ref|ZP_06493335.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. syringae FF5]
          Length = 339

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 31  VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 90

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      HRP VILVVGVNG GKTT I
Sbjct: 91  LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKSEHRPFVILVVGVNGAGKTTTI 150

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 151 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 210

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 211 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 270

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 271 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 328


>gi|262279319|ref|ZP_06057104.1| signal recognition particle-docking protein FtsY [Acinetobacter
           calcoaceticus RUH2202]
 gi|262259670|gb|EEY78403.1| signal recognition particle-docking protein FtsY [Acinetobacter
           calcoaceticus RUH2202]
          Length = 370

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 136/311 (43%), Positives = 197/311 (63%), Gaps = 2/311 (0%)

Query: 2   SNQKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGV 60
           S   V      +  ++ +G   T     +G+ +I I  + +DD + EE+E+ L+ +DIGV
Sbjct: 55  SETAVEQPKSGFFGRMKEGLTKTRRNFADGMVNILIGGKEIDDELLEEVEEQLLVADIGV 114

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
              + I+  L  +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGV
Sbjct: 115 EATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGV 174

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NGVGKTT IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A
Sbjct: 175 NGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSA 234

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           ++ ++AF+ A+AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA
Sbjct: 235 SVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDA 294

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
            TGQNA+ QV+ F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL 
Sbjct: 295 GTGQNAINQVQEFDQTVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLR 354

Query: 300 PFVAKDFSAVI 310
           PF AK F A +
Sbjct: 355 PFSAKSFVAAL 365


>gi|227358349|ref|ZP_03842690.1| cell division protein FtsY [Proteus mirabilis ATCC 29906]
 gi|227161685|gb|EEI46722.1| cell division protein FtsY [Proteus mirabilis ATCC 29906]
          Length = 401

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   +   +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 99  FFSRLKKGLLKTRQNLGSGFMGLFRGKKIDDELFEELEEQLLIADVGMDTTSKIINSLTQ 158

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               KD+     LY  + E +  +L  + KP N +   +P VIL+VGVNGVGKTT IGKL
Sbjct: 159 HASRKDLKDAESLYGKLREEMGDILNKVDKPLNIE-GKKPFVILMVGVNGVGKTTTIGKL 217

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D A++ ++A + AQA
Sbjct: 218 ARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADPASVIFDAIQSAQA 277

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 278 KGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTLDASTGQNAVSQAKL 337

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TGL +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 338 FNETVGLTGLTLTKLDGTAKGGVIFSIADQFGIPIRYIGVGEGIEDLRPFKADDF 392


>gi|332871215|ref|ZP_08439792.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii 6013113]
 gi|332731700|gb|EGJ62983.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii 6013113]
          Length = 369

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 196/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G + T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 65  FFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLT 124

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 125 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGK 184

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A+
Sbjct: 185 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESAR 244

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 245 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 304

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 305 EFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 364


>gi|227113848|ref|ZP_03827504.1| cell division protein FtsY [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 503

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 190/297 (63%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 201 FFARLKRSLVKTRQNLGSGFIGLFRGKKIDDDLFDELEEQLLVADVGVETTRKIITSLTE 260

Query: 72  --TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             ++R  KD     +   + E + ++L  +  P N +    P+VIL+VGVNGVGKTT IG
Sbjct: 261 HASRRQLKDADT--LFVKLKEEMAEILAKVDAPLNIE-GKTPYVILMVGVNGVGKTTTIG 317

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A
Sbjct: 318 KMARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVAVVAQHTGADSASVIFDAIQAA 377

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q 
Sbjct: 378 KARGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQA 437

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 438 KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDF 494


>gi|169795732|ref|YP_001713525.1| cell division protein [Acinetobacter baumannii AYE]
 gi|213157575|ref|YP_002319620.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB0057]
 gi|215483218|ref|YP_002325425.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB307-0294]
 gi|301345809|ref|ZP_07226550.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB056]
 gi|301513516|ref|ZP_07238753.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB058]
 gi|301594918|ref|ZP_07239926.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB059]
 gi|332850276|ref|ZP_08432624.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii 6013150]
 gi|169148659|emb|CAM86525.1| cell division protein [Acinetobacter baumannii AYE]
 gi|213056735|gb|ACJ41637.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB0057]
 gi|213986284|gb|ACJ56583.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii AB307-0294]
 gi|332730851|gb|EGJ62160.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii 6013150]
          Length = 368

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 196/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G + T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 64  FFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLT 123

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 124 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGK 183

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A+
Sbjct: 184 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESAR 243

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 244 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 303

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 304 EFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 363


>gi|197287408|ref|YP_002153280.1| cell division protein [Proteus mirabilis HI4320]
 gi|194684895|emb|CAR47054.1| cell division protein [Proteus mirabilis HI4320]
          Length = 612

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   +   +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 310 FFSRLKKGLLKTRQNLGSGFMGLFRGKKIDDELFEELEEQLLIADVGMDTTSKIINSLTQ 369

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               KD+     LY  + E +  +L  + KP N +   +P VIL+VGVNGVGKTT IGKL
Sbjct: 370 HASRKDLKDAESLYGKLREEMGDILNKVDKPLNIE-GKKPFVILMVGVNGVGKTTTIGKL 428

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D A++ ++A + AQA
Sbjct: 429 ARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADPASVIFDAIQSAQA 488

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 489 KGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTLDASTGQNAVSQAKL 548

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TGL +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 549 FNETVGLTGLTLTKLDGTAKGGVIFSIADQFGIPIRYIGVGEGIEDLRPFKADDF 603


>gi|184158365|ref|YP_001846704.1| Signal recognition particle GTPase [Acinetobacter baumannii ACICU]
 gi|239503951|ref|ZP_04663261.1| Signal recognition particle GTPase [Acinetobacter baumannii AB900]
 gi|260554794|ref|ZP_05827015.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii ATCC 19606]
 gi|332872440|ref|ZP_08440413.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii 6014059]
 gi|183209959|gb|ACC57357.1| Signal recognition particle GTPase [Acinetobacter baumannii ACICU]
 gi|193077529|gb|ABO12357.2| cell division protein [Acinetobacter baumannii ATCC 17978]
 gi|260411336|gb|EEX04633.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii ATCC 19606]
 gi|322508691|gb|ADX04145.1| Cell division protein [Acinetobacter baumannii 1656-2]
 gi|323518297|gb|ADX92678.1| Signal recognition particle GTPase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332739363|gb|EGJ70217.1| signal recognition particle-docking protein FtsY [Acinetobacter
           baumannii 6014059]
          Length = 368

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 196/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G + T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 64  FFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLT 123

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 124 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGK 183

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A+
Sbjct: 184 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESAR 243

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 244 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 303

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 304 EFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 363


>gi|153835089|ref|ZP_01987756.1| cell division protein FtsY [Vibrio harveyi HY01]
 gi|148868439|gb|EDL67547.1| cell division protein FtsY [Vibrio harveyi HY01]
          Length = 410

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 198/304 (65%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 98  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMETT 157

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 158 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILAKVEQPLEIDSSKTPYVILMVGVNGV 217

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+  + G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 218 GKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 277

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 278 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 337

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF 
Sbjct: 338 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFE 397

Query: 303 AKDF 306
            ++F
Sbjct: 398 TQEF 401


>gi|307546425|ref|YP_003898904.1| signal recognition particle receptor [Halomonas elongata DSM 2581]
 gi|307218449|emb|CBV43719.1| K03110 signal recognition particle receptor [Halomonas elongata DSM
           2581]
          Length = 455

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 188/310 (60%), Gaps = 9/310 (2%)

Query: 3   NQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVA 61
            +K   E   W  ++  G   T   L +G+  +   R+ +DD + EELE  L+ +D+G+ 
Sbjct: 137 REKPRGEKKGWFARIKDGLGKTRANLTDGLAGLFLGRKQIDDDLMEELETQLLMADVGIE 196

Query: 62  VAQKIVEELLTKRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHRPHVILV 116
              +I++ L  +   K++     L+     +++ L+  +  PL  P        P VILV
Sbjct: 197 ATTEIIDRLTERVSRKELKDPEALFKALQEELASLLDGVTQPLELPPK---GEGPFVILV 253

Query: 117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGS 176
           VGVNGVGKTT IGKL+++    G  VMLAAGDTFR+AA++QLK+W +R S   V    G+
Sbjct: 254 VGVNGVGKTTTIGKLTQRFQREGRSVMLAAGDTFRAAAVEQLKVWGERNSVPVVAQHTGA 313

Query: 177 DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV 236
           D+A++ Y+A   A+A+ VDVLI DTAGRLHN S LM  + K+ RV+ +LD  APH V+ V
Sbjct: 314 DSASVVYDALAAARARGVDVLIADTAGRLHNKSHLMEELKKVRRVMGKLDADAPHEVMLV 373

Query: 237 LDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGIN 296
           LDA TGQNAL Q   F+     TG+ +TK+DGTA+GG +  +      P+ F+GVGE ++
Sbjct: 374 LDAGTGQNALSQASTFNEAVPVTGITLTKLDGTAKGGIIFALAQQLGTPIRFIGVGETLD 433

Query: 297 DLEPFVAKDF 306
           DL PF A++F
Sbjct: 434 DLRPFAAREF 443


>gi|308051465|ref|YP_003915031.1| signal recognition particle-docking protein FtsY [Ferrimonas
           balearica DSM 9799]
 gi|307633655|gb|ADN77957.1| signal recognition particle-docking protein FtsY [Ferrimonas
           balearica DSM 9799]
          Length = 590

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 190/296 (64%), Gaps = 3/296 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L  G   TS  +  G   +   +++DD + EELE  L+ +D+GV    +I++ L  
Sbjct: 285 FFARLKAGLRRTSENIGGGFMALFKGKKIDDELFEELETQLLLADVGVETTSRIIDSLTD 344

Query: 73  KRYAKDVSVQRVLYD--VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
           K    ++     L+    SEL    L  + +P   +  + P VIL+VGVNGVGKTT IGK
Sbjct: 345 KASFGELKDSDALFAHLKSEL-KDTLSKVDQPLVIENPNGPFVILMVGVNGVGKTTTIGK 403

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W DR +   +    G+D+A++ ++A + A+
Sbjct: 404 LAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNNIPVIAQHTGADSASVIFDALQAAK 463

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ VDVLI DTAGRL N + LM  + K++RV+K+LD +APH V+  LDA+TGQNA+ Q +
Sbjct: 464 ARNVDVLIADTAGRLQNKAHLMDELKKIVRVMKKLDENAPHEVMLTLDASTGQNAISQAQ 523

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F+   G TGL +TK+DGTA+GG +  +     IPV ++GVGEGI+DL PF ++ F
Sbjct: 524 IFNEAVGLTGLTLTKLDGTAKGGVIFALADKFGIPVRYIGVGEGIDDLRPFESQAF 579


>gi|156972628|ref|YP_001443535.1| signal recognition particle GTPase [Vibrio harveyi ATCC BAA-1116]
 gi|156524222|gb|ABU69308.1| hypothetical protein VIBHAR_00280 [Vibrio harveyi ATCC BAA-1116]
          Length = 408

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 198/304 (65%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 96  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMETT 155

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 156 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILAKVEQPLEIDSSKTPYVILMVGVNGV 215

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+  + G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 216 GKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 275

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 276 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 335

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF 
Sbjct: 336 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFE 395

Query: 303 AKDF 306
            ++F
Sbjct: 396 TQEF 399


>gi|227329287|ref|ZP_03833311.1| cell division protein FtsY [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 488

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 190/297 (63%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 186 FFARLKRSLVKTRQNLGSGFIGLFRGKKIDDDLFDELEEQLLVADVGVETTRKIIGSLTE 245

Query: 72  --TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             ++R  KD     +   + E + ++L  +  P N +    P+VIL+VGVNGVGKTT IG
Sbjct: 246 HASRRQLKDADT--LFVKLKEEMAEILAKVDAPLNIE-GKTPYVILMVGVNGVGKTTTIG 302

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A
Sbjct: 303 KMARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVAVVAQHTGADSASVIFDAIQAA 362

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q 
Sbjct: 363 KARGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQA 422

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 423 KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDF 479


>gi|167648815|ref|YP_001686478.1| signal recognition particle-docking protein FtsY [Caulobacter sp.
           K31]
 gi|167351245|gb|ABZ73980.1| signal recognition particle-docking protein FtsY [Caulobacter sp.
           K31]
          Length = 314

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 202/304 (66%), Gaps = 1/304 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           W ++LT G A +S ++ E +T + + + LD    ++LE++LI +D+G  +A +I +    
Sbjct: 11  WFQRLTSGLARSSQQMTEQVTGVFTKKPLDQEQLDQLEEMLIEADLGPQIAARIADAFGK 70

Query: 73  KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132
            R+ K  +   V   ++EL+   L      F+     +P+V+L +GVNG GKTT +GK++
Sbjct: 71  ARFGKSSTEIEVKEALAELVAAELSDREGTFDPLSGPKPYVVLFIGVNGSGKTTTLGKIA 130

Query: 133 KKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
             ++ +   KV++AAGDTFR+AA++QLK+WADR  ADF+    G+DAAALAYEA ++A+ 
Sbjct: 131 SDLTHNKKAKVLIAAGDTFRAAAVEQLKVWADRAGADFMSRPPGADAAALAYEAVERAKL 190

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DV++IDTAGRL N   LM  + K+IRVLK++DP APH  L VLDAT G+NAL Q ++
Sbjct: 191 EGHDVVLIDTAGRLQNKQGLMDELLKVIRVLKKVDPDAPHETLLVLDATVGRNALAQEKI 250

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F    G +G++MTK+DGTARGG L+P+      P+  +GVGEG++DL+PF A+ FS  + 
Sbjct: 251 FGNQVGVSGIVMTKLDGTARGGVLVPVARASDSPIKLIGVGEGVDDLQPFDARAFSRSLV 310

Query: 312 GCLD 315
           G  D
Sbjct: 311 GLED 314


>gi|320539370|ref|ZP_08039039.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Serratia symbiotica str.
           Tucson]
 gi|320030495|gb|EFW12505.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Serratia symbiotica str.
           Tucson]
          Length = 440

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 186/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L      T   L  G   +   +R+DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 138 FFTRLKHSLLKTKQNLGSGFISLFRGKRIDDDLFDELEEQLLIADVGVETTRKIITTLTQ 197

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  +   + ++L  + +P N      P+VIL+VGVNGVGKTT IGKL
Sbjct: 198 HASRKQLKDAEALYGKLKAEMSEILTNVDRPLNVS-GKAPYVILMVGVNGVGKTTTIGKL 256

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 257 ARQFQAKGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVVAQHTGADSASVIFDAVQAAKA 316

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 317 RGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDTQAPHEVMLTLDASTGQNAVSQAKL 376

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 377 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFKADDF 431


>gi|260550345|ref|ZP_05824557.1| signal recognition particle GTPase [Acinetobacter sp. RUH2624]
 gi|260406657|gb|EEX00138.1| signal recognition particle GTPase [Acinetobacter sp. RUH2624]
          Length = 368

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 196/300 (65%), Gaps = 2/300 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++ +G + T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L 
Sbjct: 64  FFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLT 123

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 124 ERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGK 183

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A+
Sbjct: 184 LAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESAR 243

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK +DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+
Sbjct: 244 AKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQ 303

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            F    G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 304 EFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 363


>gi|253686507|ref|YP_003015697.1| signal recognition particle-docking protein FtsY [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251753085|gb|ACT11161.1| signal recognition particle-docking protein FtsY [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 495

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/297 (41%), Positives = 190/297 (63%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 193 FFARLKRSLVKTRQNLGSGFIGLFRGKKIDDDLFDELEEQLLVADVGVETTRKIITSLTE 252

Query: 72  --TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             ++R  KD     +   + + + ++L  +  P N +    P+VIL+VGVNGVGKTT IG
Sbjct: 253 HASRRQLKDADT--LFVKLKDEMAEILAKVDAPLNIE-GKTPYVILMVGVNGVGKTTTIG 309

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A
Sbjct: 310 KMARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVAVVAQHTGADSASVIFDAIQAA 369

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q 
Sbjct: 370 KARGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQA 429

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 430 KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDF 486


>gi|15603384|ref|NP_246458.1| hypothetical protein PM1519 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721906|gb|AAK03603.1| FtsY [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 459

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G       +++DD + EELE+ L+ +D+GV  A KI+  L  
Sbjct: 150 FFSRLVKGLLKTKQNLGAGFRSFFFGKKIDDALFEELEEQLLIADLGVPTATKIINNLTQ 209

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               + +    +LY   ++ + ++L P+++P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 210 HASHQQLKEADLLYQQLKVEMAEILKPVAQPLVIDQSKKPYVILMVGVNGVGKTTTIGKL 269

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++  + G  VMLAAGDTFR+AA++QL++W +R S   V    GSD+A++ ++A + A A
Sbjct: 270 ARQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVVAQSTGSDSASVIFDAMQSAAA 329

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 330 RHVDVLIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 389

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL PF A +F
Sbjct: 390 FHEAVGLTGITLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLRPFNADEF 444


>gi|120556651|ref|YP_961002.1| signal recognition particle-docking protein FtsY [Marinobacter
           aquaeolei VT8]
 gi|120326500|gb|ABM20815.1| signal recognition particle-docking protein FtsY [Marinobacter
           aquaeolei VT8]
          Length = 405

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 195/301 (64%), Gaps = 8/301 (2%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVE- 68
           +S   ++ +G   T   L  G+ D+ S  +++D+ + EE+E  L+ +D+GV    +I++ 
Sbjct: 101 VSVFERIKQGLGKTRASLTGGLADLFSVGKKIDEDLLEEIETTLLMADVGVTATSEIIDA 160

Query: 69  --ELLTKRYAKD-VSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
             E L +   KD  ++++ L D    +H +L  +++P   D   +P+VIL+VGVNGVGKT
Sbjct: 161 LTEKLERNQLKDGEALRKALRDE---LHGLLKEVARPLEIDAGKQPYVILMVGVNGVGKT 217

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+KK    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++A
Sbjct: 218 TTIGKLTKKFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIFDA 277

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + AQ++ VDV+I DTAGRL N   LM  + K++RV+K+LD  APH V+ VLDA TGQNA
Sbjct: 278 IQSAQSRGVDVVIADTAGRLQNKDNLMNELSKVVRVMKKLDESAPHEVMLVLDAGTGQNA 337

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q ++F    G +G+ +TK+DGTA+GG +  I    ++P+ ++GVGE   DL  F A+ 
Sbjct: 338 LSQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRYIGVGEQAEDLRSFDAET 397

Query: 306 F 306
           F
Sbjct: 398 F 398


>gi|262273591|ref|ZP_06051405.1| signal recognition particle receptor protein FtsY [Grimontia
           hollisae CIP 101886]
 gi|262222569|gb|EEY73880.1| signal recognition particle receptor protein FtsY [Grimontia
           hollisae CIP 101886]
          Length = 529

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 194/295 (65%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   T + L  G   + S +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 226 FFARLKRGLQKTKVNLGAGFFGLFSGKKIDDELFEELEEQLLIADVGMDTTTKIINSLTE 285

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           K   K++     LY +  + +  +L  + KP   D    P VIL+VGVNGVGKTT IGKL
Sbjct: 286 KASRKELKDGEALYGILKQEMADILSKVEKPLEIDRKDGPFVILMVGVNGVGKTTTIGKL 345

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ Y+A + A+A
Sbjct: 346 AKQFQQQGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVIYDAIEAAKA 405

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDV+I DTAGRL N + LM  + K++RV+K+LD +APH ++  +DA TGQNA+ Q  +
Sbjct: 406 RNVDVVIADTAGRLQNKANLMEELKKIVRVMKKLDENAPHEIMLTIDAGTGQNAISQARL 465

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+ +A  +G+ +TK+DGTA+GG +  +     IP+ ++GVGEGI+DL PFVA++F
Sbjct: 466 FNDIAPLSGITLTKLDGTAKGGVIFAVADQFNIPIRYIGVGEGIDDLRPFVAEEF 520


>gi|153002662|ref|YP_001368343.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS185]
 gi|151367280|gb|ABS10280.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS185]
          Length = 611

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 308 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 367

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + K L P++ P   D ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 368 RKQLKDAEALYDLLREEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQ 427

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+KV
Sbjct: 428 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKV 487

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP  PH V+  LDA+TGQNA+ Q ++F  
Sbjct: 488 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQE 547

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 548 AVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 599


>gi|304415087|ref|ZP_07395823.1| fused Signal Recognition Particle (SRP) receptor and membrane
           binding protein/conserved protein [Candidatus Regiella
           insecticola LSR1]
 gi|304283060|gb|EFL91487.1| fused Signal Recognition Particle (SRP) receptor and membrane
           binding protein/conserved protein [Candidatus Regiella
           insecticola LSR1]
          Length = 426

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 193/306 (63%), Gaps = 2/306 (0%)

Query: 2   SNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVA 61
           SN +      ++  +L K    T   +  G+ ++   +++DD   E+LE+ L+ +DIGV 
Sbjct: 113 SNVQKQPNKENFFTRLKKSLLKTKQNIGFGLLNLFRGKKIDDDFFEQLEEKLLIADIGVE 172

Query: 62  VAQKIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
              KI++ L      K +    VLY+ + E + ++L  + KP   +    P VIL+VGVN
Sbjct: 173 TTHKIIKSLTEHANRKQLKDAEVLYEKLKETMAEILAKVDKPLETN-GKNPCVILMVGVN 231

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           GVGKTT IGKL+ +    G  VMLAAGDTFR+AA++QL++W +R +   +    G+D+A+
Sbjct: 232 GVGKTTTIGKLAYQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQHTGADSAS 291

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           + ++AF+ A+A+ +DVL+ DTAGRL N + LM  + K++RV+K++D  APH ++  LDA+
Sbjct: 292 VIFDAFQAAKARNIDVLLADTAGRLQNKTDLMIELQKIVRVMKKIDEKAPHEIMLTLDAS 351

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNA+ Q ++FH   G TG+ +TK+DG+A+GG +  I     IP+ ++GVGE I DL  
Sbjct: 352 TGQNAVNQAKLFHEAVGLTGINLTKLDGSAKGGVIFAIADQFGIPIRYIGVGEAIEDLRL 411

Query: 301 FVAKDF 306
           F A DF
Sbjct: 412 FKADDF 417


>gi|163803406|ref|ZP_02197281.1| cell division protein FtsY [Vibrio sp. AND4]
 gi|159172810|gb|EDP57655.1| cell division protein FtsY [Vibrio sp. AND4]
          Length = 410

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 199/304 (65%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 98  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMETT 157

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 158 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILAKVEQPLEIDSSKTPYVILMVGVNGV 217

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+  + G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 218 GKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 277

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           ++A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 278 FDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 337

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI+DL PF 
Sbjct: 338 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIDDLRPFE 397

Query: 303 AKDF 306
            ++F
Sbjct: 398 TQEF 401


>gi|126641975|ref|YP_001084959.1| cell division protein [Acinetobacter baumannii ATCC 17978]
          Length = 301

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 194/296 (65%), Gaps = 2/296 (0%)

Query: 17  LTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           + +G + T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+  L  +  
Sbjct: 1   MKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTA 60

Query: 76  AKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
             D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT IGKL+K+
Sbjct: 61  RGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKR 120

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
           +   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF+ A+AK +
Sbjct: 121 LQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGI 180

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRLHN S LM  + K+ RV++++D  APH ++ V+DA TGQNA+ QV+ F  
Sbjct: 181 DVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQ 240

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
             G TG+ +TK+DGTA+GG L  I     +P+ F+GVGE I+DL PF AK F A +
Sbjct: 241 AVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAAL 296


>gi|304412286|ref|ZP_07393894.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS183]
 gi|307306070|ref|ZP_07585815.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica BA175]
 gi|304349321|gb|EFM13731.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS183]
 gi|306910943|gb|EFN41370.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica BA175]
          Length = 576

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 273 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 332

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + K L P++ P   D ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 333 RKQLKDAEALYDLLREEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQ 392

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+KV
Sbjct: 393 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKV 452

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP  PH V+  LDA+TGQNA+ Q ++F  
Sbjct: 453 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPETPHEVMLTLDASTGQNAISQAQLFQE 512

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 513 AVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 564


>gi|330898961|gb|EGH30380.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 494

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 186 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 245

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      HRP VILVVGVNG GKTT I
Sbjct: 246 LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKSEHRPFVILVVGVNGAGKTTTI 305

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 306 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 365

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 366 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 425

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 426 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 483


>gi|126172425|ref|YP_001048574.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS155]
 gi|125995630|gb|ABN59705.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS155]
          Length = 621

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 318 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 377

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + K L P++ P   D ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 378 RKQLKDAEALYDLLREEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQ 437

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+KV
Sbjct: 438 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKV 497

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP  PH V+  LDA+TGQNA+ Q ++F  
Sbjct: 498 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQE 557

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 558 AVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 609


>gi|268590802|ref|ZP_06125023.1| cell division protein [Providencia rettgeri DSM 1131]
 gi|291313582|gb|EFE54035.1| cell division protein [Providencia rettgeri DSM 1131]
          Length = 627

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 191/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI++ L  
Sbjct: 325 FFARLKKGLLKTRQNLGSGFFGLFSGKKIDDDLFEELEEQLLIADVGVDTTRKIIDNLTA 384

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L  + KP   +   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 385 HASRKELKDAEALYGKLREEMSDILAKVDKPLVIE-DKKPYVILMVGVNGVGKTTTIGKL 443

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D A++ ++A + AQA
Sbjct: 444 ARQYQSEGKSVMLAAGDTFRAAAVEQLQVWGERNKIPVVAQHTGADPASVIFDAIQSAQA 503

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N S LM  + K++RV+K+LD +APH ++  LDA+TGQNA+ Q ++
Sbjct: 504 KGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDENAPHEIMLTLDASTGQNAVSQAKL 563

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ +TK+DGTA+GG +  I     IP+ ++G+GEGI DL PF A DF
Sbjct: 564 FDDAVGLTGITLTKLDGTAKGGVIFSIADQFGIPIRYIGIGEGIEDLRPFKADDF 618


>gi|330957085|gb|EGH57345.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 506

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 191 QEPENAKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 250

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 251 TSVIIQSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNG 310

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 311 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 370

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 371 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 430

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 431 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 490

Query: 302 VAKDF 306
            A+ F
Sbjct: 491 EAEPF 495


>gi|160872800|ref|ZP_02062932.1| signal recognition particle-docking protein FtsY [Rickettsiella
           grylli]
 gi|159121599|gb|EDP46937.1| signal recognition particle-docking protein FtsY [Rickettsiella
           grylli]
          Length = 329

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 198/310 (63%), Gaps = 6/310 (1%)

Query: 3   NQKVASESLS----WIRKLTKGFASTSLKLKEGITDII-SSRRLDDGVREELEDLLIRSD 57
           N +  +ESL     ++ ++      T  +  E +  ++   +++D  + +E+ DLL+ +D
Sbjct: 2   NVREGNESLERKDHFLYRIKNSLLKTRHQFTENLAHLLFGKKKIDAELIDEIVDLLLMAD 61

Query: 58  IGVAVAQKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILV 116
           +G  V + I++ L  K     ++  +V++DV  + + ++L P   P   D +H+P VILV
Sbjct: 62  VGSTVTEAIIQRLTVKLERNHLTDGQVIWDVLKQQLGELLQPCEAPLMIDSTHKPMVILV 121

Query: 117 VGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGS 176
           VGVNGVGKTT IGKL+  +   G KVMLAAGDTFR+AA +QL IWA+R     +    G+
Sbjct: 122 VGVNGVGKTTSIGKLAYYLKKQGKKVMLAAGDTFRAAATEQLTIWAERNQIPIIAQHQGA 181

Query: 177 DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV 236
           D+A++ Y+AF+ A+A+ +DVLI DTAGR H  + LM  + K+ +V+ +LD  APH ++ +
Sbjct: 182 DSASVIYDAFQAAKARNIDVLIADTAGRFHTKNNLMQELQKIKKVMGKLDVSAPHEIMLI 241

Query: 237 LDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGIN 296
           LDA TGQNAL Q ++FH   G TGL++TK+DGTA+GG +  I     +P+ F+G+GE ++
Sbjct: 242 LDANTGQNALMQAQVFHEALGLTGLMLTKLDGTAKGGVIFAIAEKLGLPIRFVGLGEAMS 301

Query: 297 DLEPFVAKDF 306
           D+  F AK+F
Sbjct: 302 DIHVFSAKEF 311


>gi|254784500|ref|YP_003071928.1| signal recognition particle-docking protein FtsY [Teredinibacter
           turnerae T7901]
 gi|242667494|gb|ACS93531.1| signal recognition particle-docking protein FtsY [Teredinibacter
           turnerae T7901]
          Length = 334

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 202/301 (67%), Gaps = 2/301 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           +E +S+  ++ +G + TS +L  G+  ++  ++ +DD + EE+E LL+ +D+GV     I
Sbjct: 26  TEKVSFFTRIKQGLSRTSNQLSGGLASLLLGKKAIDDELLEEIETLLLMADVGVEATTDI 85

Query: 67  VEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           +++L  +   K ++    LY  + + +  +L+ +  P + + + +P VILVVGVNGVGKT
Sbjct: 86  IDDLTARVARKQLADSDALYAALRQSLADLLLDVEAPLDVECAQKPFVILVVGVNGVGKT 145

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+K+  + G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A
Sbjct: 146 TTIGKLAKRFQNQGKSVMLAAGDTFRAAAVEQLQVWGERNKVPVVAQHTGADSASVIYDA 205

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + AQA+++DV+I DTAGRLHN S LM  + K+ RV+ +LD  APH VL VLDA TGQNA
Sbjct: 206 VQSAQARQIDVVIADTAGRLHNKSNLMEELAKVKRVMAKLDDSAPHEVLLVLDAGTGQNA 265

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q   F   AG TGL +TK+DGTA+GG +  +   + +PV ++GVGEGI+DL+PF A  
Sbjct: 266 LSQAGHFKEAAGVTGLALTKLDGTAKGGIIFALSKQYGLPVRYIGVGEGIDDLQPFQATS 325

Query: 306 F 306
           F
Sbjct: 326 F 326


>gi|229587138|ref|YP_002845639.1| Signal recognition particle-docking protein FtsY [Rickettsia
           africae ESF-5]
 gi|228022188|gb|ACP53896.1| Signal recognition particle-docking protein FtsY [Rickettsia
           africae ESF-5]
          Length = 303

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/303 (42%), Positives = 192/303 (63%), Gaps = 3/303 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +S   KL +  + TS K+ EGI  I   ++LD G  E LE+LLI SD+ V V   I+EE 
Sbjct: 2   ISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAGTLEALEELLISSDMSVLVVTNIIEEF 61

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              ++ K++    V   +++LI + L   + PF     ++ +VILV GVNG GKTT IGK
Sbjct: 62  KKVKFDKEIDSDTVKEALAKLIEQQLSKSAIPFTLS-ENKLNVILVCGVNGAGKTTTIGK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+   S  G KV +AA DTFR+AA++QL  WADR +A  +  E  +D A++AY   +++ 
Sbjct: 121 LAAMYSAQGKKVAVAACDTFRAAAVNQLSTWADRANALLITGEESADPASVAYRGMEESI 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP-HSVLQVLDATTGQNALRQV 249
            + +++L IDTAGRLHN   LM  + K+++V+K+LD +AP HS+L V+DA TGQN   QV
Sbjct: 181 KQNINILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSIL-VIDAITGQNTYNQV 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F+     TGLI+TK+DG+A+ G ++ +V    +P+YF+G+GE I DL+ F   DF+  
Sbjct: 240 EHFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGIGEKIEDLKIFNQHDFARN 299

Query: 310 ITG 312
           + G
Sbjct: 300 LVG 302


>gi|304311581|ref|YP_003811179.1| Cell division protein, SRP docking protein [gamma proteobacterium
           HdN1]
 gi|301797314|emb|CBL45534.1| Cell division protein, SRP docking protein [gamma proteobacterium
           HdN1]
          Length = 416

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/305 (43%), Positives = 190/305 (62%), Gaps = 16/305 (5%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           S+  ++ +G + T     E +  +++ ++ +D  + EE+E  L+ +D+GV+  Q+IV  L
Sbjct: 110 SFFSRVKRGLSRTRSGFTEAMASLLAGKKAIDADLLEEIETQLLMADVGVSATQRIVTAL 169

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFN-----WDFSH----RPHVILVVGVNG 121
             K     VS +R L D   L H +   L+   +     W        +P VIL+VGVNG
Sbjct: 170 TQK-----VS-RRELVDSDALYHALQQELAALLSGHAEPWQLGKTAEGKPRVILMVGVNG 223

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
           VGKTT IGKL+K++   G +VMLAAGDTFR+AA++QL++W  R     V    G+D+A++
Sbjct: 224 VGKTTTIGKLAKRLQIEGKQVMLAAGDTFRAAAVEQLQVWGQRNEIAVVAQHTGADSASV 283

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A AKKVDVLI DTAGRLH  S LM  + K+ RV+++LDP APH VL VLDA T
Sbjct: 284 IFDALQSATAKKVDVLIADTAGRLHTKSNLMEELKKVKRVMQKLDPQAPHEVLLVLDAGT 343

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNAL Q   F+   G TG+++TK+DGTA+GG +  I     IP+  +GVGE I+DL PF
Sbjct: 344 GQNALSQATQFNEAVGVTGIVLTKLDGTAKGGIVFAIAEKTGIPIRLIGVGETIDDLRPF 403

Query: 302 VAKDF 306
             + F
Sbjct: 404 EPQQF 408


>gi|217975238|ref|YP_002359989.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS223]
 gi|217500373|gb|ACK48566.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS223]
          Length = 615

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 312 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 371

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + K L P++ P   D ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 372 RKQLKDAEALYDLLREEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQ 431

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+KV
Sbjct: 432 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKV 491

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP  PH V+  LDA+TGQNA+ Q ++F  
Sbjct: 492 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQE 551

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 552 AVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 603


>gi|254508809|ref|ZP_05120920.1| cell division protein FtsY [Vibrio parahaemolyticus 16]
 gi|219548266|gb|EED25280.1| cell division protein FtsY [Vibrio parahaemolyticus 16]
          Length = 412

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 196/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  A T   +  G   +   +++DD + EELE+ L+ +D+G+    KI++ L 
Sbjct: 108 SFFARLKRSLARTKANIGAGFFGLFKGKQIDDDLFEELEEQLLIADVGMDTTTKIIDSLT 167

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +++     LY +  E + ++L  + KP   D S  P+VIL+VGVNGVGKTT IGK
Sbjct: 168 EKASRQELKDGEALYGLLKEEMAEILSTVEKPLEVDTSKTPYVILMVGVNGVGKTTTIGK 227

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ Y+A + A+
Sbjct: 228 LAKQFQAEGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIYDAIESAK 287

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDV+I DTAGRL N S LM  + K++RV++++D  APH ++  LDA TGQNA+ Q +
Sbjct: 288 AKGVDVVIADTAGRLQNKSNLMEELRKIVRVMQKVDGSAPHEIMLTLDAGTGQNAISQAK 347

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PF  ++F
Sbjct: 348 LFSDVAPLTGITLTKLDGTAKGGVIFALADQFQIPIRYIGVGEGIDDLRPFETQEF 403


>gi|94499827|ref|ZP_01306363.1| signal recognition particle-docking protein FtsY [Oceanobacter sp.
           RED65]
 gi|94428028|gb|EAT13002.1| signal recognition particle-docking protein FtsY [Oceanobacter sp.
           RED65]
          Length = 359

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 190/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDII-SSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  ++  G + T   L EG+ D++   + +D+ + E++E  L+ +DIG+   Q I+++L 
Sbjct: 55  FFARIKAGLSRTRSGLSEGLGDLLLGKKEIDEDLLEDIETQLLMADIGINATQAIIDDLT 114

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   K++     L + + + +  +L P   P     S +P VIL+VGVNGVGKTT IGK
Sbjct: 115 ERSSRKELKDSEALLEALKQHLKDILEPCHAPLEIPQSDKPFVILMVGVNGVGKTTTIGK 174

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           ++K+    G  VMLAAGDTFR+AA++QL+ W +R     V    G+D+A++ Y+A + AQ
Sbjct: 175 MAKRFQSQGKSVMLAAGDTFRAAAVEQLQTWGERNKVPVVAQHTGADSASVIYDAVQSAQ 234

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           +K VDV+I DTAGRL N + LM  + K++RV+++LD  APH V+ VLDA TGQNAL Q +
Sbjct: 235 SKGVDVVIADTAGRLQNKANLMQELEKVVRVMRKLDDTAPHEVMLVLDAGTGQNALSQAK 294

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G + L ++K+DGTA+GG +  I    ++PV F+GVGE I+DL PF  ++F
Sbjct: 295 IFQEAVGVSSLTLSKLDGTAKGGVIFAIAKELQLPVRFIGVGEQIDDLRPFNHEEF 350


>gi|297180323|gb|ADI16541.1| hypothetical protein [uncultured bacterium HF4000_009C18]
          Length = 304

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 182/281 (64%), Gaps = 1/281 (0%)

Query: 31  GITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL-TKRYAKDVSVQRVLYDVS 89
           G+ D+I  +++D+ +  ELED LI+SD+GV  A+++ E+   TK   K V    +    S
Sbjct: 21  GLNDLIFKKKIDENMLNELEDFLIQSDVGVESAKELREKFANTKVNPKTVEKDEIFKIFS 80

Query: 90  ELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT 149
             +H++L PL K       ++P VIL+ GVNGVGKTT IGKL K +     K++L A DT
Sbjct: 81  NYVHEILKPLEKNLENINKNKPCVILIAGVNGVGKTTTIGKLGKILGQNNKKIVLGAADT 140

Query: 150 FRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNS 209
           FR+AA+ QL++WA R +AD + S+ G+D A++AY+A   A+    D L+IDTAGRL N  
Sbjct: 141 FRAAAVSQLEVWAKRINADIIKSDEGADPASVAYKALDHAKKNNFDYLLIDTAGRLQNKK 200

Query: 210 ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGT 269
            LM    K+ +VLK++D +APH    +LDATTGQNA+ QVE F  ++  TG+IMTK+DGT
Sbjct: 201 NLMDEFKKITKVLKKIDSNAPHETFLILDATTGQNAISQVEEFKKISPITGIIMTKLDGT 260

Query: 270 ARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
           A+GG L+ I    K+P+  L +GE  +DL+ F ++ FS  +
Sbjct: 261 AKGGILLAIGKKFKLPIIALCMGEKEDDLQTFNSEYFSNAL 301


>gi|320326373|gb|EFW82426.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. glycinea str. B076]
          Length = 498

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 192/305 (62%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 183 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 242

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I+  L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 243 TSVIINSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKVEHKPFVILVVGVNG 302

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 303 AGKTTTIGKLAKKLQLGGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 362

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 363 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 422

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 423 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 482

Query: 302 VAKDF 306
            A+ F
Sbjct: 483 EAEPF 487


>gi|160877397|ref|YP_001556713.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS195]
 gi|160862919|gb|ABX51453.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS195]
 gi|315269601|gb|ADT96454.1| signal recognition particle-docking protein FtsY [Shewanella
           baltica OS678]
          Length = 540

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 237 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 296

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + K L P++ P   D ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 297 RKQLKDAEALYDLLREEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQ 356

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+KV
Sbjct: 357 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKV 416

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP  PH V+  LDA+TGQNA+ Q ++F  
Sbjct: 417 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQE 476

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 477 AVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 528


>gi|328472443|gb|EGF43309.1| signal recognition particle-docking protein FtsY [Vibrio
           parahaemolyticus 10329]
          Length = 403

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 197/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 91  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTT 150

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P + D S  P+VIL+VGVNGV
Sbjct: 151 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILSKVEQPLDIDSSKTPYVILMVGVNGV 210

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 211 GKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 270

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 271 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 330

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 331 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFE 390

Query: 303 AKDF 306
            ++F
Sbjct: 391 TQEF 394


>gi|300721685|ref|YP_003710961.1| cell division protein [Xenorhabdus nematophila ATCC 19061]
 gi|297628178|emb|CBJ88733.1| cell division protein: membrane binding (N-terminal); GTPase domain
           (C-terminal) [Xenorhabdus nematophila ATCC 19061]
          Length = 465

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 192/307 (62%), Gaps = 2/307 (0%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           +S ++       +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV
Sbjct: 151 LSKEQERPSKEGFFTRLKRSLVKTRQNLGSGFLSLFRGKKIDDELFEELEEQLLIADVGV 210

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
               KI+  L      K++     LY  + E +  +L+ + KP   +    P+VIL+VGV
Sbjct: 211 ETTSKIITSLTAHASRKELKDAEALYSKLKEEMSDILVKVDKPLEIE-GKSPYVILMVGV 269

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NGVGKTT IGKL+++    G  VMLAAGDTFR+AA++QL++W DR     V    G+D A
Sbjct: 270 NGVGKTTTIGKLARQYQSQGKSVMLAAGDTFRAAAVEQLQVWGDRNKIPVVAQHTGADPA 329

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           ++ ++A + A+AK VD+LI DTAGRL N S LM  + K++RV+K+LD  APH ++  LDA
Sbjct: 330 SVIFDAIQSAKAKGVDILIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEIMLTLDA 389

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
           +TGQNA+ Q ++FH   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL 
Sbjct: 390 STGQNAVSQAKLFHEAVGLTGISLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLR 449

Query: 300 PFVAKDF 306
           PF A DF
Sbjct: 450 PFKADDF 456


>gi|221133909|ref|ZP_03560214.1| signal recognition particle GTPase [Glaciecola sp. HTCC2999]
          Length = 367

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 187/299 (62%), Gaps = 6/299 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +   L    + T   +  GI D+   R +DD + E+LE  L+ +D+G+   Q I+E L  
Sbjct: 61  FFSSLAAKLSRTKESIGSGIADLFVGRSIDDELYEDLETQLLVADVGMDTTQNIIEHLTQ 120

Query: 72  -TKRYA---KDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            TKR      +  +  +   + EL+  +  PL  P   +    P VIL+VGVNGVGKTT 
Sbjct: 121 STKRSTLKNGEALLGELKAYMGELLTNIEAPLI-PVVPEGKKGPFVILMVGVNGVGKTTT 179

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGK++K+    G KVMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A +
Sbjct: 180 IGKMAKQFQQDGKKVMLAAGDTFRAAAVEQLQVWGERNDIPVVAQHTGADSASVLYDAIQ 239

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            AQAK +DVLI DTAGRL N   LM  + K++RV+++++P APH ++  +DA TGQNA+ 
Sbjct: 240 SAQAKNIDVLIADTAGRLQNKDYLMQELEKVVRVIRKINPDAPHEIMLTIDAGTGQNAIS 299

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++FH   G TG+ ++K+DGTA+GG +  I     IPV ++GVGE I+DL PF A +F
Sbjct: 300 QAKLFHDAVGLTGITLSKLDGTAKGGVIFSIADQFSIPVRYIGVGEAIDDLRPFQATEF 358


>gi|330965439|gb|EGH65699.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 514

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 206 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 265

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG GKTT I
Sbjct: 266 LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNGAGKTTTI 325

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 326 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 385

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 386 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 445

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 446 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 503


>gi|71736424|ref|YP_276881.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|71556977|gb|AAZ36188.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 500

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 192/305 (62%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 185 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 244

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I+  L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 245 TSVIINSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKVEHKPFVILVVGVNG 304

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 305 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 364

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 365 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 424

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 425 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 484

Query: 302 VAKDF 306
            A+ F
Sbjct: 485 EAEPF 489


>gi|319428376|gb|ADV56450.1| signal recognition particle-docking protein FtsY [Shewanella
           putrefaciens 200]
          Length = 480

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    +++ +L     
Sbjct: 177 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLINKLTEHAS 236

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  + + K L P++ P   + ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 237 RKQLKDAEALYDLLRDELQKTLDPVAIPLVPNNANGPFVILMVGVNGVGKTTTIGKLAKQ 296

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A + A+A+KV
Sbjct: 297 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVVAQHTGADSASVLFDALQAAKARKV 356

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP APH V+  LDA+TGQNA+ Q ++F  
Sbjct: 357 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQE 416

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TGL ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 417 AVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 468


>gi|146291397|ref|YP_001181821.1| signal recognition particle-docking protein FtsY [Shewanella
           putrefaciens CN-32]
 gi|145563087|gb|ABP74022.1| signal recognition particle-docking protein FtsY [Shewanella
           putrefaciens CN-32]
          Length = 482

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    +++ +L     
Sbjct: 179 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLINKLTEHAS 238

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  + + K L P++ P   + ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 239 RKQLKDAEALYDLLRDELQKTLDPVAIPLVPNNANGPFVILMVGVNGVGKTTTIGKLAKQ 298

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A + A+A+KV
Sbjct: 299 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVVAQHTGADSASVLFDALQAAKARKV 358

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP APH V+  LDA+TGQNA+ Q ++F  
Sbjct: 359 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQE 418

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TGL ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 419 AVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 470


>gi|289648495|ref|ZP_06479838.1| cell division transporter substrate-binding protein FtsY
           [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 494

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 179 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 238

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 239 TSVIIKSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNG 298

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 299 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 358

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 359 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 418

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 419 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 478

Query: 302 VAKDF 306
            A+ F
Sbjct: 479 EAEPF 483


>gi|127514534|ref|YP_001095731.1| signal recognition particle-docking protein FtsY [Shewanella
           loihica PV-4]
 gi|126639829|gb|ABO25472.1| signal recognition particle-docking protein FtsY [Shewanella
           loihica PV-4]
          Length = 561

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    +++  L  
Sbjct: 255 FFARLKRGLKRTSENIGSGFIGLFKGKKIDDELFEELEEQLLIADVGVETTSRLIASLTE 314

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  E + K L P+S P   + S  P VIL+VGVNGVGKTT IGKL
Sbjct: 315 QASRKQLKDGEALYELMREEMQKTLEPVSIPLVPENSEGPFVILMVGVNGVGKTTTIGKL 374

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A
Sbjct: 375 AKQYQQQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVIAQHTGADSASVLFDALQAARA 434

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +K+D+LI DTAGRL N + LM  + K++RV+K+ D  APH V+  LDA+TGQNA+ Q ++
Sbjct: 435 RKIDILIADTAGRLQNKAHLMDELKKVVRVMKKQDESAPHEVMLTLDASTGQNAISQAQL 494

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ M+K+DGTA+GG +  I     IP+  +GVGE I+DL PF AKDF
Sbjct: 495 FKEAVGVTGITMSKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRPFDAKDF 549


>gi|289624656|ref|ZP_06457610.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|298485261|ref|ZP_07003354.1| signal recognition particle docking protein [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298160249|gb|EFI01277.1| signal recognition particle docking protein [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|330871132|gb|EGH05841.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 496

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 181 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 240

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 241 TSVIIKSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNG 300

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 301 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 360

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 361 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 420

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 421 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 480

Query: 302 VAKDF 306
            A+ F
Sbjct: 481 EAEPF 485


>gi|323492926|ref|ZP_08098066.1| signal recognition particle-docking protein FtsY [Vibrio
           brasiliensis LMG 20546]
 gi|323312819|gb|EGA65943.1| signal recognition particle-docking protein FtsY [Vibrio
           brasiliensis LMG 20546]
          Length = 404

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 196/296 (66%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  A T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+E L 
Sbjct: 100 SFFARLKRSLARTKANIGAGFFGLFKGKQIDDDLFEELEEQLLIADVGMDTTLKIIENLT 159

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +++     LY +  E + ++L  + KP   D S  P+VIL+VGVNGVGKTT IGK
Sbjct: 160 EKASRQELKDGEALYGLLKEEMAEILSNVEKPLEVDSSKAPYVILMVGVNGVGKTTTIGK 219

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ Y+A + A+
Sbjct: 220 LAKQFQAEGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIYDAIESAK 279

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDV+I DTAGRL N + LM  + K++RV++++D  APH ++  LDA TGQNA+ Q +
Sbjct: 280 AKGVDVVIADTAGRLQNKANLMEELRKIVRVMQKVDGSAPHEIMLTLDAGTGQNAISQAK 339

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PF  ++F
Sbjct: 340 LFSDVAPLTGITLTKLDGTAKGGVIFALADQFQIPIRYIGVGEGIDDLRPFETQEF 395


>gi|257482993|ref|ZP_05637034.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|331011768|gb|EGH91824.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 496

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 181 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 240

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 241 TSVIIKSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNG 300

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 301 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 360

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 361 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 420

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 421 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 480

Query: 302 VAKDF 306
            A+ F
Sbjct: 481 EAEPF 485


>gi|260899650|ref|ZP_05908045.1| cell division protein FtsY [Vibrio parahaemolyticus AQ4037]
 gi|308106736|gb|EFO44276.1| cell division protein FtsY [Vibrio parahaemolyticus AQ4037]
          Length = 411

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 99  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTT 158

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 159 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDSSKTPYVILMVGVNGV 218

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 219 GKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 278

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 279 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 338

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 339 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFE 398

Query: 303 AKDF 306
            ++F
Sbjct: 399 TQEF 402


>gi|260361295|ref|ZP_05774400.1| cell division protein FtsY [Vibrio parahaemolyticus K5030]
 gi|308111830|gb|EFO49370.1| cell division protein FtsY [Vibrio parahaemolyticus K5030]
          Length = 407

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 95  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTT 154

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 155 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDSSKTPYVILMVGVNGV 214

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 215 GKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 274

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 275 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 334

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 335 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFE 394

Query: 303 AKDF 306
            ++F
Sbjct: 395 TQEF 398


>gi|149909415|ref|ZP_01898070.1| signal recognition particle-docking protein FtsY [Moritella sp.
           PE36]
 gi|149807525|gb|EDM67474.1| signal recognition particle-docking protein FtsY [Moritella sp.
           PE36]
          Length = 451

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 192/295 (65%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G + T   +  G       + +DD + EELE+ L+ +D+GVA  ++I++ L  
Sbjct: 146 FFTRLKRGLSRTKGNIGSGFKSFFRGKHIDDDLFEELEEQLLIADLGVATTKRIIDNLTQ 205

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LYD+  + +  ML  + +P   D +++PHVIL+VGVNGVGKTT IGK+
Sbjct: 206 QASRKQLKDAEALYDILKKDMADMLHKVEQPLVIDSNNKPHVILMVGVNGVGKTTTIGKM 265

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +KK    G  VMLAAGDTFR+AA++QL++W DR     V    G+D+A++ ++A + A A
Sbjct: 266 AKKFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNGIPVVAQHTGADSASVLFDAMQSATA 325

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVLI DTAGRL N + LM  + K++RV+++ D  APH ++  +DA TGQNAL Q ++
Sbjct: 326 KDVDVLIADTAGRLQNKAHLMDELKKVVRVMRKHDATAPHEIMLTIDAGTGQNALSQAQL 385

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ +TK+DGTA+GG +  +    +IP+ F+G+GEGI+DL  F +++F
Sbjct: 386 FKEAVGLTGITITKLDGTAKGGVIFAVADKFEIPIRFIGIGEGIDDLRTFNSEEF 440


>gi|153840071|ref|ZP_01992738.1| cell division protein FtsY [Vibrio parahaemolyticus AQ3810]
 gi|149746343|gb|EDM57398.1| cell division protein FtsY [Vibrio parahaemolyticus AQ3810]
          Length = 403

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 91  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTT 150

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 151 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDSSKTPYVILMVGVNGV 210

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 211 GKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 270

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 271 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 330

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 331 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFE 390

Query: 303 AKDF 306
            ++F
Sbjct: 391 TQEF 394


>gi|28899730|ref|NP_799335.1| cell division protein FtsY [Vibrio parahaemolyticus RIMD 2210633]
 gi|260879107|ref|ZP_05891462.1| cell division protein FtsY [Vibrio parahaemolyticus AN-5034]
 gi|260897983|ref|ZP_05906479.1| cell division protein FtsY [Vibrio parahaemolyticus Peru-466]
 gi|28807982|dbj|BAC61219.1| cell division protein FtsY [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087163|gb|EFO36858.1| cell division protein FtsY [Vibrio parahaemolyticus Peru-466]
 gi|308089649|gb|EFO39344.1| cell division protein FtsY [Vibrio parahaemolyticus AN-5034]
          Length = 405

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++DD + EELE+ L+ +D+G+   
Sbjct: 93  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTT 152

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D S  P+VIL+VGVNGV
Sbjct: 153 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDSSKTPYVILMVGVNGV 212

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 213 GKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 272

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 273 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 332

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 333 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFE 392

Query: 303 AKDF 306
            ++F
Sbjct: 393 TQEF 396


>gi|66047975|ref|YP_237816.1| cell division transporter substrate-binding protein FtsY
           [Pseudomonas syringae pv. syringae B728a]
 gi|63258682|gb|AAY39778.1| Cell division transporter substrate-binding protein FtsY
           [Pseudomonas syringae pv. syringae B728a]
          Length = 505

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 197 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 256

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG GKTT I
Sbjct: 257 LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNGAGKTTTI 316

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 317 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 376

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 377 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 436

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 437 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 494


>gi|28867657|ref|NP_790276.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|28850892|gb|AAO53971.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|331014970|gb|EGH95026.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 513

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 205 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 264

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG GKTT I
Sbjct: 265 LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNGAGKTTTI 324

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 325 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 384

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 385 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 444

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 445 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 502


>gi|302187229|ref|ZP_07263902.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. syringae 642]
          Length = 502

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 194 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 253

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG GKTT I
Sbjct: 254 LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKSEHKPFVILVVGVNGAGKTTTI 313

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 314 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 373

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 374 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 433

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 434 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 491


>gi|113972101|ref|YP_735894.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           MR-4]
 gi|113886785|gb|ABI40837.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           MR-4]
          Length = 582

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 195/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L 
Sbjct: 275 SFFARLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTSRLIQSLT 334

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
                K +     LYD+  + + K L P++ P   + ++ P+VIL+VGVNGVGKTT IGK
Sbjct: 335 EHASRKQLKDAEALYDLLRDEMQKTLDPVAIPLVPENANGPYVILMVGVNGVGKTTTIGK 394

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A+
Sbjct: 395 LAKQYQRQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVLFDALQAAK 454

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+K+D+LI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q +
Sbjct: 455 ARKIDILIADTAGRLQNKSHLMEELKKVVRVMKKLDLEAPHEVMLTLDASTGQNAISQAQ 514

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G TG+ ++K+DGTA+GG +  I    KIP+ ++GVGE I+DL  F +K+F
Sbjct: 515 LFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEF 570


>gi|320331637|gb|EFW87575.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330872359|gb|EGH06508.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 500

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 192/305 (62%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 185 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 244

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I+  L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 245 TSVIINSLTRKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKVEHKPFVILVVGVNG 304

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 305 AGKTTTIGKLAKKLQLGGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 364

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 365 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 424

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 425 GQNAINQAKQFNQTVMLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 484

Query: 302 VAKDF 306
            A+ F
Sbjct: 485 EAEPF 489


>gi|90581426|ref|ZP_01237221.1| putative cell division protein FtsY [Vibrio angustum S14]
 gi|90437403|gb|EAS62599.1| putative cell division protein FtsY [Vibrio angustum S14]
          Length = 459

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 194/298 (65%), Gaps = 1/298 (0%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           S  +  +L +G   T      G   + S +++DD + EELE+ L+ +D+G+    KI+E 
Sbjct: 153 SEGFFARLMRGLKKTKTNFGAGFFGLFSGKKIDDELFEELEEQLLIADVGMDTTLKIIEN 212

Query: 70  LLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K++     LY +  + +  ML  + +P   D S +P+VIL+VGVNGVGKTT I
Sbjct: 213 LTDKASKKELKDGEALYGLLKDELADMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTTI 272

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+K+    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++A + 
Sbjct: 273 GKLAKQCQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIFDAIES 332

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+AK VDV+I DTAGRL N   LM  + K++RV+K++D  APH ++  +DA TGQNA+ Q
Sbjct: 333 AKAKNVDVVIADTAGRLQNKGNLMEELRKIVRVMKKVDVDAPHEIMLTVDAGTGQNAISQ 392

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            ++F  VA  +G+ +TK+DGTA+GG +  +     IP+ ++GVGEGI+DL PF A++F
Sbjct: 393 AKLFSDVAPVSGITITKLDGTAKGGVIFAVADQFNIPIRYIGVGEGIDDLRPFAAEEF 450


>gi|262372507|ref|ZP_06065786.1| signal recognition particle-docking protein FtsY [Acinetobacter
           junii SH205]
 gi|262312532|gb|EEY93617.1| signal recognition particle-docking protein FtsY [Acinetobacter
           junii SH205]
          Length = 379

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 197/305 (64%), Gaps = 2/305 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
           ++S  +  ++  G   T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I
Sbjct: 70  TKSTGFFGRMKDGLIKTRRSFTDGMVNILIGGKEIDDELLEEVEEQLLIADIGVEATKTI 129

Query: 67  VEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           +  L  +    D+     LY V  E +  +L P  KP + D +  P+VIL+VGVNGVGKT
Sbjct: 130 IANLTERTARGDLIYSHALYKVLQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKT 189

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++A
Sbjct: 190 TTIGKLAKRLQAEGKKVMLAAGDTFRAAATEQLQIWGERNDIPVVAQGHGADSASVIFDA 249

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
           F+ A+AK +DVLI DTAGRL N S LM  + K+ RV++++D  APH ++ ++DA TGQNA
Sbjct: 250 FESARAKGIDVLIADTAGRLQNKSNLMEELKKVKRVMQKIDATAPHEIMLIVDAGTGQNA 309

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           + QV++F    G TG+ +TK+DGTA+GG L  I     +P+ ++G+GE I+DL PF AK 
Sbjct: 310 INQVQLFDEAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRYIGIGEKIDDLRPFSAKS 369

Query: 306 FSAVI 310
           F A +
Sbjct: 370 FVAAL 374


>gi|330970953|gb|EGH71019.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 499

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 191 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 250

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG GKTT I
Sbjct: 251 LTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNGAGKTTTI 310

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 311 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 370

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 371 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 430

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 431 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 488


>gi|120600697|ref|YP_965271.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           W3-18-1]
 gi|120560790|gb|ABM26717.1| signal recognition particle-docking protein FtsY [Shewanella sp.
           W3-18-1]
          Length = 480

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    +++ +L     
Sbjct: 177 RLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLINKLTEHAS 236

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  + + K L P++ P   + ++ P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 237 RKQLKDAEALYDLLRDELQKTLDPVAIPLVPNNANGPFVILMVGVNGVGKTTTIGKLAKQ 296

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A + A+A+KV
Sbjct: 297 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVVAQHTGADSASVLFDALQAAKARKV 356

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+LDP APH V+  LDA+TGQNA+ Q ++F  
Sbjct: 357 DVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAKLFQE 416

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TGL ++K+DGTA+GG +  I     IP+ ++GVGE I+DL  F +K+F
Sbjct: 417 AVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEF 468


>gi|330874697|gb|EGH08846.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 516

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 190/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 208 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 267

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  +L P+ +P      H+P VILVVGVNG GKTT I
Sbjct: 268 LTQKVARKQLTDAQALYTSLQAELAALLKPVEQPLVIKAEHKPFVILVVGVNGAGKTTTI 327

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 328 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 387

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 388 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 447

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 448 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 505


>gi|223041714|ref|ZP_03611908.1| cell division protein FtsY-like protein [Actinobacillus minor 202]
 gi|223017458|gb|EEF15875.1| cell division protein FtsY-like protein [Actinobacillus minor 202]
          Length = 517

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 193/298 (64%), Gaps = 7/298 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL-- 70
           +  +L +G   T   +  G  +    +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 211 FFSRLIQGLIKTKQSIGSGFFNFFRGKKIDDELFEELEEQLLIADLGMPTTTKIINNLSQ 270

Query: 71  -LTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
             TK+  KD      LY +  E +  +L P+++P   D S +P+VIL+VGVNGVGKTT I
Sbjct: 271 HATKQQLKDADA---LYQLLKEELADVLKPVARPLEIDTSKKPYVILMVGVNGVGKTTTI 327

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+++  + G  VMLAAGDTFR+AA++QL++W +R +   +    GSD+A++ ++A + 
Sbjct: 328 GKLARQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQTSGSDSASVIFDAMQS 387

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A AK +DVLI DTAGRL N + LM  + K++RV+++ D  APH ++  LDA TGQNA+ Q
Sbjct: 388 ASAKNIDVLIADTAGRLQNKNNLMDELKKIVRVMQKYDETAPHEIMLTLDAGTGQNAISQ 447

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            ++F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 448 AKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 505


>gi|323144388|ref|ZP_08078996.1| signal recognition particle-docking protein FtsY [Succinatimonas
           hippei YIT 12066]
 gi|322415841|gb|EFY06567.1| signal recognition particle-docking protein FtsY [Succinatimonas
           hippei YIT 12066]
          Length = 507

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 189/306 (61%), Gaps = 18/306 (5%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           SE LS+  +L +   + S+    G++  +  R++D+ + EELE  L+ +D+GV     ++
Sbjct: 204 SEKLSFFERLKRTRENISM----GLSSFMKGRKIDEDLYEELETALLTADLGVETTNFVI 259

Query: 68  EELLTKRYAKDVSVQRVLYD-------VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN 120
           E+L      ++ S  R L+D       + +++  +L P   P       +P VIL+VGVN
Sbjct: 260 EKL------REESKLRELHDAVLLKKNLKDILKNILKPCEIPLEV-TGKKPFVILMVGVN 312

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           G GKTT IGKL++K  D GLKVMLAAGDTFR+AA++QLK W +R +   +    GSD+A+
Sbjct: 313 GAGKTTTIGKLARKYQDLGLKVMLAAGDTFRAAAVEQLKEWGNRANVPVIAQATGSDSAS 372

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           + ++A   A+A+  DVLI DTAGRL N   LM  + K++RV+K++D   PH VL VLDAT
Sbjct: 373 VLFDAVNAAKARNTDVLICDTAGRLQNKDNLMEELKKIVRVMKKIDEEVPHEVLLVLDAT 432

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNA+ Q  +F      TG+ +TK+DGTA+GG +  +    K+P+ ++G+GE   DL P
Sbjct: 433 TGQNAVSQATLFGKAVPITGICLTKLDGTAKGGVIFTLADKFKLPIRYVGIGEKAEDLRP 492

Query: 301 FVAKDF 306
           F A  F
Sbjct: 493 FKADIF 498


>gi|33152121|ref|NP_873474.1| cell division protein FtsY [Haemophilus ducreyi 35000HP]
 gi|33148343|gb|AAP95863.1| cell division protein FtsY [Haemophilus ducreyi 35000HP]
          Length = 519

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 194/307 (63%), Gaps = 4/307 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +          +++DD + EELE+ L+ +D+G+    KI++ L T
Sbjct: 216 FFSRLLKGLIKTKQNIGSNFRQFFRGKKIDDELFEELEERLLMADLGMPTTTKIIQNLTT 275

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   ++ +  +L P+ KP   D   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 276 HATKKQLKDADLLYQQLKIELANVLKPIDKPLEIDPLTKPYVILMVGVNGVGKTTTIGKL 335

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +KK  D G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++A + A +
Sbjct: 336 AKKFQDEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQTTGADSASVIFDAMQSAAS 395

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K +D+LI DTAGRL N + LM  + K++RV+K+ +  APH ++  LDA TGQNA+ Q ++
Sbjct: 396 KGIDILIADTAGRLQNKNHLMDELKKIVRVMKKYNESAPHEIMLTLDAGTGQNAISQAKL 455

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F+   G TG+ +TK+DGTA+GG +  I     +P+ F+GVGE I+DL PF A++F   I 
Sbjct: 456 FNEATGLTGITLTKLDGTAKGGVIFAIADQFNLPIRFIGVGEKIDDLRPFNAEEF---ID 512

Query: 312 GCLDYGE 318
              +Y E
Sbjct: 513 ALFEYDE 519


>gi|218710918|ref|YP_002418539.1| cell division protein FtxY [Vibrio splendidus LGP32]
 gi|218323937|emb|CAV20299.1| Cell division protein ftsY [Vibrio splendidus LGP32]
          Length = 422

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 171/252 (67%), Gaps = 1/252 (0%)

Query: 56  SDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVI 114
           +D+G+    KI+E L  K    D+     LY +  E + ++L  + +P   D +  P+VI
Sbjct: 162 ADVGMNTTVKIIENLTEKASRNDLKDGEALYGLLKEEMSEILSQVEQPLVVDTTKTPYVI 221

Query: 115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI 174
           L+VGVNGVGKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W  R     +    
Sbjct: 222 LMVGVNGVGKTTTIGKLAKQFQSEGKKVMLAAGDTFRAAAVEQLQVWGQRNDVPVIAQHT 281

Query: 175 GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL 234
           G+D+A++ Y+A + A+A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++
Sbjct: 282 GADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIM 341

Query: 235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG 294
             LDA TGQNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEG
Sbjct: 342 LTLDAGTGQNAISQAKLFSDVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRYIGVGEG 401

Query: 295 INDLEPFVAKDF 306
           I+DL PF +KDF
Sbjct: 402 IDDLRPFESKDF 413


>gi|237802351|ref|ZP_04590812.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331025208|gb|EGI05264.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 514

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 199 QESEAGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 258

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+P VILVVGVNG
Sbjct: 259 TSVIIKSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKSEHKPFVILVVGVNG 318

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 319 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 378

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 379 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 438

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 439 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 498

Query: 302 VAKDF 306
            A+ F
Sbjct: 499 EAEPF 503


>gi|240949098|ref|ZP_04753446.1| cell division protein FtsY-like protein [Actinobacillus minor
           NM305]
 gi|240296493|gb|EER47125.1| cell division protein FtsY-like protein [Actinobacillus minor
           NM305]
          Length = 517

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 127/298 (42%), Positives = 193/298 (64%), Gaps = 7/298 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL-- 70
           +  +L +G   T   +  G  +    +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 211 FFSRLIQGLIKTKQSIGSGFFNFFRGKKIDDELFEELEEQLLIADLGMPTTTKIINNLSQ 270

Query: 71  -LTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
             TK+  KD      LY +  E +  +L P+++P   D S +P+VIL+VGVNGVGKTT I
Sbjct: 271 HATKQQLKDADA---LYQLLKEELADVLKPVARPLEIDTSKKPYVILMVGVNGVGKTTTI 327

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+++  + G  VMLAAGDTFR+AA++QL++W +R +   +    GSD+A++ ++A + 
Sbjct: 328 GKLARQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQTSGSDSASVIFDAMQS 387

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A AK +DVLI DTAGRL N + LM  + K++RV+++ D  APH ++  LDA TGQNA+ Q
Sbjct: 388 ASAKNIDVLIADTAGRLQNKNNLMDELKKIVRVMQKYDETAPHEIMLTLDAGTGQNAISQ 447

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            ++F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 448 AKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 505


>gi|225677364|ref|ZP_03788335.1| signal recognition particle docking protein FtsY [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590591|gb|EEH11847.1| signal recognition particle docking protein FtsY [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 303

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 192/304 (63%), Gaps = 3/304 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +S    L KG   TS +   G+  I S+++ LD  + +ELE+LLI  DIG   ++ I++ 
Sbjct: 1   MSLFGNLYKGLLKTSSRFSNGVKSIFSNKKKLDQSLLDELEELLISMDIGHKTSKLIIDR 60

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           L + ++ K+V    +   +   I  +L P+ +P     + +PH+I+V GVNG GKTT IG
Sbjct: 61  LTSIKFDKEVEYNIISQQLMNEIEAILSPVVQPL--ILNKKPHIIMVCGVNGNGKTTTIG 118

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+ K  + G  VML A DTFR+AA +QL IWA+R+    V  E GSD+A++AY A  QA
Sbjct: 119 KLAYKYKEMGKSVMLVACDTFRAAASEQLNIWAERSDCLIVTGEYGSDSASVAYRAVSQA 178

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
               VDV++IDTAGRL NN  LM  + K+ R +K+LD  APH V+ VLDATTGQNA  Q+
Sbjct: 179 IKDNVDVVLIDTAGRLQNNVNLMEELSKIYRTIKKLDDTAPHDVILVLDATTGQNAYSQL 238

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F  +   TGLI+TK+DGTA+GG +I +   +KI ++ +G+GE I DL  F +K+F+  
Sbjct: 239 EAFSKMVNVTGLIVTKLDGTAKGGVVIGLAEAYKIKLHAIGIGENIEDLREFTSKEFAEA 298

Query: 310 ITGC 313
           +  C
Sbjct: 299 LFNC 302


>gi|42520719|ref|NP_966634.1| cell division ABC transporter, periplasmic substrate-binding
           protein FtsY [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410459|gb|AAS14568.1| cell division ABC transporter, periplasmic substrate-binding
           protein FtsY [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 303

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 191/304 (62%), Gaps = 3/304 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +S    L +G   TS +  +G+  I S  ++LD  + +ELE+LLI  DIG   ++ I++ 
Sbjct: 1   MSLFSNLYQGLLKTSSRFSDGVKSIFSGKKKLDQSLLDELEELLISMDIGHKTSKLIIDR 60

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           L + ++ K+V    +   +   I  +L P  +P     + +PH+I+V GVNG GKTT IG
Sbjct: 61  LTSIKFDKEVEYNTITQQLMSEIESILNPAVQPL--ILNKKPHIIMVCGVNGNGKTTTIG 118

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+ K  + G  VML A DTFR+AA +QL IWA+R+    V  E GSD+A++AY A  QA
Sbjct: 119 KLAYKYKEMGKSVMLVACDTFRAAASEQLNIWAERSDCLIVTGEYGSDSASVAYRAVSQA 178

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
               VDV++IDTAGRL NN  LM  + K+ R +K+LD  APH V+ VLDATTGQNA  Q+
Sbjct: 179 IKDNVDVVLIDTAGRLQNNVNLMEELSKIYRTIKKLDDTAPHDVILVLDATTGQNAYSQL 238

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F  +   TGLI+TK+DGTA+GG +I +   +KI ++ +G+GE I DL  F +K+F+  
Sbjct: 239 EAFSKMVNVTGLIVTKLDGTAKGGVVIGLAEAYKIKLHAIGIGENIEDLREFTSKEFAEA 298

Query: 310 ITGC 313
           +  C
Sbjct: 299 LFNC 302


>gi|219669784|ref|YP_002460219.1| signal recognition particle-docking protein FtsY
           [Desulfitobacterium hafniense DCB-2]
 gi|219540044|gb|ACL21783.1| signal recognition particle-docking protein FtsY
           [Desulfitobacterium hafniense DCB-2]
          Length = 320

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/315 (45%), Positives = 212/315 (67%), Gaps = 11/315 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEEL- 70
           +  KL  G   T  +    + +I++ RR +D+ + EELE++LIRSD+GV  + ++VE L 
Sbjct: 11  FFTKLKAGLTKTRDQFVTKVEEILTGRRKIDEELYEELEEVLIRSDVGVNTSFELVEGLR 70

Query: 71  --LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFS-HRPHVILVVGVNGVGKTTV 127
             + KR  ++    +V+  + ELI ++L    +  + +F+ H P + LVVGVNGVGKTT 
Sbjct: 71  KEVKKRKLQEAEELKVV--LQELIAELL---GEEESMNFAEHGPSIFLVVGVNGVGKTTT 125

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+    + G KV+LAAGDTFR+AAIDQL++W  R   + +  + G+D AA+AY+A +
Sbjct: 126 IGKLAHYFQEEGKKVILAAGDTFRAAAIDQLEVWGQRAGVEVIKQKEGADPAAVAYDALQ 185

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+++  D++I+DTAGRLHN   LM  + K+ RV++R  P APH VL VLDATTGQNAL+
Sbjct: 186 AAKSRGADLVIMDTAGRLHNKVNLMEELRKVKRVIEREIPGAPHEVLLVLDATTGQNALQ 245

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF- 306
           Q ++F  VAG TG+++TK+DGTA+GG ++ I     IPV ++GVGEG+ DL PF+ +DF 
Sbjct: 246 QAKLFQEVAGVTGIVLTKLDGTAKGGVVLGIQGEINIPVKWIGVGEGMEDLRPFIPQDFA 305

Query: 307 SAVITGCLDYGEEKI 321
           SA+     D  EE+I
Sbjct: 306 SALFDQTQDDEEEEI 320


>gi|261250005|ref|ZP_05942582.1| signal recognition particle receptor protein FtsY [Vibrio
           orientalis CIP 102891]
 gi|260939509|gb|EEX95494.1| signal recognition particle receptor protein FtsY [Vibrio
           orientalis CIP 102891]
          Length = 406

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 195/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  A T   +  G   +   +++DD + EELE+ L+ +D+G+    KI++ L 
Sbjct: 102 SFFARLKRSLARTKANIGAGFFGLFKGKQIDDELFEELEEQLLIADVGMDTTLKIIDNLT 161

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +D+     LY +  E + ++L  + KP   D S  P+VIL+VGVNGVGKTT IGK
Sbjct: 162 EKASRQDLKDGEALYGLLKEEMAEILSNVEKPLEVDSSKAPYVILMVGVNGVGKTTTIGK 221

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ Y+A + A+
Sbjct: 222 LAKQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIYDAIESAK 281

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDV+I DTAGRL N + LM  + K++RV++++D  APH ++  LDA TGQNA+ Q +
Sbjct: 282 AKGVDVVIADTAGRLQNKANLMEELRKIVRVMQKVDGSAPHEIMLTLDAGTGQNAISQAK 341

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PF  ++F
Sbjct: 342 LFSDVAPLTGITLTKLDGTAKGGVIFALADQFQIPIRYIGVGEGIDDLRPFETQEF 397


>gi|291288128|ref|YP_003504944.1| signal recognition particle-docking protein FtsY [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290885288|gb|ADD68988.1| signal recognition particle-docking protein FtsY [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 380

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 200/305 (65%), Gaps = 12/305 (3%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   + ++L +G + TS KL  G+  I S ++ +D+ + EELE+L I SD+GV+   KI
Sbjct: 69  AEKPGFFKRLKQGLSKTSGKLVGGMETIFSGKKVIDEDLLEELEELFITSDVGVSTTMKI 128

Query: 67  VEELLTKRYAKDVSVQRVLYDVSELI----HKMLMPLSKPFNWDFSH-RPHVILVVGVNG 121
           ++ +      +D   ++ L +  EL      ++L  L  P   + +  +P+VILV GVNG
Sbjct: 129 IDNV------RDELSRKALKNPQELKASLRKQILNILDIPNELNTTDDKPYVILVAGVNG 182

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT I K++K+  + GL   LAAGDTFR+AAIDQL +WA R     V    GSD+AA+
Sbjct: 183 AGKTTSIAKMAKRFKEQGLSTCLAAGDTFRAAAIDQLCVWAKRVDVPVVKQSEGSDSAAV 242

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A +  ++KK+DVLI DTAGRLHN   LM  + K++R+ KR  P APH VL VLDAT+
Sbjct: 243 IFDAIQSCKSKKIDVLIADTAGRLHNKFNLMKEMEKIVRIAKRELPDAPHEVLLVLDATS 302

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNAL Q + FH   G TGL++TK+DGTA+GG +I IV   +IPV F+G GEGI+D++PF
Sbjct: 303 GQNALSQAQKFHEDIGITGLVLTKLDGTAKGGAVIGIVDELQIPVKFIGFGEGIDDMKPF 362

Query: 302 VAKDF 306
            A+DF
Sbjct: 363 SAEDF 367


>gi|114561463|ref|YP_748976.1| signal recognition particle-docking protein FtsY [Shewanella
           frigidimarina NCIMB 400]
 gi|114332756|gb|ABI70138.1| signal recognition particle-docking protein FtsY [Shewanella
           frigidimarina NCIMB 400]
          Length = 587

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 191/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   +   +++++ + EELE+ L+ +D+GV    K+++ L     
Sbjct: 284 RLKRGLMRTSENIGSGFIGLFRGKKINEELFEELEEQLLIADVGVETTNKLIKSLTEHAS 343

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + KML P++ P   D ++ P VIL++GVNGVGKTT IGKL+K+
Sbjct: 344 RKQLKDAEALYDLMREEMQKMLDPVAIPLVPDNANGPFVILMIGVNGVGKTTTIGKLAKQ 403

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A+A+KV
Sbjct: 404 YQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVIFDALQAAKARKV 463

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N S LM  + K++RV+K+LDP +PH V+  LDA+TGQNA+ Q ++F  
Sbjct: 464 DVLIADTAGRLQNKSHLMEELKKVVRVMKKLDPDSPHEVMLTLDASTGQNAISQAQLFKE 523

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F + DF
Sbjct: 524 AVGVTGITISKLDGTAKGGVIFAIADKFSIPIRHIGVGEQIDDLRTFNSNDF 575


>gi|119776600|ref|YP_929340.1| cell division protein FtsY [Shewanella amazonensis SB2B]
 gi|119769100|gb|ABM01671.1| signal recognition particle-docking protein FtsY [Shewanella
           amazonensis SB2B]
          Length = 563

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 130/298 (43%), Positives = 194/298 (65%), Gaps = 7/298 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    K+++ L  
Sbjct: 256 FFARLKRGLMRTSENIGSGFIGLFRGKKIDDELFEELEEQLLIADVGVETTSKLIKSLTE 315

Query: 72  --TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
             ++R  KD      LY++  E + + L P+S P   + +  P+VIL+VGVNGVGKTT I
Sbjct: 316 HASRRQLKDAEA---LYELLREEMQRTLEPVSVPLVPENAQGPYVILMVGVNGVGKTTTI 372

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+K+    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + 
Sbjct: 373 GKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVLFDALQS 432

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+AK VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q
Sbjct: 433 AKAKGVDVLICDTAGRLQNKNHLMEELKKVVRVMKKLDESAPHEVMLTLDASTGQNAISQ 492

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            ++F    G TG+ +TK+DGTA+GG +  I     IP+ ++GVGE I+DL  F A+DF
Sbjct: 493 AKLFQEAVGVTGISITKLDGTAKGGVIFAIADKFGIPIRYIGVGEQIDDLRVFNARDF 550


>gi|307128891|ref|YP_003880907.1| signal recognition particle (SRP) receptor [Dickeya dadantii 3937]
 gi|306526420|gb|ADM96350.1| signal recognition particle (SRP) receptor [Dickeya dadantii 3937]
          Length = 446

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 189/297 (63%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI++ L  
Sbjct: 144 FFARLKRSLVKTRQNLGSGFVGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIDRLTE 203

Query: 72  --TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             +++  KD      L      +  +L  +  P + D S  P VIL+VGVNGVGKTT IG
Sbjct: 204 HASRKQLKDAEALIALLKAE--MSDILAKVDAPLDID-SKTPFVILMVGVNGVGKTTTIG 260

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A
Sbjct: 261 KLARQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVPVVAQHTGADSASVIFDALQAA 320

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N S LM  + K++RV+K+LD +APH V+  LDA+TGQNA+ Q 
Sbjct: 321 RARGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDENAPHEVMLTLDASTGQNAVSQA 380

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           ++F+   G +G+ +TK+DGTA+GG +  I     IP+ ++GVGE I+DL PF A DF
Sbjct: 381 KLFNETVGLSGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGESIDDLRPFKADDF 437


>gi|323498060|ref|ZP_08103066.1| signal recognition particle-docking protein FtsY [Vibrio
           sinaloensis DSM 21326]
 gi|323316868|gb|EGA69873.1| signal recognition particle-docking protein FtsY [Vibrio
           sinaloensis DSM 21326]
          Length = 404

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 194/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  A T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+E L 
Sbjct: 100 SFFARLKRSLARTKANIGAGFFGLFKGKQIDDDLFEELEEQLLIADVGMDTTLKIIENLT 159

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +++     LY +  E + ++L  + +P   D S  P+VIL+VGVNGVGKTT IGK
Sbjct: 160 EKASRQELKDGEALYGLLKEEMAEILSNVEQPLQVDTSKTPYVILMVGVNGVGKTTTIGK 219

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A + A+
Sbjct: 220 LAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNGVPVVAQHTGADSASVIYDAIESAK 279

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 280 AKGVDVVIADTAGRLQNKANLMEELRKIVRVMKKVDDSAPHEIMLTLDAGTGQNAISQAK 339

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PF  ++F
Sbjct: 340 LFSDVAPLTGITLTKLDGTAKGGVIFALADQFQIPIRYIGVGEGIDDLRPFETQEF 395


>gi|86148197|ref|ZP_01066495.1| cell division protein FtsY [Vibrio sp. MED222]
 gi|85834044|gb|EAQ52204.1| cell division protein FtsY [Vibrio sp. MED222]
          Length = 422

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 171/252 (67%), Gaps = 1/252 (0%)

Query: 56  SDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVI 114
           +D+G+    KI+E L  K    D+     LY +  E + ++L  + +P   D +  P+VI
Sbjct: 162 ADVGMNTTVKIIENLTEKASRNDLKDGEALYGLLKEEMSEILSQVEQPLVVDTTKTPYVI 221

Query: 115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI 174
           L+VGVNGVGKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W  R     +    
Sbjct: 222 LMVGVNGVGKTTTIGKLAKQFQSEGKKVMLAAGDTFRAAAVEQLQVWGQRNDVPVIAQHT 281

Query: 175 GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL 234
           G+D+A++ Y+A + A+A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++
Sbjct: 282 GADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIM 341

Query: 235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG 294
             LDA TGQNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEG
Sbjct: 342 LTLDAGTGQNAISQAKLFSDVAPVTGITLTKLDGTAKGGVIFSIADLFQIPIRYIGVGEG 401

Query: 295 INDLEPFVAKDF 306
           I+DL PF +KDF
Sbjct: 402 IDDLRPFESKDF 413


>gi|226952926|ref|ZP_03823390.1| signal recognition particle-docking protein FtsY [Acinetobacter sp.
           ATCC 27244]
 gi|226836247|gb|EEH68630.1| signal recognition particle-docking protein FtsY [Acinetobacter sp.
           ATCC 27244]
          Length = 371

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 196/304 (64%), Gaps = 2/304 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           +S  +  ++  G   T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+
Sbjct: 63  KSGGFFGRMKDGLTKTRRSFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTII 122

Query: 68  EELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126
             L  +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT
Sbjct: 123 ANLTERTARGDLIYSHALYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTT 182

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF
Sbjct: 183 TIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIPVVAQGHGADSASVIFDAF 242

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+AK +DVLI DTAGRL N S LM  + K+ RV++++D  APH ++ ++DA TGQNA+
Sbjct: 243 ESARAKGIDVLIADTAGRLQNKSHLMEELKKVKRVMQKIDATAPHEIMLIVDAGTGQNAI 302

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            QV++F    G TG+ +TK+DGTA+GG L  I     +P+ ++GVGE I+DL PF AK F
Sbjct: 303 NQVQLFDEAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRYIGVGEKIDDLRPFSAKSF 362

Query: 307 SAVI 310
            A +
Sbjct: 363 VAAL 366


>gi|294650502|ref|ZP_06727861.1| signal recognition particle-docking protein FtsY [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292823645|gb|EFF82489.1| signal recognition particle-docking protein FtsY [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 371

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 196/304 (64%), Gaps = 2/304 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           +S  +  ++  G   T     +G+ +I I  + +DD + EE+E+ L+ +DIGV   + I+
Sbjct: 63  KSGGFFGRMKDGLTKTRRSFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTII 122

Query: 68  EELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126
             L  +    D+     LY  + E +  +L P  KP + D +  P+VIL+VGVNGVGKTT
Sbjct: 123 ANLTERTARGDLIYSHALYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTT 182

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+K++   G KVMLAAGDTFR+AA +QL+IW +R     V    G+D+A++ ++AF
Sbjct: 183 TIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIPVVAQGHGADSASVIFDAF 242

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+AK +DVLI DTAGRL N S LM  + K+ RV++++D  APH ++ ++DA TGQNA+
Sbjct: 243 ESARAKGIDVLIADTAGRLQNKSHLMEELKKVKRVMQKIDATAPHEIMLIVDAGTGQNAI 302

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            QV++F    G TG+ +TK+DGTA+GG L  I     +P+ ++GVGE I+DL PF AK F
Sbjct: 303 NQVQLFDEAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRYIGVGEKIDDLRPFSAKSF 362

Query: 307 SAVI 310
            A +
Sbjct: 363 VAAL 366


>gi|84393534|ref|ZP_00992288.1| Signal recognition particle GTPase [Vibrio splendidus 12B01]
 gi|84375813|gb|EAP92706.1| Signal recognition particle GTPase [Vibrio splendidus 12B01]
          Length = 417

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 171/252 (67%), Gaps = 1/252 (0%)

Query: 56  SDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVI 114
           +D+G+    KI+E L  K    D+     LY +  E +  +L  + +P   D +  P+VI
Sbjct: 157 ADVGMNTTVKIIENLTEKASRNDLKDGEALYGLLKEEMADILSQVEQPLVVDTTKTPYVI 216

Query: 115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI 174
           L+VGVNGVGKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W  R +   +    
Sbjct: 217 LMVGVNGVGKTTTIGKLAKQFQSEGKKVMLAAGDTFRAAAVEQLQVWGQRNNVPVIAQHT 276

Query: 175 GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL 234
           G+D+A++ Y+A + A+A+ VDV+I DTAGRL N S LM  + K++RV+K++D  APH ++
Sbjct: 277 GADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIM 336

Query: 235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG 294
             LDA TGQNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEG
Sbjct: 337 LTLDAGTGQNAISQAKLFSDVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRYIGVGEG 396

Query: 295 INDLEPFVAKDF 306
           I+DL PF +KDF
Sbjct: 397 IDDLRPFESKDF 408


>gi|294085381|ref|YP_003552141.1| cell division protein ftsY [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664956|gb|ADE40057.1| cell division protein ftsY [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 309

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 201/305 (65%), Gaps = 3/305 (0%)

Query: 11  LSWIRKLTKGFASTSLKLK---EGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           +SW +KL +G   ++ K+      ++++    R+D    EE+ED LI +D+G   AQ++ 
Sbjct: 1   MSWFKKLKEGLGKSTSKVTASLSSLSNLFGGARIDASSLEEVEDALISADLGTTSAQRLA 60

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
           + +   ++   +    +   +++ I ++L P+++    D +H PHV+L+VGVNG GKTT 
Sbjct: 61  DRMRRHKFEGPIDSDTLGQALADGITEILEPVAQKLEIDAAHAPHVVLLVGVNGSGKTTT 120

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
            GKL+++  D G  VMLAAGDTFR+AAI+QL+IW  RT  + +    G DAAALAYEA +
Sbjct: 121 AGKLAQQWRDEGKSVMLAAGDTFRAAAIEQLQIWGARTGTEVIAGAQGGDAAALAYEALE 180

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           +A+A  +DVLIIDTAGRL N + LM  + K++RV+++LD  APH  + +LD T GQNA+ 
Sbjct: 181 KAKAANIDVLIIDTAGRLQNRTELMDELAKIVRVMRKLDASAPHDSVIILDGTVGQNAIS 240

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QV+ F  VA  TGLI+TK+DG+A+GG ++ +     +PV+ +GVGE  +DL+PF A +F+
Sbjct: 241 QVKAFREVADVTGLIVTKLDGSAKGGVVVALAEEFGLPVHAVGVGEQADDLQPFAAAEFA 300

Query: 308 AVITG 312
             + G
Sbjct: 301 KALVG 305


>gi|260774826|ref|ZP_05883728.1| signal recognition particle receptor protein FtsY [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260609251|gb|EEX35406.1| signal recognition particle receptor protein FtsY [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 411

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 193/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L    A T   +  G   +   +++DD + EELE+ L+ +D+G+    KI++ L 
Sbjct: 107 SFFARLKHSLARTKANIGAGFFGLFKDKQIDDELFEELEEQLLIADVGMDTTVKIIDNLT 166

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +++     LY +  E +  +L  + KP   D +  P+VIL+VGVNGVGKTT IGK
Sbjct: 167 EKASRQELKDGEALYGLLKEEMAGILSTVEKPLEIDTNKTPYVILMVGVNGVGKTTTIGK 226

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A + A+
Sbjct: 227 LAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVVAQHTGADSASVIYDAIESAK 286

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 287 AKGVDVVIADTAGRLQNKANLMEELRKIVRVMKKVDDSAPHEIMLTLDAGTGQNAISQAK 346

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PF  ++F
Sbjct: 347 LFSDVAPLTGITLTKLDGTAKGGVIFALADQFQIPIRYIGVGEGIDDLRPFETQEF 402


>gi|330447182|ref|ZP_08310832.1| signal recognition particle-docking protein FtsY [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491373|dbj|GAA05329.1| signal recognition particle-docking protein FtsY [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 458

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 192/298 (64%), Gaps = 1/298 (0%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           S  +  +L +G   T      G   + S +++DD + EELE+ L+ +D+G+    KI+E 
Sbjct: 152 SEGFFARLMRGLKKTKTNFGAGFFGLFSGKKIDDELFEELEEQLLIADVGMDTTLKIIEN 211

Query: 70  LLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K++     LY +  + +  ML  + +P   D S +P+VIL+VGVNGVGKTT I
Sbjct: 212 LTDKASRKELKDGEALYGLLKDELADMLSKVEQPLVVDTSKKPYVILMVGVNGVGKTTTI 271

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+K+    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + 
Sbjct: 272 GKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNHVPVVAQHTGADSASVIFDAIES 331

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+AK +DV+I DTAGRL N   LM  + K++RV+K++D  APH ++  +DA TGQNA+ Q
Sbjct: 332 AKAKNIDVVIADTAGRLQNKGNLMEELRKIVRVMKKVDVDAPHEIMLTVDAGTGQNAISQ 391

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            ++F  VA  +G+ +TK+DGTA+GG +  I     IP+ ++G+GEGI+DL PF A +F
Sbjct: 392 AKLFSDVAPVSGITITKLDGTAKGGVIFAIADQFNIPIRYIGIGEGIDDLRPFAADEF 449


>gi|89895351|ref|YP_518838.1| hypothetical protein DSY2605 [Desulfitobacterium hafniense Y51]
 gi|89334799|dbj|BAE84394.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 322

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/327 (44%), Positives = 214/327 (65%), Gaps = 11/327 (3%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIG 59
           MS  K   +   +  KL  G   T  +    + +I++ RR +D+ + EELE++LIRSD+G
Sbjct: 1   MSMYKEEVQLAGFFTKLKNGLTKTRDQFVTKVEEILTGRRKIDEELYEELEEVLIRSDVG 60

Query: 60  VAVAQKIVEEL---LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFS-HRPHVIL 115
           V  +  +VE L   + KR  ++    +++  + ELI ++L    +  + +F+ H P + L
Sbjct: 61  VNTSFGLVEGLRKEVKKRKLQEAEELKIV--LQELIAELL---GEEESMNFAEHGPSIFL 115

Query: 116 VVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIG 175
           VVGVNGVGKTT IGKL+      G KV+LAAGDTFR+AAIDQL++W  R   + +  + G
Sbjct: 116 VVGVNGVGKTTTIGKLAHYFQGEGKKVILAAGDTFRAAAIDQLEVWGQRAGVEVIKQKEG 175

Query: 176 SDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQ 235
           +D AA+AY+A + A+++  D++I+DTAGRLHN   LM  + K+ RV++R  P APH VL 
Sbjct: 176 ADPAAVAYDALQAAKSRGADLVIMDTAGRLHNKVNLMEELRKVKRVIEREIPGAPHEVLL 235

Query: 236 VLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGI 295
           VLDATTGQNAL+Q ++F  VAG TG+++TK+DGTA+GG ++ I     IPV ++GVGEG+
Sbjct: 236 VLDATTGQNALQQAKLFQEVAGVTGIVLTKLDGTAKGGVVLGIQGEINIPVKWIGVGEGM 295

Query: 296 NDLEPFVAKDF-SAVITGCLDYGEEKI 321
            DL PF+ +DF SA+     D  EE+I
Sbjct: 296 EDLRPFIPQDFASALFDQTQDDEEEEI 322


>gi|293393950|ref|ZP_06638256.1| cell division protein FtsY [Serratia odorifera DSM 4582]
 gi|291423510|gb|EFE96733.1| cell division protein FtsY [Serratia odorifera DSM 4582]
          Length = 608

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 193/300 (64%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+E L  
Sbjct: 306 FFARLKRSLIKTKQNLGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIESLTL 365

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
               K +     LY     ++SE++ K+  PL      D S + P+VIL+VGVNGVGKTT
Sbjct: 366 HASRKQLKDAEALYGKLKEEMSEILAKVDQPL------DVSGKTPYVILMVGVNGVGKTT 419

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A 
Sbjct: 420 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVVAQHTGADSASVIFDAV 479

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N + LM  + K++RV+K+LD HAPH V+  LDA+TGQNA+
Sbjct: 480 QAAKARGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEHAPHEVMLTLDASTGQNAV 539

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 540 SQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 599


>gi|271502549|ref|YP_003335575.1| signal recognition particle-docking protein FtsY [Dickeya dadantii
           Ech586]
 gi|270346104|gb|ACZ78869.1| signal recognition particle-docking protein FtsY [Dickeya dadantii
           Ech586]
          Length = 466

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 126/299 (42%), Positives = 192/299 (64%), Gaps = 10/299 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+  L  
Sbjct: 164 FFARLKRSLIKTRQNLGSGFVGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIARLTE 223

Query: 72  --TKRYAKDVSVQRVLY--DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
             +++  KD      L   ++S+++ K+ +PL+       S  P VIL+VGVNGVGKTT 
Sbjct: 224 HASRKQLKDAEALIALLKSEMSDILAKVDVPLAID-----SKTPFVILMVGVNGVGKTTT 278

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A +
Sbjct: 279 IGKLARQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVPVVAQHTGADSASVIFDALQ 338

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+A+ VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ 
Sbjct: 339 AAKARGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVS 398

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F+   G +G+ +TK+DGTA+GG +  I     IP+ ++GVGE I+DL PF A DF
Sbjct: 399 QAKLFNEAVGLSGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGESIDDLRPFKADDF 457


>gi|319786795|ref|YP_004146270.1| signal recognition particle-docking protein FtsY [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465307|gb|ADV27039.1| signal recognition particle-docking protein FtsY [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 447

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 176/269 (65%), Gaps = 3/269 (1%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV--SELIHKMLM 97
           +LDD + +E+E  L+ +D+GV     +VE L  +  A++ +  R L     +ELI  ML 
Sbjct: 169 KLDDDLLDEIETALLTADVGVTATTALVEGLRKRMKAREFADARALLTALRAELIA-MLQ 227

Query: 98  PLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ 157
           P+++P   D + RP V+L VGVNGVGKTT IGKL+++  D G  +MLAAGDTFR+AA+ Q
Sbjct: 228 PVARPLQIDPATRPFVLLTVGVNGVGKTTTIGKLARRFKDEGRSLMLAAGDTFRAAAVAQ 287

Query: 158 LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGK 217
           L+ W +R     +     +DAA++A++A + A+A+  +VLI DTAGRLH    LM  +GK
Sbjct: 288 LQAWGERNGVTVIAQGQNADAASVAFDALQAAKARGTEVLIADTAGRLHTQVGLMNELGK 347

Query: 218 MIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIP 277
           + RVL++LDP APH VL V+D TTGQNAL Q+  F+A  G TGL++TK+DGTA+GG +  
Sbjct: 348 IKRVLQKLDPAAPHEVLMVIDGTTGQNALNQLRQFNAAVGVTGLVVTKLDGTAKGGVVFA 407

Query: 278 IVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +     IP+ F G+GE   DL  F  + F
Sbjct: 408 LAREFGIPIRFAGIGERPEDLRVFDPEAF 436


>gi|145630513|ref|ZP_01786293.1| cell division protein FtsY [Haemophilus influenzae R3021]
 gi|144983903|gb|EDJ91345.1| cell division protein FtsY [Haemophilus influenzae R3021]
          Length = 400

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KIV+ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIVKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMADILEPVARPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|70733142|ref|YP_262915.1| signal recognition particle-docking protein FtsY [Pseudomonas
           fluorescens Pf-5]
 gi|68347441|gb|AAY95047.1| signal recognition particle-docking protein FtsY [Pseudomonas
           fluorescens Pf-5]
          Length = 497

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 3/305 (0%)

Query: 5   KVASES-LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           + A ES + +  +L +G + TS  + EG+  + +  + +DD + E+LE  L+ +D+GV  
Sbjct: 182 RPAEESKIGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDELLEDLETRLLTADVGVEA 241

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++    LY  +   +  ML P+ +P      ++P VILVVGVNG
Sbjct: 242 TSVIIQNLTQKVARKQLTDSDALYASLQAELTSMLKPVEQPLQIVAQNKPFVILVVGVNG 301

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 302 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADSASV 361

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 362 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 421

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     +GL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 422 GQNAINQAKQFNQTVQLSGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 481

Query: 302 VAKDF 306
            A+ F
Sbjct: 482 EAEPF 486


>gi|119475398|ref|ZP_01615751.1| signal recognition particle receptor FtsY [marine gamma
           proteobacterium HTCC2143]
 gi|119451601|gb|EAW32834.1| signal recognition particle receptor FtsY [marine gamma
           proteobacterium HTCC2143]
          Length = 398

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 120/256 (46%), Positives = 174/256 (67%), Gaps = 1/256 (0%)

Query: 56  SDIGVAVAQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVI 114
           +D+GV   + I+E L  +   ++++  + LY  + + + ++L    +P   D + +P+VI
Sbjct: 139 ADVGVEATRDIMETLAKQVSRRELADPQALYRGLQKELAELLEHSREPLQIDETKKPYVI 198

Query: 115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI 174
           LVVGVNGVGKTT IGKL K+    G  VMLAAGDTFR+AA++QL++W +R +   +    
Sbjct: 199 LVVGVNGVGKTTTIGKLGKRFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHT 258

Query: 175 GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL 234
           G+D+A++ ++A + AQA+KVDVLI DTAGRLHN   LM  + K++RV+ +LD  APH V+
Sbjct: 259 GADSASVIFDAVQAAQARKVDVLIADTAGRLHNKDNLMEELKKVVRVMGKLDSTAPHEVM 318

Query: 235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG 294
            VLDA TGQNAL Q + F  V G TG+ +TK+DGTA+GG +  I    ++P+ F+GVGE 
Sbjct: 319 LVLDAGTGQNALSQAKAFQEVVGVTGITVTKLDGTAKGGIIFAISKQLQLPIRFIGVGEQ 378

Query: 295 INDLEPFVAKDFSAVI 310
           I+DL PF A DF A +
Sbjct: 379 IDDLRPFAADDFVAAL 394


>gi|58585012|ref|YP_198585.1| Signal recognition particle GTPase [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
 gi|58419328|gb|AAW71343.1| Signal recognition particle GTPase [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 301

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 192/298 (64%), Gaps = 3/298 (1%)

Query: 17  LTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           L +G   TS +  +G+  I S+++ LD  + +ELE+LLI  DIG   ++ I++ L + ++
Sbjct: 5   LYRGLLKTSSRFSDGVKSIFSAKKKLDQSLLDELEELLISMDIGHKTSKLIIDRLASIKF 64

Query: 76  AKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKM 135
            K+V    +   +   I  +L P+ +P   D    PH+I+V GVNG GKTT IGKL+ K 
Sbjct: 65  DKEVEHNIITQQLMSEIEAILNPVVQPLILD--KNPHIIMVCGVNGNGKTTTIGKLAYKY 122

Query: 136 SDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVD 195
            + G  VML A DTFR+AA +QL IWA+R+    V  E G+D+A++AY A  QA    VD
Sbjct: 123 KNMGKSVMLVACDTFRAAASEQLNIWAERSDCFIVTGEYGNDSASVAYRAVSQAIKGSVD 182

Query: 196 VLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV 255
           V++IDTAGRL NN  LM  + K+ R +K+LD  APH V+ VLDATTGQNA  Q+E F  +
Sbjct: 183 VVLIDTAGRLQNNVNLMEELSKIYRTIKKLDGTAPHDVILVLDATTGQNAYSQLEAFSKM 242

Query: 256 AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
              TGLI+TK+DGTA+GG +I +  T+++ ++ +G+GE I DL  F +K+F+  + GC
Sbjct: 243 VSVTGLIITKLDGTAKGGVVIGLAETYRVKLHAIGIGESIEDLREFTSKEFAKALFGC 300


>gi|89076091|ref|ZP_01162451.1| putative cell division protein FtsY [Photobacterium sp. SKA34]
 gi|89048243|gb|EAR53825.1| putative cell division protein FtsY [Photobacterium sp. SKA34]
          Length = 346

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 194/299 (64%), Gaps = 1/299 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           +S  +  +L +G   T      G   +   +++DD + EELE+ L+ +D+G+    KI+E
Sbjct: 39  KSEGFFARLMRGLKKTKTNFGAGFFGLFRGKKIDDELFEELEEQLLIADVGMDTTLKIIE 98

Query: 69  ELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            L  K   K++     LY +  + +  ML  + +P   D S +P+VIL+VGVNGVGKTT 
Sbjct: 99  NLTDKASKKELKDGEALYGLLKDELAGMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTT 158

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+K+    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++A +
Sbjct: 159 IGKLAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIFDAIE 218

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+AK +DV+I DTAGRL N   LM  + K++RV+K++D  APH ++  +DA TGQNA+ 
Sbjct: 219 SAKAKNIDVVIADTAGRLQNKGNLMEELRKIVRVMKKVDVDAPHEIMLTVDAGTGQNAIS 278

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F  VA  +G+ +TK+DGTA+GG +  +     IP+ ++G+GEGI+DL PF A++F
Sbjct: 279 QAKLFSDVAPVSGITITKLDGTAKGGVIFAVADQFNIPIRYIGIGEGIDDLRPFAAEEF 337


>gi|290473621|ref|YP_003466493.1| cell division protein: membrane binding (N-terminal); GTPase domain
           (C-terminal) [Xenorhabdus bovienii SS-2004]
 gi|289172926|emb|CBJ79697.1| cell division protein: membrane binding (N-terminal); GTPase domain
           (C-terminal) [Xenorhabdus bovienii SS-2004]
          Length = 465

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 163 FFARLKRSLVKTRQNLGSGFLGLFSGKKIDDDLFEELEEQLLVADVGVETTRKIINNLTA 222

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L  + KP + +    P+VIL+VGVNGVGKTT IGKL
Sbjct: 223 HASRKELKDAEALYTKLKEEMSDILAKVDKPLDIE-GKSPYVILMVGVNGVGKTTTIGKL 281

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D A++ ++A + A+A
Sbjct: 282 ARQYQSQGKSVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADPASVIFDAIQSAKA 341

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VD+LI DTAGRL N S LM  + K++RV+++LD   PH ++  LDA TGQNA+ Q ++
Sbjct: 342 KGVDILIADTAGRLQNKSHLMEELKKIVRVMRKLDEETPHEIMLTLDACTGQNAVSQAKL 401

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 402 FHEAVGLTGISLTKLDGTAKGGVIFAIADQFDIPIRYIGVGEGIEDLRPFKADDF 456


>gi|121533798|ref|ZP_01665625.1| signal recognition particle-docking protein FtsY [Thermosinus
           carboxydivorans Nor1]
 gi|121307789|gb|EAX48704.1| signal recognition particle-docking protein FtsY [Thermosinus
           carboxydivorans Nor1]
          Length = 307

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 133/305 (43%), Positives = 190/305 (62%), Gaps = 9/305 (2%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISS-RRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  KL  G   T     E I  +I+   ++DD   +ELE +L+ +D+G+     ++++
Sbjct: 3   MGFFDKLKAGLEKTRKNFTEKIEQLITGYTKIDDEFLDELEAVLLSADVGIKTTATLMKD 62

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWD----FSHRPHVILVVGVNGVGKT 125
           +      +++     L  V  L  ++   LS+   W         P VILVVGVNGVGKT
Sbjct: 63  IRQAIKNREIETPEQLKPV--LQERLCAVLSE--GWTGMRLAPEPPTVILVVGVNGVGKT 118

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL       GLKV+LAAGDTFR+AAIDQL+IW  R  A+ +    GSD AA+A++A
Sbjct: 119 TTIGKLGNYYRQLGLKVLLAAGDTFRAAAIDQLEIWGQRIGAEVIKHSEGSDPAAVAFDA 178

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + A+A+K +++IIDTAGRLH  S LM  + K+ RV+ R  P APH  L VLDATTGQNA
Sbjct: 179 VQAAKARKAEIVIIDTAGRLHTKSNLMEELKKIRRVIAREIPDAPHETLLVLDATTGQNA 238

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           + Q ++F    G TG+++TK+DGTA+GG ++ I     +PV ++GVGEG+NDL PF A+D
Sbjct: 239 ISQAKLFSEATGVTGVVLTKLDGTAKGGVVVAIKTELGLPVKWVGVGEGVNDLRPFNAQD 298

Query: 306 FSAVI 310
           F+A +
Sbjct: 299 FAAAL 303


>gi|89068002|ref|ZP_01155419.1| signal recognition particle-docking protein FtsY [Oceanicola
           granulosus HTCC2516]
 gi|89046241|gb|EAR52298.1| signal recognition particle-docking protein FtsY [Oceanicola
           granulosus HTCC2516]
          Length = 384

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 186/275 (67%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E LE+LLI +D+GV  A ++   +    Y K VS + +   ++  + +++ P
Sbjct: 109 RVLDDEMLESLEELLITADLGVETAVRVTANIAEDLYGKRVSTEEIKRALAAEVARIMEP 168

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +++P    +  RP V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 169 VARPLPL-YPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKNVVIAAGDTFRAAAVEQL 227

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W +R     + +  GSD A+LA++A  +AQA   D+L+IDTAGRL N + LM  + K+
Sbjct: 228 QVWGERAGVPVLTAPEGSDPASLAFDALGKAQADGADLLLIDTAGRLQNRADLMEELAKI 287

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQN L QV+ F  +A  +GL+MTK+DGTA+GG L+ +
Sbjct: 288 VRVIRKKDPDAPHNTLLVLDATTGQNGLSQVKTFQQLADVSGLVMTKLDGTAKGGVLVAL 347

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL PF  ++F+  + G 
Sbjct: 348 ADRFGLPIHAIGVGEQIDDLAPFDPQEFADALVGV 382


>gi|54307374|ref|YP_128394.1| putative cell division protein FtsY [Photobacterium profundum SS9]
 gi|46911794|emb|CAG18592.1| putative cell division protein FtsY [Photobacterium profundum SS9]
          Length = 427

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 125/299 (41%), Positives = 191/299 (63%), Gaps = 1/299 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           +S  +  +L +G   T      G   + S +++DD + EELE+ L+ + +G+     I+E
Sbjct: 120 QSDGFFARLMRGLKKTKTNFGSGFFGLFSGKKIDDELFEELEEQLLIAXVGMDXTLXIIE 179

Query: 69  ELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            L  K    ++     LY +  E +  ML  + +P   D + +P VIL+VGVNGVGKTT 
Sbjct: 180 NLTDKAXRNELKDGEALYGLLKEELADMLSTVEQPLIVDTTQKPFVILMVGVNGVGKTTT 239

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+K+    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A +
Sbjct: 240 IGKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNGVPVVAQHTGADSASVIFDAIE 299

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            AQA+ VDV+I DTAGRL N   LM  + K++RV+K++DP APH ++  +DA TGQNA+ 
Sbjct: 300 SAQARNVDVVIADTAGRLQNKGHLMEELRKIVRVMKKVDPAAPHEIMLTVDAGTGQNAIS 359

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F  VA  +G+ ++K+DGTA+GG +  I     IP+ ++G+GEGI+DL PFVA +F
Sbjct: 360 QAKLFSEVAPVSGITISKLDGTAKGGVIFAIANQFSIPIRYIGIGEGIDDLRPFVADEF 418


>gi|261344966|ref|ZP_05972610.1| cell division transporter substrate-binding protein FtsY
           [Providencia rustigianii DSM 4541]
 gi|282567109|gb|EFB72644.1| cell division transporter substrate-binding protein FtsY
           [Providencia rustigianii DSM 4541]
          Length = 701

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 399 FFSRLKKGLLKTRQNLGLGFFSLFSGKKIDDDLFEELEEQLLIADVGVDTTRKIINNLTA 458

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++     LY  + E +  +L  + KP   +   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 459 HASRKELKDAEALYGKLREEMSDILATVDKPLVIE-GKKPYVILMVGVNGVGKTTTIGKL 517

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D A++ ++A + AQA
Sbjct: 518 ARQYQSEGKSVMLAAGDTFRAAAVEQLQVWGERNKISVVAQHTGADPASVIFDAIQSAQA 577

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           K VDVL+ DTAGRL N + LM  + K++RV+++LD  APH ++  LDA+TGQNA+ Q ++
Sbjct: 578 KGVDVLLADTAGRLQNKAHLMEELKKIVRVMRKLDDTAPHEIMLTLDASTGQNAVSQAKL 637

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++G+GEGI DL PF A DF
Sbjct: 638 FNDAVGLTGITLTKLDGTAKGGVIFSIADQFGIPIRYIGIGEGIEDLRPFKADDF 692


>gi|68249364|ref|YP_248476.1| cell division protein FtsY [Haemophilus influenzae 86-028NP]
 gi|68057563|gb|AAX87816.1| cell division protein FtsY [Haemophilus influenzae 86-028NP]
          Length = 414

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KIV+ L  
Sbjct: 110 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIVKNLTE 169

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 170 HASRKELQDAELLYQQLKVEMADILEPVARPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 229

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 230 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 289

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 290 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 349

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 350 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 404


>gi|329896518|ref|ZP_08271576.1| Signal recognition particle receptor protein FtsY [gamma
           proteobacterium IMCC3088]
 gi|328921735|gb|EGG29108.1| Signal recognition particle receptor protein FtsY [gamma
           proteobacterium IMCC3088]
          Length = 375

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 125/301 (41%), Positives = 191/301 (63%), Gaps = 3/301 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           +E   W  +L +G + T  +L  G+ ++   R+ +D  + E+LE  L+ +D+G+     I
Sbjct: 66  AEKSGWYARLKQGLSRTRGQLSSGLGNLFLGRKVIDADLLEDLESTLLMADVGIEATTHI 125

Query: 67  VEELLTKRYAKDVS-VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           VE+L  +   K+++    +L  + + +  M+ P  K      +  P VIL+VGVNG GKT
Sbjct: 126 VEQLTAQVSRKELADGDALLRALKQALTNMVGPYEKALPL-AATAPTVILMVGVNGAGKT 184

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+++    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++A
Sbjct: 185 TTIGKLAQRYKAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQHTGADSASVIFDA 244

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + AQA+ VDVLI DTAGRLHN   LM  + K++RV+K+L+P APH V+ VLDAT GQNA
Sbjct: 245 LQAAQARGVDVLIADTAGRLHNKDNLMEELKKVVRVMKKLNPEAPHEVMLVLDATMGQNA 304

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           + Q + F A    +G+ +TK+DGTA+GG +  I     IP+ ++GVGE + DL PF A+ 
Sbjct: 305 IAQAQHFKAAVDVSGITLTKLDGTAKGGVIFAIAHKLGIPIRYIGVGESLEDLRPFEAEP 364

Query: 306 F 306
           F
Sbjct: 365 F 365


>gi|145634821|ref|ZP_01790529.1| cell division protein [Haemophilus influenzae PittAA]
 gi|145267987|gb|EDK07983.1| cell division protein [Haemophilus influenzae PittAA]
          Length = 410

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 106 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 165

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 166 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 225

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 226 ARKFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVSQSTGSDSASVIFDAMQSAAA 285

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 286 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 345

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 346 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 400


>gi|145640856|ref|ZP_01796438.1| cell division protein FtsY [Haemophilus influenzae R3021]
 gi|145274370|gb|EDK14234.1| cell division protein FtsY [Haemophilus influenzae 22.4-21]
          Length = 399

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P++KP   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMANILEPVAKPLVIDNTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|83955621|ref|ZP_00964201.1| signal recognition particle-docking protein FtsY [Sulfitobacter sp.
           NAS-14.1]
 gi|83839915|gb|EAP79091.1| signal recognition particle-docking protein FtsY [Sulfitobacter sp.
           NAS-14.1]
          Length = 388

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 189/275 (68%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R+ K +SV  +   ++  + +++ P
Sbjct: 112 RVLDDEMLEQLEELLISTDMGVDTALRVTANMAEGRFGKRLSVDEIKRLMATEVARIMDP 171

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    ++  P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 172 IAKPLPI-YAKTPQVVLVVGVNGSGKTTTIGKLASQFKAAGKNVVIAAGDTFRAAAVEQL 230

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  QA+    D+L+IDTAGRL N   LM  + K+
Sbjct: 231 QVWGDRADVPVLTAGQGSDPASLAFDAMTQAERDGADLLLIDTAGRLQNRGDLMEELAKI 290

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QV++F  ++  +GL+MTK+DGTA+GG L+ +
Sbjct: 291 VRVIRKKDPSAPHNTLLVLDATTGQNALNQVKVFQEISDVSGLVMTKLDGTAKGGVLVAL 350

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL+PF  ++F+  + G 
Sbjct: 351 ADKFGLPIHAIGVGEQIDDLQPFDPQEFADALMGL 385


>gi|83942798|ref|ZP_00955259.1| signal recognition particle-docking protein FtsY [Sulfitobacter sp.
           EE-36]
 gi|83846891|gb|EAP84767.1| signal recognition particle-docking protein FtsY [Sulfitobacter sp.
           EE-36]
          Length = 398

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 189/275 (68%), Gaps = 1/275 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R+ K +SV  +   ++  + +++ P
Sbjct: 122 RVLDDEMLEQLEELLISTDMGVDTALRVTANMAEGRFGKRLSVDEIKRLMATEVARIMDP 181

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    ++  P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 182 IAKPLPI-YAKTPQVVLVVGVNGSGKTTTIGKLASQFKAAGKNVVIAAGDTFRAAAVEQL 240

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA++A  QA+    D+L+IDTAGRL N   LM  + K+
Sbjct: 241 QVWGDRADVPVLTAGQGSDPASLAFDAMTQAERDGADLLLIDTAGRLQNRGDLMEELAKI 300

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ DP APH+ L VLDATTGQNAL QV++F  ++  +GL+MTK+DGTA+GG L+ +
Sbjct: 301 VRVIRKKDPSAPHNTLLVLDATTGQNALNQVKVFQEISDVSGLVMTKLDGTAKGGVLVAL 360

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
                +P++ +GVGE I+DL+PF  ++F+  + G 
Sbjct: 361 ADKFGLPIHAIGVGEQIDDLQPFDPQEFADALMGL 395


>gi|145636676|ref|ZP_01792343.1| cell division protein FtsY [Haemophilus influenzae PittHH]
 gi|145270202|gb|EDK10138.1| cell division protein FtsY [Haemophilus influenzae PittHH]
          Length = 400

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMADILEPVARPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|260914701|ref|ZP_05921166.1| FtsY protein [Pasteurella dagmatis ATCC 43325]
 gi|260631205|gb|EEX49391.1| FtsY protein [Pasteurella dagmatis ATCC 43325]
          Length = 476

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +D+GV    KI+  L  
Sbjct: 173 FFSRLVKGLLKTKQNIGVGFRSFFLGKKIDDELFEELEEQLLVADLGVPTTTKIINNLTQ 232

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   ++ + ++L P+++P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 233 HASRKQLQDAELLYQQLKVEMAEILKPVAQPLLIDQSKKPYVILMVGVNGVGKTTTIGKL 292

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K  + G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A A
Sbjct: 293 ARKFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAA 352

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 353 RNVDVLIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 412

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A +F
Sbjct: 413 FHEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFKADEF 467


>gi|148826589|ref|YP_001291342.1| cell division protein FtsY [Haemophilus influenzae PittEE]
 gi|148716749|gb|ABQ98959.1| cell division protein FtsY [Haemophilus influenzae PittEE]
          Length = 400

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|330985908|gb|EGH84011.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 502

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 192/305 (62%), Gaps = 2/305 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAV 62
           Q+  +  + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV  
Sbjct: 187 QEPETGKVGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEA 246

Query: 63  AQKIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNG 121
              I++ L  K   K ++  + LY  +   +  ML P+ +P      H+  VILVVGVNG
Sbjct: 247 TSVIIKSLTQKVARKQLTDAQALYTSLQGELAAMLKPVEQPLVIKAEHKSFVILVVGVNG 306

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++
Sbjct: 307 AGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASV 366

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA T
Sbjct: 367 IFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGT 426

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F
Sbjct: 427 GQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTF 486

Query: 302 VAKDF 306
            A+ F
Sbjct: 487 EAEPF 491


>gi|308188478|ref|YP_003932609.1| Cell division protein ftsY [Pantoea vagans C9-1]
 gi|308058988|gb|ADO11160.1| Cell division protein ftsY [Pantoea vagans C9-1]
          Length = 564

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 189/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   ++I+  L  
Sbjct: 262 FFSRLKRSLVKTRQNLGSGFISLFRGKKIDDDLFDELEEQLLIADVGVDTTRRIITNLTQ 321

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     +++ ++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 322 QANRKQLRDAEALYGLLKAEMASILAKVDAPL------DVSGKTPFVILMVGVNGVGKTT 375

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A 
Sbjct: 376 TIGKLARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAI 435

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+++ VDVLI DTAGRL N S LM  + K+ RV+K+LD  APH V+  LDA+TGQNA+
Sbjct: 436 QAAKSRGVDVLIADTAGRLQNKSHLMEELKKITRVMKKLDDSAPHEVMLTLDASTGQNAV 495

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q  +F+   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A+DF
Sbjct: 496 SQARLFNEAVGLTGIALTKLDGTAKGGVIFSVADQFGIPIRYIGVGEGIEDLRPFKAEDF 555


>gi|145632121|ref|ZP_01787856.1| cell division protein [Haemophilus influenzae 3655]
 gi|144987028|gb|EDJ93558.1| cell division protein [Haemophilus influenzae 3655]
          Length = 405

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 101 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 160

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 161 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 220

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 221 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 280

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 281 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 340

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 341 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 395


>gi|167622228|ref|YP_001672522.1| signal recognition particle-docking protein FtsY [Shewanella
           halifaxensis HAW-EB4]
 gi|167352250|gb|ABZ74863.1| signal recognition particle-docking protein FtsY [Shewanella
           halifaxensis HAW-EB4]
          Length = 597

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 190/292 (65%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   + S +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 291 RLKRGLKRTSESIGSGFIGLFSGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 350

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LY++  E + K L P+S P   + +  P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 351 RKQLKDGEALYELLREEMQKTLEPVSVPLVPENADGPFVILMVGVNGVGKTTTIGKLAKQ 410

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A+KV
Sbjct: 411 YQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVLFDALQAARARKV 470

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+ D  APH V+  LDA+TGQNA+ Q ++F  
Sbjct: 471 DVLIADTAGRLQNKAHLMDELKKVVRVMKKQDETAPHEVMLTLDASTGQNAISQAQLFQE 530

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF
Sbjct: 531 AVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDF 582


>gi|119503518|ref|ZP_01625601.1| signal recognition particle-docking protein FtsY [marine gamma
           proteobacterium HTCC2080]
 gi|119460580|gb|EAW41672.1| signal recognition particle-docking protein FtsY [marine gamma
           proteobacterium HTCC2080]
          Length = 339

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 122/293 (41%), Positives = 186/293 (63%), Gaps = 3/293 (1%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELLTKR 74
           +  +G + T  +   GI  +   R+ +D+ V E LED L+ +D+G+   Q+IV ++  + 
Sbjct: 40  RFRRGLSRTGGQFSNGIGALFLGRKVIDENVLEALEDQLLTADVGIEATQRIVSDITERI 99

Query: 75  YAKDVSVQRVLYDVSE-LIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSK 133
             K++S    + + ++  +  +L P  +P   D  ++P VILVVGVNG GKTT IGKL+ 
Sbjct: 100 SRKELSDGAAVMEATKSALLDILTPCEQPLAPD-DNKPFVILVVGVNGAGKTTTIGKLAH 158

Query: 134 KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193
           +    G +VMLAAGDTFR+AA++QL+ W +R     +    G+D+A++ ++A + A+A+ 
Sbjct: 159 RFKAEGKQVMLAAGDTFRAAAVEQLQAWGERNEVPVIAQHTGADSASVLFDAVQAAKARG 218

Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH 253
           VD+LI DTAGRL N S LM  + K++RV++++DP APH  L VLDA TGQNA+ Q E F 
Sbjct: 219 VDILIADTAGRLQNKSHLMDELEKVVRVMRKVDPQAPHETLLVLDAGTGQNAVSQAEEFD 278

Query: 254 AVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
              G TG+ ++K+DGTARGG +  I      P+ F+G+GE + DL+PF A  F
Sbjct: 279 RTVGVTGIALSKLDGTARGGVIFAIAQRLARPIRFVGIGEAVTDLQPFDANAF 331


>gi|254486217|ref|ZP_05099422.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           GAI101]
 gi|214043086|gb|EEB83724.1| signal recognition particle-docking protein FtsY [Roseobacter sp.
           GAI101]
          Length = 399

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 188/274 (68%), Gaps = 1/274 (0%)

Query: 39  RRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMP 98
           R LDD + E+LE+LLI +D+GV  A ++   +   R+ K +SV  +   ++  I +++ P
Sbjct: 123 RVLDDEMLEQLEELLISTDMGVDTALRVTANMAEGRFGKRLSVDEIKRLLAAEIARIMDP 182

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           ++KP    +S  P V+LVVGVNG GKTT IGKL+ +   AG  V++AAGDTFR+AA++QL
Sbjct: 183 IAKPLPL-YSKTPQVVLVVGVNGSGKTTTIGKLASQFKAAGKHVVIAAGDTFRAAAVEQL 241

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           ++W DR     + +  GSD A+LA+EA  QA+    D+L+IDTAGRL N   LM  + K+
Sbjct: 242 QVWGDRAGVPVLTAAQGSDPASLAFEAMGQAERDGADLLLIDTAGRLQNRGDLMEELAKI 301

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
           +RV+++ D  APH+ L VLDATTGQNAL QV++F  ++  +GL+MTK+DGTA+GG L+ +
Sbjct: 302 VRVIRKKDATAPHNTLLVLDATTGQNALNQVKVFQEISDVSGLVMTKLDGTAKGGVLVAL 361

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG 312
                +P++ +GVGE I+DL+PF  ++F+  + G
Sbjct: 362 ADKFGLPIHAIGVGEQIDDLQPFDPQEFADALMG 395


>gi|145638433|ref|ZP_01794043.1| cell division protein [Haemophilus influenzae PittII]
 gi|145272762|gb|EDK12669.1| cell division protein [Haemophilus influenzae PittII]
          Length = 420

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 116 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 175

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 176 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 235

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 236 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 295

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 296 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 355

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 356 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 410


>gi|309751571|gb|ADO81555.1| Signal recognition particle receptor FtsY [Haemophilus influenzae
           R2866]
          Length = 435

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 131 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 190

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 191 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 250

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 251 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 310

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 311 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 370

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 371 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 425


>gi|88606999|ref|YP_505757.1| signal recognition particle-docking protein FtsY [Anaplasma
           phagocytophilum HZ]
 gi|88598062|gb|ABD43532.1| signal recognition particle-docking protein FtsY [Anaplasma
           phagocytophilum HZ]
          Length = 305

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 188/301 (62%), Gaps = 4/301 (1%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           S + S+ + L +G + TS +L EGI +I   +  +D    + L DLLI +D+G  VA   
Sbjct: 2   SSNESFWQSLKRGLSKTSARLSEGIRNIFGGKADVDQSTLKALRDLLISTDMGPDVADFF 61

Query: 67  VEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126
            +++ T ++   V+ +  L   SE I   L P S P     +H PH+IL+ GVNG GKTT
Sbjct: 62  TQKISTLKFTDSVAEEVRLKLASE-IENFLQPRSAPIT--ITHTPHIILLCGVNGSGKTT 118

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            + KL+ K     + V++ A DTFR+AA++QL +WA+R S   V   IG+DAA++AY+  
Sbjct: 119 TVAKLAHKFMKKNMSVIIGACDTFRAAAVEQLNVWAERISCPIVTGTIGADAASVAYKTV 178

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           ++A  +  DV+IIDTAGRLHN+  LM  + K+ RV++R D  APH ++ VLDAT GQN  
Sbjct: 179 ERAVKEPFDVVIIDTAGRLHNHKNLMEELAKICRVIRRHDEKAPHDIILVLDATIGQNTF 238

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            QVEMF +     GLI+TK+DGTA+GG ++ +   + + ++ +G GEGI DLE F A +F
Sbjct: 239 TQVEMFSSFVDVGGLILTKLDGTAKGGVVLRVSQKYNLMIHAIGTGEGIEDLEDFSATNF 298

Query: 307 S 307
           +
Sbjct: 299 A 299


>gi|260581582|ref|ZP_05849379.1| signal recognition particle-docking protein FtsY [Haemophilus
           influenzae NT127]
 gi|260095175|gb|EEW79066.1| signal recognition particle-docking protein FtsY [Haemophilus
           influenzae NT127]
          Length = 414

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 110 FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 169

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 170 HASRKELQDAELLYQQLKVEMADILEPVAQPLKIDSTKKPYVILMVGVNGVGKTTTIGKL 229

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 230 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 289

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 290 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 349

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 350 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 404


>gi|157963791|ref|YP_001503825.1| signal recognition particle-docking protein FtsY [Shewanella
           pealeana ATCC 700345]
 gi|157848791|gb|ABV89290.1| signal recognition particle-docking protein FtsY [Shewanella
           pealeana ATCC 700345]
          Length = 643

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 189/292 (64%), Gaps = 1/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   + S +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 337 RLKRGLKRTSESIGSGFIGLFSGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 396

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  E + K L P+S P   + +  P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 397 RKQLKDGEALYDLLREEMQKTLDPVSVPLIPENADGPFVILMVGVNGVGKTTTIGKLAKQ 456

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
             + G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+ V
Sbjct: 457 YQEQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVIAQHTGADSASVLFDALQAARARNV 516

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+ D  APH V+  LDA+TGQNA+ Q ++F  
Sbjct: 517 DVLIADTAGRLQNKAHLMDELKKVVRVMKKQDEAAPHEVMLTLDASTGQNAISQAQLFQE 576

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF
Sbjct: 577 AVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDF 628


>gi|52424195|ref|YP_087332.1| FtsY protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306247|gb|AAU36747.1| FtsY protein [Mannheimia succiniciproducens MBEL55E]
          Length = 468

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G   + + +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 164 FFSRLVKGLLKTKQNIGAGFLSLFTGKKIDDELFEELEEQLLIADIGVPTTAKIIKNLTE 223

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
                 +   + LY   ++ + ++L P+ +P   D   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 224 HASRAQLKDTQALYQQLKVEMAEILKPVEQPLIVDTGRKPYVILMVGVNGVGKTTTIGKL 283

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A A
Sbjct: 284 ARQFQQQGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAA 343

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 344 RNADILIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 403

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL PF A++F
Sbjct: 404 FHEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLRPFHAEEF 458


>gi|309973736|gb|ADO96937.1| Signal recognition particle receptor FtsY [Haemophilus influenzae
           R2846]
          Length = 400

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P++KP   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMANILEPVAKPLVIDNTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|254362682|ref|ZP_04978769.1| cell division protein FtsY [Mannheimia haemolytica PHL213]
 gi|261493203|ref|ZP_05989730.1| cell division protein FtsY [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496553|ref|ZP_05992933.1| cell division protein FtsY [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153094301|gb|EDN75165.1| cell division protein FtsY [Mannheimia haemolytica PHL213]
 gi|261307756|gb|EEY09079.1| cell division protein FtsY [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311053|gb|EEY12229.1| cell division protein FtsY [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 498

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 128/299 (42%), Positives = 195/299 (65%), Gaps = 10/299 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +G   T   +  G  +    +++DD + EELE+ L+ +D+G+   QKI+  L  
Sbjct: 192 FFSRLIQGLIKTKQNIGSGFRNFFRGKKIDDELFEELEEQLLVADLGMPTTQKIINNLTQ 251

Query: 72  --TKRYAKDVSV--QRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
             TK+  KD  +  Q++  ++ E+    L P+++P   + + +P+VIL+VGVNGVGKTT 
Sbjct: 252 HATKQQLKDADLLYQQLKVELGEV----LKPVAQPLVLE-AKKPYVILMVGVNGVGKTTT 306

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL++K    G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A +
Sbjct: 307 IGKLARKFQQEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQ 366

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A AK +DVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ 
Sbjct: 367 SAAAKGIDVLIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAIS 426

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ F+GVGE I DL PF A++F
Sbjct: 427 QAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFNIPIRFIGVGEKIEDLRPFNAEEF 485


>gi|294138984|ref|YP_003554962.1| cell division protein FtsY [Shewanella violacea DSS12]
 gi|293325453|dbj|BAJ00184.1| cell division protein FtsY [Shewanella violacea DSS12]
          Length = 743

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+G+    ++++ L  
Sbjct: 436 FFARLKRGLKRTSENIGSGFVGLFKGKKIDDDLFEELEEQLLIADVGIETTTRLIDSLTE 495

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  E + K L P+S P   D +  P VIL+VGVNGVGKTT IGKL
Sbjct: 496 QASRKQLKDGEALYELLREEMQKTLDPVSIPLVPDNADGPFVILMVGVNGVGKTTTIGKL 555

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A
Sbjct: 556 AKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVIAQHTGADSASVVFDALQAARA 615

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +KVDVLI DTAGRL N + LM  + K++RV+K+LD +APH V+  LDA TGQNA+ Q E 
Sbjct: 616 RKVDVLIADTAGRLQNKAHLMDELKKIVRVMKKLDENAPHEVMLTLDAGTGQNAISQAEF 675

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF
Sbjct: 676 FKKDVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDF 730


>gi|90407352|ref|ZP_01215537.1| Signal recognition particle GTPase [Psychromonas sp. CNPT3]
 gi|90311503|gb|EAS39603.1| Signal recognition particle GTPase [Psychromonas sp. CNPT3]
          Length = 507

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/299 (41%), Positives = 192/299 (64%), Gaps = 1/299 (0%)

Query: 9   ESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           + L +  +  +    + L +  G+  I   +++D+ + EELE+ LI +D+GV    KI+E
Sbjct: 191 DKLGFFARFRQSLTKSRLTIGSGLFSIFKGKQIDEDLFEELEEQLIIADMGVETTLKIIE 250

Query: 69  ELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            L      K +     LY +  E + ++L  + KP   D S  P+VIL+VGVNGVGKTT 
Sbjct: 251 NLTQHANRKQLKDAEALYSLLKEDLSEILATVEKPLVIDKSKSPYVILMVGVNGVGKTTT 310

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+KK    GL VMLAAGDTFR+AA++QL++W DR +   +  + G+D+A++ ++A  
Sbjct: 311 IGKLAKKYQQQGLSVMLAAGDTFRAAAVEQLQVWGDRNNIPVIAQQTGADSASVLFDAMD 370

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+A+ VDVLI DTAGRL N   LM  + K++R++++ D  APH ++  +DA TGQNA+ 
Sbjct: 371 AARARGVDVLIADTAGRLQNKDHLMDELSKVVRIMRKKDASAPHEIMLTIDAGTGQNAIS 430

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           QV +F+   G TG+ +TK+DGTA+GG +  +    K+P+ ++G GEGI+DL  F A++F
Sbjct: 431 QVNLFNKAVGLTGITLTKLDGTAKGGIIFSLADKFKLPIRYIGTGEGIDDLREFNAQEF 489


>gi|319775293|ref|YP_004137781.1| cell division protein FtsY [Haemophilus influenzae F3047]
 gi|317449884|emb|CBY86095.1| cell division protein FtsY [Haemophilus influenzae F3047]
          Length = 414

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 110 FFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 169

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P++KP   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 170 HASRKELQDAELLYQQLKVEMANILEPVAKPLVIDNTKKPYVILMVGVNGVGKTTTIGKL 229

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 230 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 289

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 290 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 349

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 350 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 404


>gi|58698555|ref|ZP_00373456.1| signal recognition particle-docking protein FtsY [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630589|ref|YP_002727380.1| signal recognition particle docking protein FtsY [Wolbachia sp.
           wRi]
 gi|58534937|gb|EAL59035.1| signal recognition particle-docking protein FtsY [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592570|gb|ACN95589.1| signal recognition particle docking protein FtsY [Wolbachia sp.
           wRi]
          Length = 303

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 191/304 (62%), Gaps = 3/304 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +S    L KG   TS +  +G+  I S  ++LD  + +ELE+LLI  DIG   ++ I++ 
Sbjct: 1   MSLFGNLYKGLLKTSSRFSDGVKSIFSGKKKLDQSLLDELEELLISMDIGHKTSKLIIDR 60

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           L + ++ K+V    +   +   I  +L P+ +P     + +PH+I+V GVNG GKTT IG
Sbjct: 61  LTSIKFDKEVEYNIITQQLVNEIEAILNPVVQPL--ILNKKPHIIMVCGVNGNGKTTTIG 118

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+ K  +    VML A DTFR+AA +QL IWA+R+    V  E GSD+A++AY A  QA
Sbjct: 119 KLAYKYKEMRKSVMLVACDTFRAAASEQLNIWAERSDCLIVTGEYGSDSASVAYRAVSQA 178

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
               VDV++IDTAGRL NN  LM  + K+ R +K+LD  APH V+ VLDATTGQNA  Q+
Sbjct: 179 IKDNVDVVLIDTAGRLQNNVNLMEELSKIYRTIKKLDGTAPHDVILVLDATTGQNAYSQL 238

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F  +   TGLI+TK+DGTA+GG +I +   +KI ++ +G+GE I DL  F +K+F+  
Sbjct: 239 EAFSKMVNVTGLIVTKLDGTAKGGVVIGLAEAYKIKLHAIGIGENIEDLREFTSKEFAEA 298

Query: 310 ITGC 313
           +  C
Sbjct: 299 LFNC 302


>gi|319897733|ref|YP_004135930.1| cell division protein ftsy [Haemophilus influenzae F3031]
 gi|329122778|ref|ZP_08251350.1| cell division protein FtsY [Haemophilus aegyptius ATCC 11116]
 gi|317433239|emb|CBY81614.1| cell division protein FtsY [Haemophilus influenzae F3031]
 gi|327472042|gb|EGF17480.1| cell division protein FtsY [Haemophilus aegyptius ATCC 11116]
          Length = 414

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 110 FFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 169

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 170 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 229

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 230 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 289

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 290 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 349

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 350 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 404


>gi|16272709|ref|NP_438927.1| cell division protein FtsY [Haemophilus influenzae Rd KW20]
 gi|260579859|ref|ZP_05847689.1| signal recognition particle-docking protein FtsY [Haemophilus
           influenzae RdAW]
 gi|1169764|sp|P44870|FTSY_HAEIN RecName: Full=Cell division protein ftsY homolog
 gi|1573776|gb|AAC22426.1| cell division protein (ftsY) [Haemophilus influenzae Rd KW20]
 gi|260093143|gb|EEW77076.1| signal recognition particle-docking protein FtsY [Haemophilus
           influenzae RdAW]
          Length = 414

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 110 FFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 169

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 170 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 229

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 230 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 289

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 290 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 349

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 350 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 404


>gi|83643465|ref|YP_431900.1| signal recognition particle-docking protein FtsY [Hahella
           chejuensis KCTC 2396]
 gi|83631508|gb|ABC27475.1| signal recognition particle-docking protein FtsY [Hahella
           chejuensis KCTC 2396]
          Length = 376

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 192/296 (64%), Gaps = 3/296 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           W+ ++  G + T  +  + +  + + S+ +D+ + EE+E LL+ +D+G+    +I + + 
Sbjct: 75  WLTRVRSGLSKTRGQFSQNLMALFAGSKAIDEELLEEIETLLLSADVGIEATTQITQAIT 134

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K     +     LYD + E +  +L P   P   + +  P+VILVVGVNGVGKTT IGK
Sbjct: 135 EKLDRNQLKDSSALYDALKEELRGLLEPCCSPLQIE-NKTPYVILVVGVNGVGKTTTIGK 193

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K    G  V+LAAGDTFR+AA++QL++W +R +   +    G+D+A++ ++A + A+
Sbjct: 194 LANKFQQEGRSVVLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVIFDAVQAAK 253

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           ++ VDV+I DTAGRL N   LMA + K++RV+K+ DP APH VL VLDA TGQNAL Q +
Sbjct: 254 SRGVDVVIADTAGRLQNKENLMAELEKVVRVIKKHDPDAPHEVLLVLDAGTGQNALSQAQ 313

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F    G TG+ +TK+DGTA+GG L  I   H +P+ ++GVGEGI+DL PF A +F
Sbjct: 314 LFRQAVGVTGIAITKLDGTAKGGILFAIAKQHGLPIRYIGVGEGIDDLRPFDASEF 369


>gi|229845814|ref|ZP_04465926.1| cell division protein FtsY [Haemophilus influenzae 7P49H1]
 gi|229810818|gb|EEP46535.1| cell division protein FtsY [Haemophilus influenzae 7P49H1]
          Length = 400

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNVGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMVDILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVSQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|301169485|emb|CBW29086.1| cell division protein FtsY [Haemophilus influenzae 10810]
          Length = 414

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 110 FFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 169

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 170 HASRKELQDAELLYQQLKVEMADILEPVAQPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 229

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 230 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 289

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 290 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 349

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 350 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 404


>gi|239946696|ref|ZP_04698449.1| signal recognition particle-docking protein FtsY [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239920972|gb|EER20996.1| signal recognition particle-docking protein FtsY [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 303

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 194/303 (64%), Gaps = 3/303 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +S   KL +  + TS K+ EGI  I   ++LD    EELE+LLI SD+ V+V   I+EE 
Sbjct: 2   ISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAETLEELEELLISSDMSVSVVTNIIEEF 61

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              ++ K++    V   ++EL+ + L     PF  D +++ +VILV GVNG GKTT IGK
Sbjct: 62  KKVKFDKEIDSDTVKDALAELVEQQLSKSEIPFTLD-ANKLNVILVCGVNGAGKTTTIGK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+   S  G KV +AA DTFR+AA++QL  W DR +A  +  E  +D A++AY A +++ 
Sbjct: 121 LAAMYSAQGKKVAVAACDTFRAAAVNQLSTWVDRANALLITGEESADPASVAYRAMEESI 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP-HSVLQVLDATTGQNALRQV 249
            + +D+L IDTAGRLHN   LM  + K+++V+K+LD +AP HS+L V+DA TGQN   QV
Sbjct: 181 KQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSIL-VIDAITGQNTYNQV 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F+     TGLI+TK+DG+A+ G L+ +V    +PVYF+G+GE I DL+ F   DF+  
Sbjct: 240 EHFNDATNLTGLIVTKLDGSAKAGVLVGVVQKFNLPVYFIGIGEKIEDLKKFNRHDFAKS 299

Query: 310 ITG 312
           + G
Sbjct: 300 LVG 302


>gi|87121171|ref|ZP_01077062.1| cell division protein FtsY [Marinomonas sp. MED121]
 gi|86163663|gb|EAQ64937.1| cell division protein FtsY [Marinomonas sp. MED121]
          Length = 439

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 198/308 (64%), Gaps = 9/308 (2%)

Query: 7   ASESLSWIRKLTKGFASTSLKLKEGITD-IISSRRLDDGVREELEDLLIRSDIGVAVAQK 65
           A   L+W +++  G + T   L  G+ + I+ S+++DD + EELE  L+ +D+GV   Q 
Sbjct: 125 ADSGLTWAQRVKAGLSRTRNGLGSGLANLIVGSKQIDDDLLEELETQLLMADVGVEATQS 184

Query: 66  IVEELLTKRYAKDVSVQRVL-----YDVSELIHKMLMPL--SKPFNWDFSHRPHVILVVG 118
           ++  L  K   K++     L     +++S+++     PL  S+P   +    P+VIL+VG
Sbjct: 185 LIATLTEKMNRKELKDADALMAALKHELSQMLASSAKPLTLSEP-EVEGKKTPYVILMVG 243

Query: 119 VNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA 178
           VNGVGKTT IGKL+KK    G KVMLAAGDTFR+AA++QL++W +R     V  + GSD+
Sbjct: 244 VNGVGKTTTIGKLTKKFQAEGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVVAQQTGSDS 303

Query: 179 AALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD 238
           A++ ++A   A+AK  DV+I DTAGRL N S LM  + K++RV+K+LD +APH V+ VLD
Sbjct: 304 ASVIFDAIDSARAKGFDVVIADTAGRLQNKSNLMNELSKVVRVMKKLDDNAPHEVMLVLD 363

Query: 239 ATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDL 298
           A TGQNA+ Q ++F    G +G+ +TK+DGTA+GG +  I    +IP+ F+GVGE ++DL
Sbjct: 364 AGTGQNAISQAKLFSEAVGVSGITLTKLDGTAKGGIIFAIAKEFEIPIRFIGVGEQVDDL 423

Query: 299 EPFVAKDF 306
             F A  F
Sbjct: 424 RAFDADVF 431


>gi|315178771|gb|ADT85685.1| signal recognition particle GTPase [Vibrio furnissii NCTC 11218]
          Length = 403

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+   
Sbjct: 91  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTT 150

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K   + +     LY V  + + ++L  + +P   D S  P VIL+VGVNGV
Sbjct: 151 LKIIASLTEKSSRQQLRDGEALYGVLKDEMAEILSTVEQPLVIDSSKTPFVILMVGVNGV 210

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL+IW +R +   +    G+D+A++ 
Sbjct: 211 GKTTTIGKLAKQFQAEGKKVMLAAGDTFRAAAVEQLQIWGERNNVPVIAQHTGADSASVI 270

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 271 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 330

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI+DL PF 
Sbjct: 331 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEGIDDLRPFA 390

Query: 303 AKDF 306
            ++F
Sbjct: 391 TQEF 394


>gi|312884400|ref|ZP_07744105.1| cell division protein FtxY [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367922|gb|EFP95469.1| cell division protein FtxY [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 397

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 194/296 (65%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  A T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 93  SFFARLKRSLAKTKTNIGAGFFGLFKGKQIDDDLFEELEEQLLIADVGMDTTMKIIGSLT 152

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   +D+     LY +  + + +ML  + +P   +   +P VIL+VGVNGVGKTT IGK
Sbjct: 153 EKASRRDLKDGEALYGLLKDEMTEMLSTVEQPLVVNNEAKPFVILMVGVNGVGKTTTIGK 212

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 213 LAKQFQAEGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIESAK 272

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           AK VDV+I DTAGRL N + LM  + K++RV++++D  APH ++  LDA TGQNA+ Q +
Sbjct: 273 AKGVDVVIADTAGRLQNKANLMEELKKIVRVMQKVDSTAPHEIMLTLDAGTGQNAISQAK 332

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGEGI+DL PF +++F
Sbjct: 333 LFSEVAPLTGIALTKLDGTAKGGVIFSLADQFQIPIRYIGVGEGIDDLRPFESQEF 388


>gi|213967799|ref|ZP_03395946.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato T1]
 gi|301382436|ref|ZP_07230854.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato Max13]
 gi|302061172|ref|ZP_07252713.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato K40]
 gi|302132035|ref|ZP_07258025.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213927575|gb|EEB61123.1| signal recognition particle-docking protein FtsY [Pseudomonas
           syringae pv. tomato T1]
          Length = 513

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 189/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  + +  + +DD + EE+E  L+ +D+GV     I++ 
Sbjct: 205 VGFFARLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKS 264

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++  + LY  +   +  ML  + +P      H+P VILVVGVNG GKTT I
Sbjct: 265 LTQKVARKQLTDAQALYTSLQGELAAMLKLVEQPLVIKAEHKPFVILVVGVNGAGKTTTI 324

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 325 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQA 384

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 385 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 444

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 445 AKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 502


>gi|88797601|ref|ZP_01113190.1| signal recognition particle receptor FtsY [Reinekea sp. MED297]
 gi|88779773|gb|EAR10959.1| signal recognition particle receptor FtsY [Reinekea sp. MED297]
          Length = 330

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 200/310 (64%), Gaps = 5/310 (1%)

Query: 12  SWIRKLTKGFASTSLKLKEGI-TDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           SW +++  G + T      G+ T ++  + LDD   EELE LL+ SD+G+   Q I+++L
Sbjct: 24  SWFQRVKNGLSKTRSGFSNGLATALLGRKTLDDDTLEELETLLLSSDVGIEATQTILDDL 83

Query: 71  LTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           + +   K+++    L + + E + + L P+ +P   D   +P VILVVGVNGVGKTT IG
Sbjct: 84  VERTSRKELNDNNALMNALRETLVEQLTPVEQPLQIDTGKQPFVILVVGVNGVGKTTTIG 143

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K++++    G  VMLAAGDTFR+AA++QL+ W +R +   +    G+D+A++ ++A + A
Sbjct: 144 KMTQRFQSEGKSVMLAAGDTFRAAAVEQLQTWGERHNVPVIAQHTGADSASVIFDAVQAA 203

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +++ VDVLI DTAGRLHN   LMA + K++RV+K++D  APH VL VLDA TGQNA+ Q 
Sbjct: 204 KSRGVDVLIADTAGRLHNKDNLMAELEKVLRVMKKIDDSAPHEVLLVLDAGTGQNAVAQA 263

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F   A  TG+ +TK+DGTARGG +  +     IPV F+GVGE   DL+ F A++F   
Sbjct: 264 ESFTKAAPLTGIALTKLDGTARGGIIFALARKFGIPVRFIGVGEQAEDLDRFSAQEF--- 320

Query: 310 ITGCLDYGEE 319
           ++  LD  +E
Sbjct: 321 VSALLDSDDE 330


>gi|242241271|ref|YP_002989452.1| signal recognition particle-docking protein FtsY [Dickeya dadantii
           Ech703]
 gi|242133328|gb|ACS87630.1| signal recognition particle-docking protein FtsY [Dickeya dadantii
           Ech703]
          Length = 432

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 186/297 (62%), Gaps = 6/297 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI+E L  
Sbjct: 130 FFARLKRSLVKTRQNLGSGFVGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIERLTE 189

Query: 73  ---KRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
              ++  KD     +L  +   +  +L    +P   +    P VIL+VGVNGVGKTT IG
Sbjct: 190 HADRKQLKDADA--LLSLLKTEMSGILAKADEPLVIE-GKTPFVILMVGVNGVGKTTTIG 246

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A + A
Sbjct: 247 KLARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNVPVVAQHTGADSASVIFDAIQAA 306

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q 
Sbjct: 307 KARGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDDDAPHEVMLTLDASTGQNAVSQA 366

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            +F    G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI+DL PF A DF
Sbjct: 367 RLFDEAVGLTGIALTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIDDLRPFKADDF 423


>gi|260767577|ref|ZP_05876513.1| signal recognition particle receptor protein FtsY [Vibrio furnissii
           CIP 102972]
 gi|260617477|gb|EEX42660.1| signal recognition particle receptor protein FtsY [Vibrio furnissii
           CIP 102972]
          Length = 405

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+   
Sbjct: 93  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTT 152

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K   + +     LY V  + + ++L  + +P   D S  P VIL+VGVNGV
Sbjct: 153 LKIIASLTEKSSRQQLRDGEALYGVLKDEMAEILSTVEQPLVIDSSKTPFVILMVGVNGV 212

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL+IW +R +   +    G+D+A++ 
Sbjct: 213 GKTTTIGKLAKQFQAEGKKVMLAAGDTFRAAAVEQLQIWGERNNVPVIAQHTGADSASVI 272

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 273 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 332

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI+DL PF 
Sbjct: 333 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEGIDDLRPFA 392

Query: 303 AKDF 306
            ++F
Sbjct: 393 TQEF 396


>gi|229844636|ref|ZP_04464775.1| cell division protein FtsY [Haemophilus influenzae 6P18H1]
 gi|229812350|gb|EEP48040.1| cell division protein FtsY [Haemophilus influenzae 6P18H1]
          Length = 400

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P++KP   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMANILEPVAKPLVIDNTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K+ RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIARVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|226946816|ref|YP_002801889.1| signal recognition particle-docking protein FtsY [Azotobacter
           vinelandii DJ]
 gi|226721743|gb|ACO80914.1| signal recognition particle-docking protein FtsY [Azotobacter
           vinelandii DJ]
          Length = 451

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G A T   L EG+  + +  + +DD + EELE  L+ +D+GV     I++ L 
Sbjct: 145 FFARLRQGLAKTGSTLGEGMASLFLGEKAIDDELLEELETRLLLADVGVEATTAIIQSLT 204

Query: 72  TKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   K+++    LY  + E +  +L P+ +P   +   RP+VILVVGVNGVGKTT IGK
Sbjct: 205 QRVARKELADSEALYRALQEELAALLRPVEQPLVLESEQRPYVILVVGVNGVGKTTTIGK 264

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ ++   G KVMLAAGDTFR+AA++QL+IW +R     +    G+D+A++ ++A + A+
Sbjct: 265 LAARLQQEGRKVMLAAGDTFRAAAVEQLQIWGERNRIPVIAQHTGADSASVIFDALQAAK 324

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DVLI DTAGRLH    LM  + K+ RVL +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 325 ARGMDVLIADTAGRLHTKDNLMEELKKVRRVLGKLDEAAPHEVLLVLDAGTGQNAINQTK 384

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEG++DL  F A++F
Sbjct: 385 QFNQAVEITGLALTKLDGTAKGGVIFALARQFGLPIRYIGVGEGVDDLRDFAAEEF 440


>gi|229520064|ref|ZP_04409492.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           TM 11079-80]
 gi|229342852|gb|EEO07842.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           TM 11079-80]
          Length = 395

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 91  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 150

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 151 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLLIDTEKKPYVILMVGVNGVGKTTTIGK 210

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 211 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 270

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 271 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 330

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 331 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGENIDDLRPFATQEF 386


>gi|212637491|ref|YP_002314016.1| cell division transporter substrate-binding protein FtsY
           [Shewanella piezotolerans WP3]
 gi|212558975|gb|ACJ31429.1| Cell division transporter substrate-binding protein FtsY
           [Shewanella piezotolerans WP3]
          Length = 528

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 194/307 (63%), Gaps = 2/307 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +G   TS  +  G   I S +++DD + EELE+ L+ +D+GV    ++++ L  +  
Sbjct: 222 RLKRGLKRTSESIGSGFVGIFSGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQAS 281

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LYD+  + + K L P+S P   + +  P VIL+VGVNGVGKTT IGKL+K+
Sbjct: 282 RKQLKDGEALYDLMRDEMQKTLDPVSVPLIPENADGPFVILMVGVNGVGKTTTIGKLAKQ 341

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A+K 
Sbjct: 342 YQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVIAQHTGADSASVLFDALQAAKARKA 401

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N + LM  + K++RV+K+ D  APH V+  LDA+TGQNA+ Q ++F  
Sbjct: 402 DVLIADTAGRLQNKAHLMDELKKVVRVMKKQDESAPHEVMLTLDASTGQNAISQAQLFQE 461

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF-SAVITGC 313
             G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF  A+ +  
Sbjct: 462 AVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDFIEALFSQS 521

Query: 314 LDYGEEK 320
            D  E K
Sbjct: 522 KDDTETK 528


>gi|330812382|ref|YP_004356844.1| signal recognition particle receptor [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380490|gb|AEA71840.1| putative signal recognition particle receptor [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 477

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 189/298 (63%), Gaps = 2/298 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +G + TS  + EG+  +   ++ +DD + E++E  L+ +D+GV     I++ 
Sbjct: 169 VGFFARLKQGLSKTSASIGEGMASLFLGKKVIDDELLEDIETRLLTADVGVEATSVIIQS 228

Query: 70  LLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  K   K ++    LY  +   +  +L P+ KP      ++P VILVVGVNG GKTT I
Sbjct: 229 LTQKVARKQLTDADALYKSLQGELTSLLKPVEKPLVIASQNKPFVILVVGVNGAGKTTTI 288

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + 
Sbjct: 289 GKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADSASVIFDAVQA 348

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 349 AKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQ 408

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 409 AKQFNQTVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 466


>gi|170718906|ref|YP_001784077.1| signal recognition particle-docking protein FtsY [Haemophilus
           somnus 2336]
 gi|168827035|gb|ACA32406.1| signal recognition particle-docking protein FtsY [Haemophilus
           somnus 2336]
          Length = 447

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G   +   +++DD + EELE+ L+ +DIGV    KI+  L+ 
Sbjct: 144 FFSRLVKGLLKTKQNIGIGFRSLFLGKKIDDELFEELEEQLLIADIGVPTTTKIINNLIQ 203

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   ++ +  +L P+ +P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 204 HASRKQLQEADLLYQQLKVELADILKPVEQPLQLDNSKKPYVILMVGVNGVGKTTTIGKL 263

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + +    G  VMLAAGDTFR+AA++QL++W +R     +    GSD+A++ ++A + A A
Sbjct: 264 ANQFQRQGKSVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQSTGSDSASVIFDAMQSAAA 323

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LD+ TGQNA+ Q ++
Sbjct: 324 RNIDVLIADTAGRLQNKNNLMDELKKIVRVIKKCDETAPHEIMLTLDSGTGQNAISQAKL 383

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I+DL PF A +F
Sbjct: 384 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIDDLRPFQADEF 438


>gi|218681649|ref|ZP_03529450.1| cell division protein [Rhizobium etli CIAT 894]
          Length = 423

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 157/203 (77%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW ++L  G A TS +L   I  + + R+LDD   ++LEDLLI++D+GV  A ++ + L
Sbjct: 221 LSWFQRLRNGLARTSSQLTGQIAALFTKRKLDDETLQDLEDLLIQADLGVETALRVTDTL 280

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            ++RY KDV+ + V   ++  I K+L P++KP   D SH+PHVILVVGVNG GKTT IGK
Sbjct: 281 ASERYGKDVTGEDVSRIMASEIAKVLKPVAKPLQLDLSHKPHVILVVGVNGTGKTTTIGK 340

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K+S AGLKVMLAAGDTFR+AAI+QLKIWA+RT+++F+ +++G+DAA LAY+AF+QA+
Sbjct: 341 LAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTNSEFIGTKLGADAAGLAYDAFEQAK 400

Query: 191 AKKVDVLIIDTAGRLHNNSILMA 213
           A+K DVLI+DTAGRL N + LMA
Sbjct: 401 ARKCDVLIVDTAGRLQNKAELMA 423


>gi|251791621|ref|YP_003006342.1| signal recognition particle-docking protein FtsY [Dickeya zeae
           Ech1591]
 gi|247540242|gb|ACT08863.1| signal recognition particle-docking protein FtsY [Dickeya zeae
           Ech1591]
          Length = 452

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 190/299 (63%), Gaps = 10/299 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL- 71
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   +KI++ L  
Sbjct: 150 FFARLKRSLIKTRQNLGSGFVGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIDRLTE 209

Query: 72  --TKRYAKDVSVQRVLY--DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
             +++  KD      L   ++S+++ K+  PL+          P VIL+VGVNGVGKTT 
Sbjct: 210 HASRKQLKDAEALIALLKAEMSDILAKVDAPLAID-----GKTPFVILMVGVNGVGKTTT 264

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A +
Sbjct: 265 IGKLARQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVPVVAQHTGADSASVIFDALQ 324

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+A+ VDVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ 
Sbjct: 325 AAKARGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEEAPHEVMLTLDASTGQNAVS 384

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F+   G  G+ +TK+DGTA+GG +  I     IP+ ++GVGE I+DL PF A DF
Sbjct: 385 QAKLFNEAVGLNGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGESIDDLRPFKADDF 443


>gi|269961511|ref|ZP_06175874.1| signal recognition particle-docking protein FtsY [Vibrio harveyi
           1DA3]
 gi|269833740|gb|EEZ87836.1| signal recognition particle-docking protein FtsY [Vibrio harveyi
           1DA3]
          Length = 416

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 197/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++D+ + EELE+ L+ +D+G+   
Sbjct: 104 QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDEDLFEELEEQLLIADVGMNTT 163

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D +  P+VIL+VGVNGV
Sbjct: 164 TKIINNLTEKASRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDTNKTPYVILMVGVNGV 223

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 224 GKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 283

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 284 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 343

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF 
Sbjct: 344 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFE 403

Query: 303 AKDF 306
            ++F
Sbjct: 404 TQEF 407


>gi|114321806|ref|YP_743489.1| signal recognition particle-docking protein FtsY [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114228200|gb|ABI57999.1| signal recognition particle-docking protein FtsY [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 389

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 187/305 (61%), Gaps = 2/305 (0%)

Query: 16  KLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTK- 73
           +L  G + T   L EGI  + + S+ +DD + EELE  L+ +D+GV   Q+I++ L  + 
Sbjct: 82  RLRAGLSRTRSGLTEGIASLFLGSKTIDDDLLEELETQLLLADVGVEATQRIIDGLTARL 141

Query: 74  RYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSK 133
           R A+      +   + E +  +L P   P       +P VIL+VG+NG GKTT IGKL++
Sbjct: 142 RRAELKDTDALFQALKEDMTAILSPCEAPLELPNEPKPFVILMVGINGAGKTTTIGKLAR 201

Query: 134 KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193
           +  D G +VMLAAGDTFR+AA++QL+ W +R +   +    G+DAA++ ++ ++ A+A+ 
Sbjct: 202 RFGDQGKRVMLAAGDTFRAAAVEQLQAWGERNNTPVIAQHTGADAASVVFDGWQAAKARG 261

Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH 253
            DVLI DTAGRLH  S LM  + K+ RVL + DP APH  L VLDA  GQNAL Q   FH
Sbjct: 262 SDVLIADTAGRLHTQSNLMEELRKIKRVLGKQDPTAPHETLLVLDAGNGQNALAQAREFH 321

Query: 254 AVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGC 313
              G  G+++TK+DGTARGG +  I    ++P+ F+GVGE   DL PFVA DF   +   
Sbjct: 322 QAIGLDGVVITKLDGTARGGVIFAIAEQLRLPIRFIGVGESAEDLRPFVAADFVEALLQR 381

Query: 314 LDYGE 318
            D G+
Sbjct: 382 DDQGQ 386


>gi|170724571|ref|YP_001758597.1| signal recognition particle-docking protein FtsY [Shewanella woodyi
           ATCC 51908]
 gi|169809918|gb|ACA84502.1| signal recognition particle-docking protein FtsY [Shewanella woodyi
           ATCC 51908]
          Length = 491

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 187/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    +++  L  
Sbjct: 184 FFARLKRGLKRTSENIGSGFIGLFKGKKIDDDLFEELEEQLLIADVGVETTTRLISSLTE 243

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  E + K L P S P   + +  P VIL+VGVNGVGKTT IGKL
Sbjct: 244 QASRKQLKDGEALYELLREEMQKTLEPASIPLVPENADGPFVILMVGVNGVGKTTTIGKL 303

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A + A+A
Sbjct: 304 AKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVVAQHTGADSASVLFDALQAARA 363

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+ D +APH V+  LDA+TGQNA+ Q E+
Sbjct: 364 RNVDVLIADTAGRLQNKSHLMDELKKVVRVMKKQDENAPHEVMLTLDASTGQNAISQAEL 423

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF
Sbjct: 424 FKQAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDF 478


>gi|293391631|ref|ZP_06635965.1| cell division protein FtsY [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952165|gb|EFE02284.1| cell division protein FtsY [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 390

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI+  L  
Sbjct: 86  FFSRLLKGLVKTKQNIGAGFRSFFLGKKIDDDLFEELEEQLLIADIGVPTTSKIINNLTQ 145

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               + +     LY   +L + ++L P+++P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 146 HATRQQLQNADSLYQQLKLEMGEILKPVAQPLCIDGSKKPYVILMVGVNGVGKTTTIGKL 205

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 206 ARKFQMEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 265

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 266 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 325

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A++F
Sbjct: 326 FHEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEF 380


>gi|229515823|ref|ZP_04405281.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           TMA 21]
 gi|229347086|gb|EEO12047.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           TMA 21]
          Length = 391

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 87  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 146

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 147 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 206

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 207 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 266

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 267 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 326

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 327 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 382


>gi|148827958|ref|YP_001292711.1| cell division protein FtsY [Haemophilus influenzae PittGG]
 gi|148719200|gb|ABR00328.1| cell division protein FtsY [Haemophilus influenzae PittGG]
          Length = 400

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 190/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 96  FFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKIIKNLTE 155

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K++    +LY   ++ +  +L P+++P   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 156 HASRKELQDAELLYQQLKVEMADILEPVARPLEIDSTKKPYVILMVGVNGVGKTTTIGKL 215

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  V+LAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 216 ARKFQAEGKSVLLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 275

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 276 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKL 335

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    K+P+ ++GVGE I DL  F AK+F
Sbjct: 336 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREFNAKEF 390


>gi|153803614|ref|ZP_01958200.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           MZO-3]
 gi|124120853|gb|EAY39596.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           MZO-3]
          Length = 391

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 87  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 146

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 147 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 206

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 207 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 266

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 267 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 326

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 327 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 382


>gi|149191502|ref|ZP_01869751.1| cell division protein FtsY [Vibrio shilonii AK1]
 gi|148834690|gb|EDL51678.1| cell division protein FtsY [Vibrio shilonii AK1]
          Length = 414

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 194/304 (63%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   +   + +DD + EELE+ L+ +D+G+   
Sbjct: 102 QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKEIDDELFEELEEQLLIADVGMNTT 161

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI++ L  K    D+     LY +  E + ++L  + KP   D +  P VIL+VGVNGV
Sbjct: 162 VKIIDSLTEKASRADLKDGEALYGLLKEEMAEILSHVEKPLEVDSTKMPFVILMVGVNGV 221

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ 
Sbjct: 222 GKTTTIGKLAKQYQAQGKKVMLAAGDTFRAAAVEQLQVWGERNDVPVIAQHTGADSASVI 281

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 282 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDESAPHEIMLTLDAGTG 341

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  +    +IP+ ++GVGE I+DL PF 
Sbjct: 342 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFALADQFQIPIRYIGVGESIDDLRPFE 401

Query: 303 AKDF 306
            +DF
Sbjct: 402 TQDF 405


>gi|153830010|ref|ZP_01982677.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           623-39]
 gi|148874495|gb|EDL72630.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           623-39]
          Length = 385

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 81  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 140

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 141 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 200

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 201 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 260

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 261 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 320

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 321 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 376


>gi|327483045|gb|AEA77452.1| Signal recognition particle receptor protein FtsY [Vibrio cholerae
           LMA3894-4]
          Length = 390

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 86  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 145

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 146 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 205

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 206 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 265

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 266 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 325

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 326 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 381


>gi|297581816|ref|ZP_06943737.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           RC385]
 gi|297533910|gb|EFH72750.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           RC385]
          Length = 397

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 93  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 152

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 153 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 212

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 213 LAKQFQAQGEKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 272

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 273 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 332

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 333 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 388


>gi|157373360|ref|YP_001471960.1| signal recognition particle-docking protein FtsY [Shewanella
           sediminis HAW-EB3]
 gi|157315734|gb|ABV34832.1| signal recognition particle-docking protein FtsY [Shewanella
           sediminis HAW-EB3]
          Length = 540

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 189/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   TS  +  G   + S +++DD + EELE+ L+ +D+GV    ++++ L  
Sbjct: 232 FFARLKRGLKRTSENIGSGFVSLFSGKKIDDDLFEELEEQLLIADVGVETTTRLIDSLTE 291

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  + + K L P+S P   + +  P VIL+VGVNGVGKTT IGKL
Sbjct: 292 QASRKQLKDGEALYEILRDEMQKTLEPVSIPLVPESADGPFVILMVGVNGVGKTTTIGKL 351

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A + A+A
Sbjct: 352 AKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVVAQHTGADSASVLFDALQAARA 411

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K+IRV+K+ D  APH V+  LDA+TGQNA+ Q E+
Sbjct: 412 RNIDILIADTAGRLQNKAHLMDELKKVIRVMKKQDESAPHEVMLTLDASTGQNAISQAEL 471

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF
Sbjct: 472 FKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDF 526


>gi|291614826|ref|YP_003524983.1| signal recognition particle-docking protein FtsY [Sideroxydans
           lithotrophicus ES-1]
 gi|291584938|gb|ADE12596.1| signal recognition particle-docking protein FtsY [Sideroxydans
           lithotrophicus ES-1]
          Length = 315

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 201/319 (63%), Gaps = 18/319 (5%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           + N   ++ES SW+ +LT   A T  +L    + ++   ++DD + EELE +LI +D+G+
Sbjct: 5   LKNTPASAESKSWLSRLTGSLARTGGQLS---SLLVPGGKIDDELYEELETILITADVGM 61

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSEL-------IHKMLMPLSKPFNWDFSHRPHV 113
              + ++ ++  +R+ K+   QR L +  +L       + K+L PL+KP +   S RP V
Sbjct: 62  DATRSLLADV--RRHVKE---QR-LTEAGQLKEALAHALLKLLQPLAKPLDVGAS-RPFV 114

Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSE 173
           I++ GVNG GKTT IGKL+K   + G  V+LAAGDTFR+AA +QL  W  R     +  +
Sbjct: 115 IMLCGVNGAGKTTSIGKLAKHFQNQGKSVLLAAGDTFRAAAREQLMEWGRRNDVTVIAQQ 174

Query: 174 IGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSV 233
            G DAAA+ Y+A + AQA+ +DV++ DTAGRL   + LM  I K+ RV+ +  P APH V
Sbjct: 175 SG-DAAAVIYDAVQAAQARGIDVVLADTAGRLTTQAHLMEEIKKVKRVIAKALPGAPHEV 233

Query: 234 LQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGE 293
           L VLDA TGQNAL QV+ F      TGL++TK+DGTA+GG +  I   H IPV F+GVGE
Sbjct: 234 LLVLDANTGQNALSQVKSFDDALQVTGLVLTKLDGTAKGGVIAAIAKAHPIPVRFIGVGE 293

Query: 294 GINDLEPFVAKDFSAVITG 312
            ++DL PFVA+DF A + G
Sbjct: 294 ALDDLRPFVAEDFVAALLG 312


>gi|190571642|ref|YP_001976000.1| signal recognition particle protein FtsY [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019044|ref|ZP_03334851.1| signal recognition particle protein FtsY [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|190357914|emb|CAQ55375.1| signal recognition particle protein FtsY [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995153|gb|EEB55794.1| signal recognition particle protein FtsY [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 303

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/304 (42%), Positives = 192/304 (63%), Gaps = 3/304 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +S    L +G   TS +   G+ +I S  ++LD  + ++LE+LLI  DIG   ++ ++++
Sbjct: 1   MSLFSNLYQGLLKTSSRFSGGVKNIFSGKKKLDQSLLDDLEELLISMDIGHKTSRLLIDK 60

Query: 70  LLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           L + ++  +V    +   +   I  +L P+ +P     + +PH+I+V GVNG GKTT IG
Sbjct: 61  LASIKFESEVEHSVITQQLMSEIESILNPVVQPL--ILNKKPHIIMVCGVNGNGKTTTIG 118

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+ K  + G  VML A DTFR+AA +QL IWA+R+    V  E GSD+A++AY A  QA
Sbjct: 119 KLAYKYKEKGKSVMLVACDTFRAAASEQLNIWAERSDCSIVTGEHGSDSASVAYRAVNQA 178

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
               VDV++IDTAGRL NN  LM  + K+ R +K+LD  APH V+ VLDATTGQNA  Q+
Sbjct: 179 IKDSVDVVLIDTAGRLQNNVNLMQELSKIHRTIKKLDDTAPHDVILVLDATTGQNAYSQL 238

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F  + G TGLI+TK+DGTA+GG +I +   +K+ ++ +G+GE I DL  F  K+F+  
Sbjct: 239 EAFSKMVGVTGLIVTKLDGTAKGGVVIGLAEAYKVKLHAIGIGESIEDLREFTGKEFAEA 298

Query: 310 ITGC 313
           +  C
Sbjct: 299 LFKC 302


>gi|254291953|ref|ZP_04962734.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           AM-19226]
 gi|150422163|gb|EDN14129.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           AM-19226]
          Length = 389

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 85  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 144

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 145 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLLIDTEKKPYVILMVGVNGVGKTTTIGK 204

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 205 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 264

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 265 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 324

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 325 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 380


>gi|325577122|ref|ZP_08147606.1| cell division protein FtsY [Haemophilus parainfluenzae ATCC 33392]
 gi|325160704|gb|EGC72825.1| cell division protein FtsY [Haemophilus parainfluenzae ATCC 33392]
          Length = 485

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI++ L  
Sbjct: 180 FFSRLVKGLLKTKQNIGAGFRAFFLGKKIDDDLFEELEEQLLIADIGVPTTNKIIKNLTE 239

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   ++ + ++L P++KP   D + +P+VIL+VGVNGVGKTT IGKL
Sbjct: 240 HASRKQLQDAELLYQQLKVEMVEILKPVAKPLVIDTTKKPYVILMVGVNGVGKTTTIGKL 299

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K  + G  VMLAAGDTFR+AA++QL++W +R +   V    GSD+A++ ++A + A A
Sbjct: 300 ARKFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQSTGSDSASVIFDAMQSAAA 359

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+++ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 360 RNIDILIADTAGRLQNKNNLMDELKKIVRVMRKYDETAPHEIMLTLDAGTGQNAISQAKL 419

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A++F
Sbjct: 420 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEF 474


>gi|251793357|ref|YP_003008085.1| cell division protein FtsY [Aggregatibacter aphrophilus NJ8700]
 gi|247534752|gb|ACS97998.1| cell division protein FtsY [Aggregatibacter aphrophilus NJ8700]
          Length = 495

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI+  L  
Sbjct: 191 FFSRLLKGLVKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTTKIINNLTQ 250

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               + +     LY   +L + ++L P+++P   D S +P+VIL+VGVNGVGKTT IGK+
Sbjct: 251 HATRQQLQNADTLYQQLKLEMGQILKPVAQPLRIDGSKKPYVILMVGVNGVGKTTTIGKV 310

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V   IGSD+A++ ++A + A A
Sbjct: 311 ARKFQMEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSIGSDSASVIFDAMQSAAA 370

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 371 RNIDVLIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 430

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A++F
Sbjct: 431 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEF 485


>gi|237728779|ref|ZP_04559260.1| cell division protein FtsY [Citrobacter sp. 30_2]
 gi|226909401|gb|EEH95319.1| cell division protein FtsY [Citrobacter sp. 30_2]
          Length = 508

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 206 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 265

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N D    P VIL+VGVNGVGKTT IGKL
Sbjct: 266 GASRKQLKDAEALYGLLKEEMGEILAKVDEPLNVD-GKTPFVILMVGVNGVGKTTTIGKL 324

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 325 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 384

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 385 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEVMLTIDASTGQNAISQAKL 444

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 445 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 499


>gi|113460560|ref|YP_718624.1| signal recognition particle-docking protein FtsY [Haemophilus
           somnus 129PT]
 gi|112822603|gb|ABI24692.1| signal recognition particle-docking protein FtsY [Haemophilus
           somnus 129PT]
          Length = 447

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G   +   +++DD + EELE+ L+ +DIGV    KI+  L+ 
Sbjct: 144 FFSRLVKGLLKTKQNIGIGFRSLFLGKKIDDELFEELEEQLLIADIGVPTTTKIINNLIQ 203

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    +LY   ++ +  +L P+ +P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 204 HASRKQLQEADLLYQQLKVELADILKPVEQPLQLDNSKKPYVILMVGVNGVGKTTTIGKL 263

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + +    G  VMLAAGDTFR+AA++QL++W +R     +    GSD+A++ ++A + A A
Sbjct: 264 ANQFQRQGKSVMLAAGDTFRAAAVEQLQVWGERNQIPVIAQSTGSDSASVIFDAMQSAVA 323

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LD+ TGQNA+ Q ++
Sbjct: 324 RNIDVLIADTAGRLQNKNNLMDELKKIVRVIKKCDETAPHEIMLTLDSGTGQNAISQAKL 383

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I+DL PF A +F
Sbjct: 384 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIDDLRPFQADEF 438


>gi|261210150|ref|ZP_05924447.1| signal recognition particle receptor protein FtsY [Vibrio sp.
           RC341]
 gi|260840690|gb|EEX67239.1| signal recognition particle receptor protein FtsY [Vibrio sp.
           RC341]
          Length = 388

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 84  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDELFEELEEQLLIADVGMDTTTKIITNLT 143

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 144 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 203

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 204 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 263

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 264 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 323

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 324 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 379


>gi|153874953|ref|ZP_02002963.1| signal recognition particle-docking protein FtsY [Beggiatoa sp. PS]
 gi|152068583|gb|EDN67037.1| signal recognition particle-docking protein FtsY [Beggiatoa sp. PS]
          Length = 328

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 194/302 (64%), Gaps = 3/302 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKI 66
           S+   W+ +L +G + T   L   ++D++  +R +DD + EE+E LL+ +D+GV   Q +
Sbjct: 20  SKKSGWLDRLKQGLSRTREVLTTDLSDLLQVKRAIDDELLEEIETLLLTADVGVEATQAL 79

Query: 67  VEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNW-DFSHRPHVILVVGVNGVGK 124
           + +L  +   K ++    L+D + E +  +L P+ +P    D S++P VIL+VGVNG GK
Sbjct: 80  MTDLTQRVNKKQLNDSEALFDALREKMQAILQPVEQPLILPDKSNKPFVILMVGVNGAGK 139

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+K+    G  VMLAAGDTFR+AA++QLK+W +R     +     +D+A++ ++
Sbjct: 140 TTTIGKLAKRFQAQGHSVMLAAGDTFRAAAVEQLKVWGERNEVPVIAQHDRADSASVIFD 199

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
           A + A A+ +DVLI DTAGRLH  S LM  + K+ RV+K+LD  APH  L V+DA  GQN
Sbjct: 200 ALQAATARGIDVLIADTAGRLHTQSNLMEELKKVQRVMKKLDDTAPHESLLVIDAGIGQN 259

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A+ Q E FH   G TGL +TK+DGTA+GG +  +     +P+ F+GVGE I+DL PF A 
Sbjct: 260 AIVQAEQFHQAIGLTGLTLTKLDGTAKGGIMFAVAKRIGLPIRFIGVGEKIDDLRPFEAA 319

Query: 305 DF 306
           +F
Sbjct: 320 NF 321


>gi|254230125|ref|ZP_04923521.1| signal recognition particle-docking protein FtsY, putative [Vibrio
           sp. Ex25]
 gi|262392912|ref|YP_003284766.1| signal recognition particle receptor protein FtsY [Vibrio sp. Ex25]
 gi|151937370|gb|EDN56232.1| signal recognition particle-docking protein FtsY, putative [Vibrio
           sp. Ex25]
 gi|262336506|gb|ACY50301.1| signal recognition particle receptor protein FtsY [Vibrio sp. Ex25]
          Length = 407

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++D+ + EELE+ L+ +D+G+   
Sbjct: 95  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDEDLFEELEEQLLIADVGMNTT 154

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D +  P+VIL+VGVNGV
Sbjct: 155 TKIINNLTEKATRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDSNKTPYVILMVGVNGV 214

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 215 GKTTTIGKLAKQFQTQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 274

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 275 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 334

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 335 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFE 394

Query: 303 AKDF 306
            ++F
Sbjct: 395 TQEF 398


>gi|259910113|ref|YP_002650469.1| Cell division protein [Erwinia pyrifoliae Ep1/96]
 gi|224965735|emb|CAX57267.1| Cell division protein [Erwinia pyrifoliae Ep1/96]
 gi|283480210|emb|CAY76126.1| Cell division protein ftsY homolog [Erwinia pyrifoliae DSM 12163]
          Length = 488

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 191/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I+  L  
Sbjct: 186 FFARLKRSLVKTRTNLGSGFISLFRGKKIDDELFEELEEQLLIADVGVETTRRIIGNLTN 245

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     D++E++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 246 QASRKQLRDAEALYGLLKTDMAEILAKVEAPL------DISGKTPFVILMVGVNGVGKTT 299

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A 
Sbjct: 300 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVIFDAI 359

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N + LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 360 QAAKARHVDVLIADTAGRLQNKAHLMEELKKITRVMKKLDDSAPHEVMLTIDASTGQNAI 419

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI+DL PF A DF
Sbjct: 420 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADLFTIPIRYIGVGEGIDDLRPFKADDF 479


>gi|310765701|gb|ADP10651.1| Cell division protein [Erwinia sp. Ejp617]
          Length = 492

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 191/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I+  L  
Sbjct: 190 FFARLKRSLVKTRTNLGSGFISLFRGKKIDDELFEELEEQLLIADVGVETTRRIIGNLTN 249

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     D++E++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 250 QASRKQLRDAEALYGLLKTDMAEILAKVESPL------DISGKMPFVILMVGVNGVGKTT 303

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R +   V    G+D+A++ ++A 
Sbjct: 304 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVIFDAI 363

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N + LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 364 QAAKARHVDVLIADTAGRLQNKAHLMEELKKITRVMKKLDDSAPHEVMLTIDASTGQNAI 423

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI+DL PF A DF
Sbjct: 424 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADLFTIPIRYIGVGEGIDDLRPFKADDF 483


>gi|152998323|ref|YP_001343158.1| signal recognition particle-docking protein FtsY [Marinomonas sp.
           MWYL1]
 gi|150839247|gb|ABR73223.1| signal recognition particle-docking protein FtsY [Marinomonas sp.
           MWYL1]
          Length = 413

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 200/306 (65%), Gaps = 16/306 (5%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISS-RRLDDGVREELEDLLIRSDIGVAVAQKIVE 68
           +LSW ++   G + T   L  G++ +I   +++DD + EELE  L+ +D+G+   Q ++ 
Sbjct: 107 ALSWSQRFKLGLSRTRSGLGNGLSSVIGGHKKVDDNLLEELETQLLMADVGIDATQTLIS 166

Query: 69  EL---LTKRYAKDVS--VQRVLYDVSELI---HKMLMPLSKPFNWDFSHRPHVILVVGVN 120
            L   L ++  KD +  +  +  D++ ++    +ML P+SK         P VIL+VGVN
Sbjct: 167 ALTDKLNRKELKDSATLLSHLKADMNGILSQSQQMLEPVSK-------DGPFVILMVGVN 219

Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA 180
           GVGKTT IGKL+KK    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A+
Sbjct: 220 GVGKTTTIGKLAKKYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSAS 279

Query: 181 LAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT 240
           + Y+A + A+AK VD++I DTAGRL N + LM  + K++RV+K+LD +APH V+ VLDA 
Sbjct: 280 VIYDAIESAKAKGVDIVIADTAGRLQNKANLMNELSKVVRVMKKLDENAPHEVMLVLDAG 339

Query: 241 TGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEP 300
           TGQNA+ Q ++F    G +G+ +TK+DGTA+GG +  I     IP+ ++GVGE  +DL P
Sbjct: 340 TGQNAISQAKLFSEAVGVSGITLTKLDGTAKGGIIFAIAKQFGIPIRYIGVGEQADDLRP 399

Query: 301 FVAKDF 306
           FVA++F
Sbjct: 400 FVAQEF 405


>gi|315635037|ref|ZP_07890318.1| cell division protein FtsY [Aggregatibacter segnis ATCC 33393]
 gi|315476299|gb|EFU67050.1| cell division protein FtsY [Aggregatibacter segnis ATCC 33393]
          Length = 518

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI+  L  
Sbjct: 214 FFSRLLKGLVKTKQNIGAGFRSFFLGKKIDDELFEELEEQLLIADIGVPTTTKIINNLTQ 273

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               + +     LY   +L + ++L P+++P   D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 274 HATRQQLQNADTLYQQLKLEMGEILKPVAQPLRIDGSKKPYVILMVGVNGVGKTTTIGKL 333

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 334 ARKFQMEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 393

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 394 RNIDVLIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 453

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A++F
Sbjct: 454 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEF 508


>gi|229508897|ref|ZP_04398387.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           B33]
 gi|229606695|ref|YP_002877343.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           MJ-1236]
 gi|227011852|gb|ACP08062.1| cell division protein FtsY [Vibrio cholerae O395]
 gi|229354014|gb|EEO18947.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           B33]
 gi|229369350|gb|ACQ59773.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           MJ-1236]
          Length = 389

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 85  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 144

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 145 ARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 204

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 205 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 264

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 265 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 324

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 325 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 380


>gi|121587716|ref|ZP_01677477.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           2740-80]
 gi|121548015|gb|EAX58093.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           2740-80]
          Length = 395

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 91  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 150

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 151 ARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 210

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 211 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 270

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 271 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 330

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 331 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 386


>gi|15640178|ref|NP_229805.1| cell division protein FtsY [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|229517011|ref|ZP_04406457.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           RC9]
 gi|255743904|ref|ZP_05417859.1| signal recognition particle receptor protein FtsY [Vibrio cholera
           CIRS 101]
 gi|9654548|gb|AAF93324.1| cell division protein FtsY [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|229346074|gb|EEO11046.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           RC9]
 gi|255738387|gb|EET93777.1| signal recognition particle receptor protein FtsY [Vibrio cholera
           CIRS 101]
          Length = 391

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 87  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 146

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 147 ARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 206

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 207 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 266

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 267 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 326

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 327 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 382


>gi|227080382|ref|YP_002808933.1| cell division protein FtsY [Vibrio cholerae M66-2]
 gi|254851533|ref|ZP_05240883.1| cell division protein FtsY [Vibrio cholerae MO10]
 gi|262151142|ref|ZP_06028281.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           INDRE 91/1]
 gi|262167011|ref|ZP_06034728.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           RC27]
 gi|298501091|ref|ZP_07010891.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           MAK 757]
 gi|227008270|gb|ACP04482.1| cell division protein FtsY [Vibrio cholerae M66-2]
 gi|254847238|gb|EET25652.1| cell division protein FtsY [Vibrio cholerae MO10]
 gi|262024529|gb|EEY43213.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           RC27]
 gi|262031036|gb|EEY49661.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           INDRE 91/1]
 gi|297540125|gb|EFH76186.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           MAK 757]
          Length = 393

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 89  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 148

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 149 ARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 208

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 209 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 268

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 269 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 328

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 329 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 384


>gi|147673157|ref|YP_001218274.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           O395]
 gi|229508422|ref|ZP_04397926.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           BX 330286]
 gi|146315040|gb|ABQ19579.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           O395]
 gi|229354695|gb|EEO19617.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           BX 330286]
          Length = 387

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 83  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 142

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 143 ARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 202

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 203 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 262

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 263 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 322

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 323 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 378


>gi|121728299|ref|ZP_01681330.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           V52]
 gi|121629429|gb|EAX61858.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           V52]
          Length = 397

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 93  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 152

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            +   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 153 ARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 212

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 213 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 272

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 273 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 332

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 333 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 388


>gi|269968645|ref|ZP_06182642.1| signal recognition particle-docking protein FtsY [Vibrio
           alginolyticus 40B]
 gi|269826732|gb|EEZ81069.1| signal recognition particle-docking protein FtsY [Vibrio
           alginolyticus 40B]
          Length = 408

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 4   QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVA 63
           Q+    + S+  +L +  + T   +  G   + S +++D+ + EELE+ L+ +D+G+   
Sbjct: 96  QEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDEDLFEELEEQLLIADVGMNTT 155

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
            KI+  L  K    D+     LY +  E + ++L  + +P   D +  P+VIL+VGVNGV
Sbjct: 156 TKIINNLTEKATRGDLKDGEALYGLLKEEMAEILSKVEQPLEIDSNKTPYVILMVGVNGV 215

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ 
Sbjct: 216 GKTTTIGKLAKQFQTQGKKVMLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVI 275

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A+ VDV+I DTAGRL N + LM  + K++RV+K++D  APH ++  LDA TG
Sbjct: 276 YDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTG 335

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F  VA  TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF 
Sbjct: 336 QNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFE 395

Query: 303 AKDF 306
            ++F
Sbjct: 396 TQEF 399


>gi|238755241|ref|ZP_04616586.1| Cell division protein ftsY [Yersinia ruckeri ATCC 29473]
 gi|238706582|gb|EEP98954.1| Cell division protein ftsY [Yersinia ruckeri ATCC 29473]
          Length = 528

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 226 FFARLKRSLLKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIIASLTE 285

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +     +P+VIL+VGVNGVGKTT IGKL
Sbjct: 286 HASRKQLKDAEALYGKLKEEMSEILAKVDKPLDVS-GKKPYVILMVGVNGVGKTTTIGKL 344

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 345 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 404

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 405 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 464

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 465 FNETVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 519


>gi|258622824|ref|ZP_05717841.1| signal recognition particle-docking protein FtsY [Vibrio mimicus
           VM573]
 gi|258584885|gb|EEW09617.1| signal recognition particle-docking protein FtsY [Vibrio mimicus
           VM573]
          Length = 398

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 94  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDELFEELEEQLLIADVGMDTTTKIITNLT 153

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   +   +P+VIL+VGVNGVGKTT IGK
Sbjct: 154 AKASRQQLRDGEALYGLLKEEMAEILAQVEQPLVIEADKKPYVILMVGVNGVGKTTTIGK 213

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 214 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 273

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 274 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 333

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 334 LFSEVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 389


>gi|285018841|ref|YP_003376552.1| cell division protein [Xanthomonas albilineans GPE PC73]
 gi|283474059|emb|CBA16560.1| hypothetical cell division protein [Xanthomonas albilineans]
          Length = 421

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 176/272 (64%), Gaps = 9/272 (3%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELL----TKRYAKDVSVQRVLY-DVSELIHK 94
           +LDD + + +E  LI +D+G+     ++E+L      + +A   ++QR L  D+  ++H 
Sbjct: 143 KLDDDLLDAIETALITADVGIPATTALIEQLRKRMKAREFADATALQRALRADLLAILH- 201

Query: 95  MLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA 154
              P++KP   D + +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA
Sbjct: 202 ---PVAKPLQIDPNAKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGHSLMLAAGDTFRAAA 258

Query: 155 IDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAG 214
           + QL+IW +R     +     +DAA++A++A +  +A+  D+LI DTAGRLH  + LM  
Sbjct: 259 VAQLQIWGERNGVSVIAQGQNADAASVAFDALQAGKARGTDILIADTAGRLHTQTGLMNE 318

Query: 215 IGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGG 274
           +GK+ RV+ +LD  APH VL V+D TTGQNAL Q+  FHA  G TGL++TK+DGTA+GG 
Sbjct: 319 LGKIRRVIGKLDASAPHEVLMVIDGTTGQNALSQLRQFHAAVGVTGLVVTKLDGTAKGGV 378

Query: 275 LIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +  +     IP+ F G+GE   DL  F A+ F
Sbjct: 379 VFALAREFGIPIRFAGIGERPEDLRVFDAEAF 410


>gi|262172903|ref|ZP_06040581.1| signal recognition particle receptor protein FtsY [Vibrio mimicus
           MB-451]
 gi|261893979|gb|EEY39965.1| signal recognition particle receptor protein FtsY [Vibrio mimicus
           MB-451]
          Length = 392

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 88  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDELFEELEEQLLIADVGMDTTTKIITNLT 147

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   +   +P+VIL+VGVNGVGKTT IGK
Sbjct: 148 AKASRQQLRDGEALYGLLKEEMAEILAQVEQPLVIETDKKPYVILMVGVNGVGKTTTIGK 207

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 208 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 267

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 268 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 327

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 328 LFSEVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 383


>gi|291284804|ref|YP_003501622.1| Cell division protein FtsY [Escherichia coli O55:H7 str. CB9615]
 gi|290764677|gb|ADD58638.1| Cell division protein FtsY [Escherichia coli O55:H7 str. CB9615]
          Length = 498

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + +ML  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEMLAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|153826285|ref|ZP_01978952.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           MZO-2]
 gi|149739953|gb|EDM54132.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           MZO-2]
          Length = 395

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 91  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 150

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 151 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 210

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 211 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 270

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 271 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 330

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DG+A+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 331 LFSDVAPITGITLTKLDGSAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 386


>gi|78043121|ref|YP_360274.1| signal recognition particle-docking protein FtsY [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995236|gb|ABB14135.1| signal recognition particle-docking protein FtsY [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 303

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 132/297 (44%), Positives = 191/297 (64%), Gaps = 2/297 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           + +  +L +    T   +   I D+     +D+ + E+LE++LI  D+GV  + ++VE+L
Sbjct: 1   MGFFDRLKESLIKTKQNIVAKIEDVFKKSTVDEELFEKLEEILIEGDVGVKPSLELVEKL 60

Query: 71  L-TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             T R  +    +++   + E I K+L         +    P VILVVGVNGVGKTT IG
Sbjct: 61  RKTARERRITDSEQLKQVLKEEILKILEAGDNKLK-NVPRTPLVILVVGVNGVGKTTTIG 119

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+      G +V+LAAGDTFR+AAI+QL+IW ++     +  + GSD AA+A++A K A
Sbjct: 120 KLAYYFKQQGKQVLLAAGDTFRAAAIEQLEIWGNKVGCPVIKQKEGSDPAAVAFDAVKAA 179

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
            A+K+DVLIIDTAGRLH  + LM  + K+ RV++R  P AP  VL VLDATTGQNAL QV
Sbjct: 180 IARKIDVLIIDTAGRLHTKTNLMEELRKVKRVIERELPGAPDEVLLVLDATTGQNALSQV 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           E F+     TGL++TK+DGTA+GG +I I  +++IP+ F+GVGE ++DL PF  ++F
Sbjct: 240 EYFNKALDLTGLVLTKLDGTAKGGVIIGIKSSYQIPIKFIGVGEKMDDLRPFDPQEF 296


>gi|304397880|ref|ZP_07379756.1| signal recognition particle-docking protein FtsY [Pantoea sp. aB]
 gi|304354591|gb|EFM18962.1| signal recognition particle-docking protein FtsY [Pantoea sp. aB]
          Length = 566

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 184/295 (62%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + +ELE+ L+ +D+GV   ++I+  L  
Sbjct: 264 FFARLKRSLVKTRQNLGSGFISLFRGKKIDDDLFDELEEQLLIADVGVDTTRRIITHLTQ 323

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY + +  +  +L  +  P        P VIL+VGVNGVGKTT IGKL
Sbjct: 324 QANRKQLRDAEALYGLLKAEMASILANVDAPLEVS-GKTPFVILMVGVNGVGKTTTIGKL 382

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A++
Sbjct: 383 ARQYQAEGKTVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKS 442

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K+ RV+K+LD  APH V+  LDA+TGQNA+ Q  +
Sbjct: 443 RGVDVLIADTAGRLQNKSHLMEELKKITRVMKKLDDSAPHEVMLTLDASTGQNAVSQARL 502

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A+DF
Sbjct: 503 FNEAVGVTGIALTKLDGTAKGGVIFSVADQFGIPIRYIGVGEGIEDLRPFKAEDF 557


>gi|262404882|ref|ZP_06081436.1| signal recognition particle receptor protein FtsY [Vibrio sp.
           RC586]
 gi|262348966|gb|EEY98105.1| signal recognition particle receptor protein FtsY [Vibrio sp.
           RC586]
          Length = 399

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 95  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDELFEELEEQLLIADVGMDTTTKIIANLT 154

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   +   +P+VIL+VGVNGVGKTT IGK
Sbjct: 155 AKASRQQLRDGEALYGLLKEEMAEILAQVEQPLVIETDKKPYVILMVGVNGVGKTTTIGK 214

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 215 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 274

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 275 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 334

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 335 LFSEVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 390


>gi|262163696|ref|ZP_06031437.1| signal recognition particle receptor protein FtsY [Vibrio mimicus
           VM223]
 gi|262027912|gb|EEY46576.1| signal recognition particle receptor protein FtsY [Vibrio mimicus
           VM223]
          Length = 390

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 86  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDELFEELEEQLLIADVGMDTTTKIITNLT 145

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   +   +P+VIL+VGVNGVGKTT IGK
Sbjct: 146 AKASRQQLRDGEALYGLLKEEMAEILAQVEQPLVIETDKKPYVILMVGVNGVGKTTTIGK 205

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 206 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 265

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 266 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 325

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 326 LFSEVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 381


>gi|254226613|ref|ZP_04920194.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           V51]
 gi|125620885|gb|EAZ49238.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           V51]
          Length = 393

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 89  SFFARLKRSLSRTKANIGVGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 148

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   +P+VIL+VGVNGVGKTT IGK
Sbjct: 149 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKPYVILMVGVNGVGKTTTIGK 208

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 209 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 268

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 269 ARGMDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 328

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 329 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 384


>gi|152978128|ref|YP_001343757.1| signal recognition particle-docking protein FtsY [Actinobacillus
           succinogenes 130Z]
 gi|150839851|gb|ABR73822.1| signal recognition particle-docking protein FtsY [Actinobacillus
           succinogenes 130Z]
          Length = 504

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 191/298 (64%), Gaps = 7/298 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV---EE 69
           +  +L KG   T   +  G     S +++DD + EELE+ L+ +DIGV    KI+   E+
Sbjct: 200 FFSRLLKGLVKTKQNIGAGFRSFFSGKKIDDELFEELEEQLLIADIGVPTTSKIITNLEQ 259

Query: 70  LLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
             T++  KD  +   LY  + + + ++L P+++P   D S +P+VIL+VGVNGVGKTT I
Sbjct: 260 HATRQQLKDADL---LYQQLKQEMAEILKPVARPLVIDGSKKPYVILMVGVNGVGKTTTI 316

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+++    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + 
Sbjct: 317 GKLARQFQQQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQS 376

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A A+ +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q
Sbjct: 377 ASARNIDILIADTAGRLQNKNNLMDELKKIVRVIKKYDESAPHEIMLTLDAGTGQNAVSQ 436

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             +F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A +F
Sbjct: 437 ARLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLRTFDADEF 494


>gi|188535387|ref|YP_001909184.1| Cell division protein [Erwinia tasmaniensis Et1/99]
 gi|188030429|emb|CAO98323.1| Cell division protein [Erwinia tasmaniensis Et1/99]
          Length = 494

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 191/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I+  L T
Sbjct: 192 FFARLKRSLVKTRTNLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVDTTRRIIGNLTT 251

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     D++E++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 252 QASRKQLRDAEALYGLLKTDMAEILAKVESPL------DVSGKTPFVILMVGVNGVGKTT 305

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ ++A 
Sbjct: 306 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVVAQHTGADSASVIFDAI 365

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N S LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 366 QAAKARHVDVLIADTAGRLQNKSHLMEELKKITRVMKKLDDSAPHEVMLTIDASTGQNAI 425

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL  F A DF
Sbjct: 426 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFTIPIRYIGVGEGIEDLRSFKADDF 485


>gi|258514470|ref|YP_003190692.1| signal recognition particle-docking protein FtsY [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778175|gb|ACV62069.1| signal recognition particle-docking protein FtsY [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 312

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 196/305 (64%), Gaps = 12/305 (3%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +    T     E I  +++ RR +D+G  EELE++LI +DIG+  A +IVE 
Sbjct: 1   MGFFSRLKESLTKTRKNFVEKIETLVTRRRAIDEGFYEELEEILIGADIGINTAVEIVEN 60

Query: 70  L---LTKRYAKDV-SVQRVLYDVSELIHKMLMP--LSKPFNWDFSHRPHVILVVGVNGVG 123
           L   + KR   DV +++ VL    ELI  +L     S   N +      VILVVGVNGVG
Sbjct: 61  LRAEVKKRKIDDVETLKEVL---KELICNILGEGGASTALNIN-EDGLTVILVVGVNGVG 116

Query: 124 KTTVIGKLSKKMSDA-GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           KTT IGKL+    +  G KV+LAAGDTFR+AAIDQL+IW++R   + +  + G+D AA+A
Sbjct: 117 KTTTIGKLAYYFKEELGKKVLLAAGDTFRAAAIDQLEIWSNRVGVEMIKHKEGADPAAVA 176

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A+A++ DVLI+DTAGRLH  S LM  + K+ RV+ +  P AP  +L VLDATTG
Sbjct: 177 YDAIQAARARRSDVLIVDTAGRLHTKSNLMDELKKIKRVINKDMPEAPQEILLVLDATTG 236

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNA+ Q ++F   A  TG+ +TK+DGTA+GG +I I    KIPV  +G+GEGI DL PF 
Sbjct: 237 QNAVSQAKLFGEAADVTGIALTKLDGTAKGGVVISIKNALKIPVKLIGIGEGIEDLRPFE 296

Query: 303 AKDFS 307
            + F+
Sbjct: 297 PEVFA 301


>gi|89092453|ref|ZP_01165407.1| signal recognition particle receptor FtsY [Oceanospirillum sp.
           MED92]
 gi|89083541|gb|EAR62759.1| signal recognition particle receptor FtsY [Oceanospirillum sp.
           MED92]
          Length = 458

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 191/301 (63%), Gaps = 2/301 (0%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66
            E   +  ++  G + T   L E + ++ + ++ +D+ + EE+E LL+ +D+GV    +I
Sbjct: 152 EEKKGFFARIKSGLSKTKANLTEQLGNLFLGAKEIDEDLLEEIETLLLMADVGVEATTEI 211

Query: 67  VEELLTKRYAKDV-SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           +  L  K   K +   Q +   + E +  +L    +P N     +P+VIL+VGVNGVGKT
Sbjct: 212 IGRLTDKVERKQLGDAQALQVALKEELAGLLHRSEEPLNIQCEKKPYVILMVGVNGVGKT 271

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+K+    G  VMLAAGDTFR+AA++QL++W +R +   V    G+D+A++ Y+A
Sbjct: 272 TTIGKLAKRFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVVAQHTGADSASVIYDA 331

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + AQAK VDVLI DTAGRL N   LM  + K++RV K+L P APH V+ VLDA TGQNA
Sbjct: 332 VQSAQAKGVDVLIADTAGRLQNKDNLMQELEKVVRVTKKLSPEAPHEVMLVLDAGTGQNA 391

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q ++F    G TG+ +TK+DGTA+GG +  I     +P+ F+GVGE I+DL PF +++
Sbjct: 392 LSQAKIFKDSVGVTGISLTKLDGTAKGGVIFAIAKQMDLPIRFIGVGEQIDDLRPFKSQE 451

Query: 306 F 306
           F
Sbjct: 452 F 452


>gi|217077937|ref|YP_002335655.1| signal recognition particle-docking protein FtsY [Thermosipho
           africanus TCF52B]
 gi|217037792|gb|ACJ76314.1| signal recognition particle-docking protein FtsY [Thermosipho
           africanus TCF52B]
          Length = 294

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 195/308 (63%), Gaps = 20/308 (6%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKI---V 67
           + +  K  +G   T       +  I+S ++LDD  +EE+E+LLI SD+G    + I   +
Sbjct: 1   MGFFEKFKQGLKKTRESFFGKMKSILSGKKLDDETKEEIEELLILSDVGFEATEYILNRI 60

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDF--SHRPHVILVVGVNGVGKT 125
           EEL  +             D  E + K+L+ +   FN +     +P VI +VGVNG GKT
Sbjct: 61  EELKGE-------------DAYESLKKVLLEILN-FNSELKIEKKPFVISMVGVNGSGKT 106

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T  GKL++  S +G  V+LAA DTFR+AAIDQLK+WA+RTS+ F+  + G+D+AA+A++A
Sbjct: 107 TTAGKLAEYFSKSGKSVVLAACDTFRAAAIDQLKVWAERTSSTFIAHQEGADSAAVAFDA 166

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
              A +K+ D++I+DTAGRLH    LM  + K+ RV+K+    APH VL V+DA TGQN 
Sbjct: 167 VSHAISKEKDIVILDTAGRLHTKKNLMEELRKINRVIKKKIEDAPHEVLLVIDAVTGQNG 226

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L+Q ++F      TG+++TK+DGTA+GG  I I     IP+ F+G+GEG++DL+PF A+D
Sbjct: 227 LQQAKIFKEFVDITGIVLTKLDGTAKGGIAIAIAKELGIPIKFVGLGEGVDDLKPFDAED 286

Query: 306 F-SAVITG 312
           F +A++ G
Sbjct: 287 FVNALLEG 294


>gi|289668668|ref|ZP_06489743.1| cell division protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 551

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ V  Q +   +   +  +L P
Sbjct: 273 KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLIALLQP 332

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 333 VSKPLVIDRSVKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 392

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 393 QAWGDRNGVSVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 452

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 453 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 512

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 513 AREFNIPIRFAGIGERPEDLRVF 535


>gi|289661713|ref|ZP_06483294.1| cell division protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 551

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ V  Q +   +   +  +L P
Sbjct: 273 KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLIALLQP 332

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 333 VSKPLVIDRSVKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 392

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 393 QAWGDRNGVSVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 452

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 453 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 512

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 513 AREFNIPIRFAGIGERPEDLRVF 535


>gi|90415299|ref|ZP_01223233.1| signal recognition particle receptor FtsY [marine gamma
           proteobacterium HTCC2207]
 gi|90332622|gb|EAS47792.1| signal recognition particle receptor FtsY [marine gamma
           proteobacterium HTCC2207]
          Length = 354

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 204/306 (66%), Gaps = 14/306 (4%)

Query: 16  KLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKR 74
           K+ +  + TS     G+ D+ + ++ +DD + EELE LL+ +D+G+    +I+ +L T+R
Sbjct: 57  KMQRALSRTS----RGLGDLFLGAKVIDDDLFEELETLLLMADVGIDATSQIIAQL-TER 111

Query: 75  YAKDV-----SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
             + +     ++Q  L D+  LI + L P  +  + + +  P V+LVVGVNGVGKTT IG
Sbjct: 112 SNRAMLKDGAALQAALRDI--LIAR-LTPCEQTLHTENAEGPFVMLVVGVNGVGKTTTIG 168

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           K+++++   G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A
Sbjct: 169 KMARQLQQQGQSVMLAAGDTFRAAAVEQLQVWGERNQIPVVAQHTGADSASVVFDAVESA 228

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +AK +DV+I DTAGRLHN S LM  + K+ RV  +LD  APH VL VLDA TGQNA+ Q+
Sbjct: 229 RAKNIDVIIADTAGRLHNKSNLMEELKKVRRVAAKLDATAPHEVLLVLDAGTGQNAVAQM 288

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
             FHA AG TG+++TK+DGTA+GG +  +     +P+ ++GVGEG++DL+PFVA+ F + 
Sbjct: 289 TEFHATAGVTGIVLTKLDGTAKGGVIFALAEKFSVPIRYIGVGEGVDDLQPFVAEQFVSA 348

Query: 310 ITGCLD 315
           + G  D
Sbjct: 349 LLGQGD 354


>gi|229593151|ref|YP_002875270.1| cell division protein [Pseudomonas fluorescens SBW25]
 gi|229365017|emb|CAY53174.1| cell division protein [Pseudomonas fluorescens SBW25]
          Length = 469

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 188/303 (62%), Gaps = 3/303 (0%)

Query: 6   VASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQ 64
           V +    +  +L +G + TS  + EG+  +   ++ +DD + E++E  L+ +D+GV    
Sbjct: 157 VETSKAGFFSRLKQGLSKTSASIGEGMASLFLGKKVIDDELLEDIETRLLTADVGVEATA 216

Query: 65  KIVEELLTKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVG 123
            I++ L  K   K ++    LY  +   +  ML P+  P       +P VILVVGVNG G
Sbjct: 217 VIIQSLTQKVARKQLTDADALYKSLQAELAAMLKPVEAPLVIT-PKKPFVILVVGVNGAG 275

Query: 124 KTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY 183
           KTT IGKL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ +
Sbjct: 276 KTTTIGKLAKKLQSEGKKVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADSASVIF 335

Query: 184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ 243
           +A + A+A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQ
Sbjct: 336 DAVQAAKARNIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQ 395

Query: 244 NALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVA 303
           NA+ Q + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A
Sbjct: 396 NAISQAKQFNQTVQLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEA 455

Query: 304 KDF 306
           + F
Sbjct: 456 EPF 458


>gi|261866873|ref|YP_003254795.1| cell division protein FtsY [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412205|gb|ACX81576.1| cell division protein FtsY [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 453

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L KG   T   +  G       +++DD + EELE+ L+ +DIGV    KI+  L  
Sbjct: 148 FFSRLLKGLVKTKQNIGAGFRSFFLGKKIDDDLFEELEEQLLIADIGVPTTTKIINNLTQ 207

Query: 73  KRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               + +     LY   +L + ++L P+++P + D S +P+VIL+VGVNGVGKTT IGKL
Sbjct: 208 HATRQQLQNADSLYQQLKLEMGEILKPVAQPLHIDGSKKPYVILMVGVNGVGKTTTIGKL 267

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           ++K    G  VMLAAGDTFR+AA++QL++W +R     V    GSD+A++ ++A + A A
Sbjct: 268 ARKFQMEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAA 327

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +D+LI DTAGRL N + LM  + K++RV+K+ D  APH ++  LDA TGQNA+ Q ++
Sbjct: 328 RNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKL 387

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     +P+ ++GVGE I DL  F A++F
Sbjct: 388 FNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEF 442


>gi|312174145|emb|CBX82398.1| Cell division protein ftsY homolog [Erwinia amylovora ATCC
           BAA-2158]
          Length = 512

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 189/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I+  L  
Sbjct: 210 FFARLKRSLVKTRTNLGSGFISLFRGKKIDDELFEELEEQLLIADVGVETTRRIIGNLTN 269

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     D++E++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 270 QASRKQLRDAEALYGLLKTDMAEILAKVEAPL------DISGKTPFVILMVGVNGVGKTT 323

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A 
Sbjct: 324 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNHIPVVAQHTGADSASVIFDAI 383

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N + LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 384 QAAKARHVDVLIADTAGRLQNKAHLMEELKKITRVMKKLDDSAPHEVMLTIDASTGQNAI 443

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A DF
Sbjct: 444 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFTIPIRYIGVGEGIEDLRPFKADDF 503


>gi|150025489|ref|YP_001296315.1| cell division protein FtsY [Flavobacterium psychrophilum JIP02/86]
 gi|149772030|emb|CAL43506.1| Cell division protein FtsY [Flavobacterium psychrophilum JIP02/86]
          Length = 317

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 188/302 (62%), Gaps = 19/302 (6%)

Query: 10  SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           S S++ KLTK  A  S              ++DD V + LE++L+ SD+GV    KI++ 
Sbjct: 24  SNSFLSKLTKAIAGKS--------------KVDDDVLDNLEEILVSSDVGVNTTLKIIQR 69

Query: 70  LLTK----RYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGK 124
           +  +    +Y     + ++L + ++ L+ +     +  F      +P+VI+VVGVNGVGK
Sbjct: 70  IEARVSNNKYLGTDELNKILREEIAGLLSETNTGEATKFEIPAHKKPYVIMVVGVNGVGK 129

Query: 125 TTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYE 184
           TT IGKL+ +   +G  V+L AGDTFR+AAIDQL+IWADR     V  ++GSD A++A++
Sbjct: 130 TTTIGKLANQFKKSGYSVVLGAGDTFRAAAIDQLQIWADRVGVPIVRQQMGSDPASVAFD 189

Query: 185 AFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN 244
             + A A+  DV+IIDTAGRLHN   LM  + K+ RV++++ P APH V+ VLD +TGQN
Sbjct: 190 TLQSAVAQNADVVIIDTAGRLHNKIGLMNELTKIKRVMEKVIPEAPHDVMLVLDGSTGQN 249

Query: 245 ALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAK 304
           A  Q + F A    T L +TK+DGTA+GG +I I    +IPV ++GVGEGINDL+ F   
Sbjct: 250 AFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGINDLQVFNKY 309

Query: 305 DF 306
           +F
Sbjct: 310 EF 311


>gi|323702683|ref|ZP_08114344.1| signal recognition particle-docking protein FtsY [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532346|gb|EGB22224.1| signal recognition particle-docking protein FtsY [Desulfotomaculum
           nigrificans DSM 574]
          Length = 309

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/305 (44%), Positives = 193/305 (63%), Gaps = 3/305 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +  A T     E I  + + R+ +D+ + E+LE++LI++D+GV  A  +VE 
Sbjct: 1   MGFFSRLKESLAKTRETFVEKIDQVFTGRKGIDEELYEDLEEVLIQADVGVQTAMTLVER 60

Query: 70  LLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           +     A++V     L D+  E +  ++     P N +    P VI+VVGVNGVGKTT I
Sbjct: 61  VRKGVKARNVQDPARLKDIFQEELEYLMGDKISPINTN-PDGPTVIMVVGVNGVGKTTTI 119

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GK++    + G KV+LAAGDTFR+AAIDQL+IWADR   D +  + G+D  A+AY+A   
Sbjct: 120 GKMAHNYKEQGKKVLLAAGDTFRAAAIDQLEIWADRVGVDIIKHQEGADPGAVAYDAVHA 179

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+++K DVL+IDTAGRLHN   LM  + K+ R++ R  P APH VL VLDATTGQNAL Q
Sbjct: 180 ARSRKADVLLIDTAGRLHNKGHLMEELRKVHRIIAREMPGAPHEVLLVLDATTGQNALSQ 239

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
            ++F      TG+ +TK+DGTA+GG +  IV    IPV  +G+GE ++DL PF  KDF A
Sbjct: 240 AKIFSEAVNVTGIALTKLDGTAKGGVITAIVTEMAIPVKLIGIGERMDDLRPFNPKDFIA 299

Query: 309 VITGC 313
            + G 
Sbjct: 300 ALYGL 304


>gi|300718827|ref|YP_003743630.1| cell division protein [Erwinia billingiae Eb661]
 gi|299064663|emb|CAX61783.1| Cell division protein [Erwinia billingiae Eb661]
          Length = 521

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 191/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I++ L  
Sbjct: 219 FFARLKRSLVKTRQNLGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTRRIIKNLTQ 278

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     ++SE++ K+  PL      D + + P VIL+VGVNGVGKTT
Sbjct: 279 QANRKQLRDAEALYGLLKQEMSEILAKVEEPL------DVTGKTPFVILMVGVNGVGKTT 332

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R +   +  + GSD+A++ ++A 
Sbjct: 333 TIGKLARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQQTGSDSASVIFDAI 392

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N S LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 393 QAAKARNVDVLIADTAGRLQNKSHLMEELKKITRVMKKLDDQAPHEVMLTIDASTGQNAI 452

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL  F A DF
Sbjct: 453 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFSIPIRYIGVGEGIEDLRAFKADDF 512


>gi|292489957|ref|YP_003532849.1| cell division protein FtsY [Erwinia amylovora CFBP1430]
 gi|291555396|emb|CBA23808.1| Cell division protein ftsY homolog [Erwinia amylovora CFBP1430]
          Length = 494

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 189/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I+  L  
Sbjct: 192 FFARLKRSLVKTRTNLGSGFISLFRGKKIDDELFEELEEQLLIADVGVETTRRIIGNLTN 251

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     D++E++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 252 QASRKQLRDAEALYGLLKTDMAEILAKVEAPL------DISGKTPFVILMVGVNGVGKTT 305

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A 
Sbjct: 306 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNHIPVVAQHTGADSASVIFDAI 365

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N + LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 366 QAAKARHVDVLIADTAGRLQNKAHLMEELKKITRVMKKLDDSAPHEVMLTIDASTGQNAI 425

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A DF
Sbjct: 426 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFTIPIRYIGVGEGIEDLRPFKADDF 485


>gi|292900987|ref|YP_003540356.1| cell division protein [Erwinia amylovora ATCC 49946]
 gi|291200835|emb|CBJ47969.1| cell division protein [Erwinia amylovora ATCC 49946]
          Length = 496

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 189/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   ++I+  L  
Sbjct: 194 FFARLKRSLVKTRTNLGSGFISLFRGKKIDDELFEELEEQLLIADVGVETTRRIIGNLTN 253

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
           +   K +     LY     D++E++ K+  PL      D S + P VIL+VGVNGVGKTT
Sbjct: 254 QASRKQLRDAEALYGLLKTDMAEILAKVEAPL------DISGKTPFVILMVGVNGVGKTT 307

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W  R     V    G+D+A++ ++A 
Sbjct: 308 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNHIPVVAQHTGADSASVIFDAI 367

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVLI DTAGRL N + LM  + K+ RV+K+LD  APH V+  +DA+TGQNA+
Sbjct: 368 QAAKARHVDVLIADTAGRLQNKAHLMEELKKITRVMKKLDDSAPHEVMLTIDASTGQNAI 427

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGEGI DL PF A DF
Sbjct: 428 SQTKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFTIPIRYIGVGEGIEDLRPFKADDF 487


>gi|270264287|ref|ZP_06192554.1| hypothetical protein SOD_g02240 [Serratia odorifera 4Rx13]
 gi|270041936|gb|EFA15033.1| hypothetical protein SOD_g02240 [Serratia odorifera 4Rx13]
          Length = 525

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 188/299 (62%), Gaps = 10/299 (3%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV    KI+  L  
Sbjct: 223 FFARLKRSLVKTKQNLGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTSKIITSLTQ 282

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
               K +     LY     ++SE++ K+  PL           P+VIL+VGVNGVGKTT 
Sbjct: 283 HASRKQLKDAEALYGKLKEEMSEILTKVEQPLDV-----GGKNPYVILMVGVNGVGKTTT 337

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ Y+A +
Sbjct: 338 IGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVVAQHTGADSASVIYDAVQ 397

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
            A+A+ +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ 
Sbjct: 398 AAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDDQAPHEVMLTLDASTGQNAVS 457

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           Q ++F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A DF
Sbjct: 458 QAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADDF 516


>gi|332159847|ref|YP_004296424.1| cell division protein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318607607|emb|CBY29105.1| signal recognition particle receptor protein FtsY (=alpha subunit)
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664077|gb|ADZ40721.1| cell division protein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 481

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 179 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 238

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P VIL+VGVNGVGKTT IGKL
Sbjct: 239 HASRKQLKDAEALYGKLKEEMSEILSKVDKPLDVS-GKNPFVILMVGVNGVGKTTTIGKL 297

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W DR     V    G+D+A++ ++A + A+A
Sbjct: 298 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNKIAVVAQHTGADSASVIFDAIQAAKA 357

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 358 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 417

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 418 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 472


>gi|312963639|ref|ZP_07778120.1| signal recognition particle-docking protein FtsY [Pseudomonas
           fluorescens WH6]
 gi|311282148|gb|EFQ60748.1| signal recognition particle-docking protein FtsY [Pseudomonas
           fluorescens WH6]
          Length = 463

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 187/296 (63%), Gaps = 3/296 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   ++ +DD + E++E  L+ +D+GV     I++ L 
Sbjct: 158 FFARLKQGLSKTSASIGEGMASLFLGKKVIDDELLEDIETRLLTADVGVEATAVIIQSLT 217

Query: 72  TKRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   K ++    LY  +   +  ML P+  P      ++P VILVVGVNG GKTT IGK
Sbjct: 218 QKVARKQLTDADALYKSLQAELAAMLKPVEAPLVIT-PNKPFVILVVGVNGAGKTTTIGK 276

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+
Sbjct: 277 LAKKLQGEGKKVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADSASVIFDAVQAAK 336

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q +
Sbjct: 337 ARNIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAISQAK 396

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A+ F
Sbjct: 397 QFNQTVQLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPF 452


>gi|283835857|ref|ZP_06355598.1| cell division protein FtsY [Citrobacter youngae ATCC 29220]
 gi|291068030|gb|EFE06139.1| cell division protein FtsY [Citrobacter youngae ATCC 29220]
          Length = 494

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 192 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 251

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 252 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 310

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R S   +    G+D+A++ ++A + A+A
Sbjct: 311 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNSIPVIAQHTGADSASVIFDAIQAAKA 370

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 371 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEVMLTIDASTGQNAISQAKL 430

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 431 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 485


>gi|313901969|ref|ZP_07835385.1| signal recognition particle-docking protein FtsY [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467758|gb|EFR63256.1| signal recognition particle-docking protein FtsY [Thermaerobacter
           subterraneus DSM 13965]
          Length = 311

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 135/294 (45%), Positives = 183/294 (62%), Gaps = 2/294 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           KL  G A T  +L   I  ++    LD+ + EELE +LI +D+GVA  Q+++E L  +  
Sbjct: 5   KLKAGLARTREQLAGRIRAVVQGAALDEALFEELEAVLITADVGVATTQRLLERLRERVR 64

Query: 76  AKDV-SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPH-VILVVGVNGVGKTTVIGKLSK 133
           A+ V     V   ++E +  ML  ++ P           VILVVGVNG GKTT +GKL+ 
Sbjct: 65  AEGVRDAAAVPGLLAEEMRGMLEAVAAPPAAPGRGPGPLVILVVGVNGSGKTTTVGKLAA 124

Query: 134 KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193
           +    G KV++ A DTFR+AAIDQL+ W  R  AD V    G+D AA+A++A + AQA+ 
Sbjct: 125 RYRQEGWKVVVGAADTFRAAAIDQLERWCQRAGADLVRQHPGADPAAVAFDALQAAQARG 184

Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH 253
            DVL++DTAGRLH    LM  + K  RVL+RLDP APH VL VLDATTGQNAL Q   F 
Sbjct: 185 ADVLLVDTAGRLHTRVNLMEELRKTQRVLQRLDPTAPHEVLLVLDATTGQNALAQARHFT 244

Query: 254 AVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
              G TG+++TK+DGTARGG ++ I    ++PV ++G GEG +DL PF   +F+
Sbjct: 245 EAVGVTGIVLTKLDGTARGGMVVAIADQLRLPVKWVGTGEGADDLAPFDPGEFT 298


>gi|311696381|gb|ADP99254.1| signal recognition particle-docking protein FtsY [marine bacterium
           HP15]
          Length = 397

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 197/301 (65%), Gaps = 8/301 (2%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIIS-SRRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +S   ++ KG   T   L  G++D+ S  +++D+ + EE+E  L+ +D+GV    +I++ 
Sbjct: 93  VSVFERIKKGLGKTRASLTGGLSDMFSLGKKIDEELLEEIETTLLMADVGVTATSEIIDS 152

Query: 70  L---LTKRYAKD-VSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125
           L   L +   KD  ++++ L D    +H +L  ++KP   D    P+VIL+VGVNGVGKT
Sbjct: 153 LTDKLERNQLKDGEALRKALRDE---LHGLLKDVTKPLQIDSGKTPYVILMVGVNGVGKT 209

Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
           T IGKL+KK  + G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A
Sbjct: 210 TTIGKLTKKFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNKVPVVAQHTGADSASVIFDA 269

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            + A+++ VDV+I DTAGRL N   LM  + K++RV+K+LD  APH V+ VLDA TGQNA
Sbjct: 270 IQSAKSRGVDVVIADTAGRLQNKDNLMQELEKVVRVMKKLDESAPHEVMLVLDAGTGQNA 329

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           L Q ++F    G +G+ +TK+DGTA+GG +  I    ++P+ F+GVGE ++DL  F A+ 
Sbjct: 330 LSQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRFIGVGEQVDDLRSFDAET 389

Query: 306 F 306
           F
Sbjct: 390 F 390


>gi|123440617|ref|YP_001004611.1| cell division protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087578|emb|CAL10359.1| cell division protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 507

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 205 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 264

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P VIL+VGVNGVGKTT IGKL
Sbjct: 265 HASRKQLKDAEALYGKLKEEMSEILSKVDKPLDVS-GKNPFVILMVGVNGVGKTTTIGKL 323

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W DR     V    G+D+A++ ++A + A+A
Sbjct: 324 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNKIAVVAQHTGADSASVIFDAIQAAKA 383

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 384 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 443

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 444 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 498


>gi|73667502|ref|YP_303518.1| signal recognition particle-docking protein FtsY [Ehrlichia canis
           str. Jake]
 gi|72394643|gb|AAZ68920.1| signal recognition particle-docking protein FtsY [Ehrlichia canis
           str. Jake]
          Length = 310

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 130/304 (42%), Positives = 200/304 (65%), Gaps = 7/304 (2%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISS-RRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           ++  + KG   TS KL +GI  I SS +++D    EEL++LLI +D+G   A  + ++L 
Sbjct: 9   FLNNIKKGLFKTSSKLSDGIKKIFSSEKKIDQETLEELKELLITADVGYENASLLTQKLA 68

Query: 72  TKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
             ++  +V    V   ++E I  +L+ + KP +   +++PHVI++ G NG GKTT IGKL
Sbjct: 69  EIKF-NEVDYSIVKQKLAESIEDILLQVEKPLS--INNKPHVIMICGTNGNGKTTTIGKL 125

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + K  + G KV++AA DTFR+AA +QL +W+ + +   V    G+DAA++AY+A +QA  
Sbjct: 126 AHKFKNEGKKVLVAACDTFRAAATEQLIVWSQKVNFPVVTGNQGADAASIAYQAMQQALN 185

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
            +VDVL+IDTAGRLHN+  LM  + K+ R++ + D +APH+V+ +LDATTGQNA+ QVE 
Sbjct: 186 DQVDVLLIDTAGRLHNHKNLMEELAKIKRIIGKHDNNAPHNVILILDATTGQNAIHQVEA 245

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F      +GLIMTK+DGTA+GG +I I   +K+ ++ +G+GE +  L+ F AK+F+    
Sbjct: 246 FSQFVNISGLIMTKLDGTAKGGVVIKIAQKYKLSIHAIGIGEHVEQLQDFSAKEFA---I 302

Query: 312 GCLD 315
           G LD
Sbjct: 303 GLLD 306


>gi|253997119|ref|YP_003049183.1| signal recognition particle-docking protein FtsY [Methylotenera
           mobilis JLW8]
 gi|253983798|gb|ACT48656.1| signal recognition particle-docking protein FtsY [Methylotenera
           mobilis JLW8]
          Length = 336

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 188/298 (63%), Gaps = 5/298 (1%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           LSW  +L +G A T  +L   +  I    ++D  V EELE +L+ SD+G+   Q +++++
Sbjct: 35  LSWTARLKQGLAKTRNQLGNQLASIFGGGKIDAEVYEELETILLTSDVGINATQHLLDDI 94

Query: 71  --LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
               KR + D +VQ +   + + +  +L PL +P      H+P +I++ GVNG GKTT I
Sbjct: 95  KGRVKRQSLDDTVQ-LKAALKDALSDLLSPLEQPLATS-KHQPFIIMLAGVNGAGKTTTI 152

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+K+    G  V++AAGDTFR+AA +QL++W +R +   V ++   D AA+ ++A   
Sbjct: 153 GKLAKQFQSEGKSVLIAAGDTFRAAAREQLQVWGERNNV-HVVAQTSGDPAAVMFDAINS 211

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+AK +D+++ DTAGRL     LM  I K+ RV+ +  P APH VL VLDA TGQNA+ Q
Sbjct: 212 ARAKNIDIVLADTAGRLPTQMHLMDEIAKVKRVMDKALPGAPHEVLLVLDANTGQNAVSQ 271

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           V++F    G TGL+++K+DGTA+GG +  I     IP+ ++G+GE I+DL PF A +F
Sbjct: 272 VKIFDDALGVTGLVLSKLDGTAKGGVIAAIAQARPIPIRYIGIGEAIDDLRPFNANEF 329


>gi|254243472|ref|ZP_04936794.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           2192]
 gi|126196850|gb|EAZ60913.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           2192]
          Length = 362

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 56  FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 114

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 115 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 174

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 175 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 234

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 235 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 294

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 295 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 351


>gi|301329789|ref|ZP_07222524.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 78-1]
 gi|300844138|gb|EFK71898.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 78-1]
          Length = 497

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  +++P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVNEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|323944312|gb|EGB40387.1| signal recognition particle-docking protein FtsY [Escherichia coli
           H120]
          Length = 515

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 213 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 272

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 273 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 331

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 332 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 391

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 392 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 451

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 452 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 506


>gi|188577553|ref|YP_001914482.1| signal recognition particle-docking protein FtsY [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|188522005|gb|ACD59950.1| signal recognition particle-docking protein FtsY [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 311

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ V  Q +   +   +  +L P
Sbjct: 33  KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLIALLQP 92

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D + +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 93  VSKPLVIDRARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 152

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 153 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 212

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 213 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 272

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 273 AREFNIPIRFAGIGERPEDLRVF 295


>gi|256025812|ref|ZP_05439677.1| cell division protein FtsY [Escherichia sp. 4_1_40B]
 gi|301645907|ref|ZP_07245821.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 146-1]
 gi|307140147|ref|ZP_07499503.1| cell division protein FtsY [Escherichia coli H736]
 gi|331644164|ref|ZP_08345293.1| cell division protein FtsY [Escherichia coli H736]
 gi|301075896|gb|EFK90702.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 146-1]
 gi|315614733|gb|EFU95373.1| signal recognition particle-docking protein FtsY [Escherichia coli
           3431]
 gi|331036458|gb|EGI08684.1| cell division protein FtsY [Escherichia coli H736]
          Length = 497

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGQLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|331659760|ref|ZP_08360698.1| cell division protein FtsY [Escherichia coli TA206]
 gi|331052975|gb|EGI25008.1| cell division protein FtsY [Escherichia coli TA206]
          Length = 498

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|298528315|ref|ZP_07015719.1| signal recognition particle-docking protein FtsY
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511967|gb|EFI35869.1| signal recognition particle-docking protein FtsY
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 435

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/301 (43%), Positives = 188/301 (62%), Gaps = 9/301 (2%)

Query: 16  KLTKGFASTSLKLKEGITDIISSR-RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKR 74
           KL+ G + T  +L   I  ++SS    D+   EELE++LI SD+G   A ++V++L T  
Sbjct: 140 KLSHGLSKTKAQLSRQIDQLLSSSTSFDEAFWEELEEILIMSDVGHKAATELVQKLRT-- 197

Query: 75  YAKDVSVQRV--LYDVSELIHKMLMPL-SKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
              +VS Q V    +  +L+ K L     +P        P VIL++GVNGVGKTT I KL
Sbjct: 198 ---EVSGQSVDDPQEFKQLLGKELAAFFPRPQKRIKPDPPEVILMIGVNGVGKTTTIAKL 254

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           + +    G +VM+AAGDTFR+AAI+QL IWA+R  A+F     G+D A++AYEA  +A A
Sbjct: 255 AHRDRMKGRRVMIAAGDTFRAAAIEQLGIWAERADAEFYAKSHGADPASVAYEALDKAVA 314

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           +  DVL +DTAGRLH  S LM  + KM  V+++  P +PH  + VLDATTGQNA+ Q E+
Sbjct: 315 EGTDVLYVDTAGRLHTKSDLMQELKKMKSVMQKKRPGSPHRTILVLDATTGQNAMSQTEL 374

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT 311
           F        +I+TK+DGTA+GG ++ I + H+IP+ F+G+GE + DL PF  + F+  + 
Sbjct: 375 FAREINIDEIILTKLDGTAKGGVMVAIALQHQIPITFIGLGEKMEDLRPFEPESFARALL 434

Query: 312 G 312
           G
Sbjct: 435 G 435


>gi|157158382|ref|YP_001464929.1| cell division protein FtsY [Escherichia coli E24377A]
 gi|218697147|ref|YP_002404814.1| cell division protein FtsY [Escherichia coli 55989]
 gi|157080412|gb|ABV20120.1| cell division protein FtsY [Escherichia coli E24377A]
 gi|218353879|emb|CAV00274.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           coli 55989]
 gi|323182929|gb|EFZ68330.1| signal recognition particle-docking protein FtsY [Escherichia coli
           1357]
          Length = 497

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|258625089|ref|ZP_05720008.1| signal recognition particle-docking protein FtsY [Vibrio mimicus
           VM603]
 gi|258582640|gb|EEW07470.1| signal recognition particle-docking protein FtsY [Vibrio mimicus
           VM603]
          Length = 400

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L  
Sbjct: 97  FFARLKRSLSRTKANIGAGFFGLFKGKKIDDELFEELEEQLLIADVGMDTTTKIITNLTA 156

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           K   + +     LY +  E + ++L  + +P   +   +P+VIL+VGVNGVGKTT IGKL
Sbjct: 157 KASRQQLRDGEALYGLLKEEMAEILAQVEQPLVIETDKKPYVILMVGVNGVGKTTTIGKL 216

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+A
Sbjct: 217 AKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAKA 276

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q ++
Sbjct: 277 RGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKL 336

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 337 FSEVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 391


>gi|209920923|ref|YP_002295007.1| cell division protein FtsY [Escherichia coli SE11]
 gi|209914182|dbj|BAG79256.1| ABC transporter permease component [Escherichia coli SE11]
 gi|324018641|gb|EGB87860.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 117-3]
          Length = 498

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|15893128|ref|NP_360842.1| cell division protein ftsY [Rickettsia conorii str. Malish 7]
 gi|81527868|sp|Q92GB8|FTSY_RICCN RecName: Full=Cell division protein ftsY homolog
 gi|15620335|gb|AAL03743.1| cell division protein ftsY [Rickettsia conorii str. Malish 7]
          Length = 303

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 193/303 (63%), Gaps = 3/303 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +S   KL +  + TS K+ EGI  I   ++LD G  EELE+LLI SD+ V V   I+EE 
Sbjct: 2   ISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAGTLEELEELLISSDMSVLVVTNIIEEF 61

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              ++ K++    V   +++LI + L   + PF     ++ +VILV GVNG GKTT IGK
Sbjct: 62  KKVKFDKEIDSDTVKEALAKLIEQQLSKSAIPFTLS-ENKLNVILVCGVNGAGKTTTIGK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+   S  G KV +AA DTFR+AA++QL  WADR +A  +  E  +D A++AY   +++ 
Sbjct: 121 LASMYSAQGKKVAVAACDTFRAAAVNQLSTWADRANALLITGEESADPASVAYRGMEESI 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP-HSVLQVLDATTGQNALRQV 249
            + +D+L IDTAGRLHN   LM  + K+++V+K+LD +AP HSVL V+DA TGQN   QV
Sbjct: 181 KQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSVL-VIDAITGQNTYNQV 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F+     TGLI+TK+DG+A+ G ++ +V    +P+YF+G+GE I DL+ F   DF+  
Sbjct: 240 EHFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGIGEKIEDLKIFNQHDFARN 299

Query: 310 ITG 312
           + G
Sbjct: 300 LVG 302


>gi|323188945|gb|EFZ74229.1| signal recognition particle-docking protein FtsY [Escherichia coli
           RN587/1]
          Length = 498

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|320194034|gb|EFW68667.1| cell division protein FtsY [Escherichia coli WV_060327]
          Length = 498

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|325925082|ref|ZP_08186502.1| cell division protein FtsY (SRP receptor) [Xanthomonas perforans
           91-118]
 gi|325544498|gb|EGD15861.1| cell division protein FtsY (SRP receptor) [Xanthomonas perforans
           91-118]
          Length = 551

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 173/264 (65%), Gaps = 3/264 (1%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV--SELIHKMLM 97
           +LDD + +E+E  LI +D+G+     +++ L  +  +++    + L+    ++LI  +L 
Sbjct: 273 KLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQALFKALRADLIA-LLQ 331

Query: 98  PLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ 157
           P+SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ Q
Sbjct: 332 PVSKPLVIDRSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQ 391

Query: 158 LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGK 217
           L+ W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK
Sbjct: 392 LQAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGK 451

Query: 218 MIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIP 277
           + RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  
Sbjct: 452 IRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVLTKLDGTAKGGVVFA 511

Query: 278 IVVTHKIPVYFLGVGEGINDLEPF 301
           +     IP+ F G+GE   DL  F
Sbjct: 512 LAREFNIPIRFAGIGERPEDLRVF 535


>gi|238763644|ref|ZP_04624604.1| Cell division protein ftsY [Yersinia kristensenii ATCC 33638]
 gi|238698122|gb|EEP90879.1| Cell division protein ftsY [Yersinia kristensenii ATCC 33638]
          Length = 502

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 200 FFARLKRSLIKTKQNLGSGFMGLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 259

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P VIL+VGVNGVGKTT IGKL
Sbjct: 260 HASRKQLKDAEALYGKLKEEMSEILSKVDKPLDVS-GKNPFVILMVGVNGVGKTTTIGKL 318

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W DR     V    G+D+A++ ++A + A+A
Sbjct: 319 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNKIAVVAQHTGADSASVIFDAIQAAKA 378

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N S LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 379 RGIDVLLADTAGRLQNKSHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 438

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 439 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 493


>gi|306816192|ref|ZP_07450330.1| cell division protein FtsY [Escherichia coli NC101]
 gi|305850588|gb|EFM51045.1| cell division protein FtsY [Escherichia coli NC101]
          Length = 498

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|163748790|ref|ZP_02156042.1| cell division protein FtsY [Shewanella benthica KT99]
 gi|161331564|gb|EDQ02369.1| cell division protein FtsY [Shewanella benthica KT99]
          Length = 456

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +G   TS  +  G   +   +++DD + EELE+ L+ +D+GV    ++++ L  
Sbjct: 148 FFARLKRGLKRTSENIGSGFIGLFKGKKIDDDLFEELEEQLLIADVGVETTTRLIDSLTE 207

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
           +   K +     LY++  E + K L P+S P   + +  P VIL+VGVNGVGKTT IGKL
Sbjct: 208 QASRKQLKDGEALYELLREEMQKTLEPVSIPLVPESADGPFVILMVGVNGVGKTTTIGKL 267

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +K+    G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A + A+A
Sbjct: 268 AKQYQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVIAQHTGADSASVLFDALQAARA 327

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N   LM  + K++RV+K+LD +APH V+  LDA TGQNA+ Q E+
Sbjct: 328 RNIDVLIADTAGRLQNKVHLMDELKKIVRVMKKLDENAPHEVMLTLDAGTGQNAISQAEL 387

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F    G TG+ ++K+DGTA+GG +  I     IP+  +GVGE I+DL  F AKDF
Sbjct: 388 FKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDF 442


>gi|58582766|ref|YP_201782.1| cell division protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58427360|gb|AAW76397.1| cell division protein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 601

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ V  Q +   +   +  +L P
Sbjct: 323 KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLIALLQP 382

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D + +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 383 VSKPLVIDRARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 442

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 443 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 502

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 503 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 562

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 563 AREFNIPIRFAGIGERPEDLRVF 585


>gi|325922810|ref|ZP_08184538.1| cell division protein FtsY [Xanthomonas gardneri ATCC 19865]
 gi|325546697|gb|EGD17823.1| cell division protein FtsY [Xanthomonas gardneri ATCC 19865]
          Length = 569

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     +VE L  +  +++ V  Q +   +   +  +L P
Sbjct: 291 KLDDDLLDEIETALITADVGIGATTALVEGLRKRMKSREFVDAQAMFKALRADLIALLQP 350

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P VIL VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 351 VSKPLVIDRSVKPFVILTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 410

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  +VLI DTAGRLH  + LM  +GK+
Sbjct: 411 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTEVLIADTAGRLHTQTGLMNELGKI 470

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 471 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 530

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 531 AREFNIPIRFAGIGERPEDLRVF 553


>gi|325915143|ref|ZP_08177469.1| signal recognition particle-docking protein FtsY [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538665|gb|EGD10335.1| signal recognition particle-docking protein FtsY [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 547

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ V  Q +   +   +  +L P
Sbjct: 269 KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLIALLQP 328

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 329 VSKPLVIDRSVKPFVVLTVGVNGVGKTTTIGKLAKRFKDDGNSLMLAAGDTFRAAAVAQL 388

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  D+LI DTAGRLH  + LM  +GK+
Sbjct: 389 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDILIADTAGRLHTQTGLMNELGKI 448

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 449 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 508

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 509 AREFNIPIRFAGIGERPEDLRVF 531


>gi|238793545|ref|ZP_04637169.1| Cell division protein ftsY [Yersinia intermedia ATCC 29909]
 gi|238727135|gb|EEQ18665.1| Cell division protein ftsY [Yersinia intermedia ATCC 29909]
          Length = 505

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 203 FFARLKRSLLKTKQNLGSGFLGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 262

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P VIL+VGVNGVGKTT IGKL
Sbjct: 263 HASRKQLKDAEALYGKLKEEMSEILSKVDKPLDVS-GKNPFVILMVGVNGVGKTTTIGKL 321

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W DR     V    G+D+A++ ++A + A+A
Sbjct: 322 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNKIAVVAQHTGADSASVIFDAIQAAKA 381

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 382 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 441

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 442 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 496


>gi|84624642|ref|YP_452014.1| cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84368582|dbj|BAE69740.1| cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 601

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ V  Q +   +   +  +L P
Sbjct: 323 KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLIALLQP 382

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D + +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 383 VSKPLVIDRARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 442

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 443 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 502

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 503 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 562

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 563 AREFNIPIRFAGIGERPEDLRVF 585


>gi|324116338|gb|EGC10257.1| signal recognition particle-docking protein FtsY [Escherichia coli
           E1167]
          Length = 515

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 213 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 272

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 273 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 331

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 332 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 391

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 392 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 451

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 452 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 506


>gi|320181957|gb|EFW56863.1| cell division protein FtsY [Shigella boydii ATCC 9905]
          Length = 498

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|323174103|gb|EFZ59731.1| signal recognition particle-docking protein FtsY [Escherichia coli
           LT-68]
          Length = 426

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 124 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 183

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 184 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 242

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W+ R +   +    G+D+A++ ++A + A+A
Sbjct: 243 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWSQRNNIPVIAQHTGADSASVIFDAIQAAKA 302

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 303 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 362

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 363 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 417


>gi|194431246|ref|ZP_03063539.1| cell division protein FtsY [Shigella dysenteriae 1012]
 gi|194420701|gb|EDX36777.1| cell division protein FtsY [Shigella dysenteriae 1012]
 gi|332085988|gb|EGI91152.1| signal recognition particle-docking protein FtsY [Shigella
           dysenteriae 155-74]
          Length = 497

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|332085341|gb|EGI90513.1| signal recognition particle-docking protein FtsY [Shigella boydii
           5216-82]
          Length = 497

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|331649271|ref|ZP_08350357.1| cell division protein FtsY [Escherichia coli M605]
 gi|330909505|gb|EGH38019.1| signal recognition particle receptor protein FtsY (alpha subunit)
           [Escherichia coli AA86]
 gi|331041769|gb|EGI13913.1| cell division protein FtsY [Escherichia coli M605]
          Length = 498

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|297517807|ref|ZP_06936193.1| cell division protein FtsY [Escherichia coli OP50]
          Length = 336

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 34  FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 93

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 94  GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 152

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 153 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 212

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 213 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 272

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 273 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 327


>gi|34581201|ref|ZP_00142681.1| cell division protein ftsY [Rickettsia sibirica 246]
 gi|28262586|gb|EAA26090.1| cell division protein ftsY [Rickettsia sibirica 246]
          Length = 303

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 193/303 (63%), Gaps = 3/303 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +S   KL +  + TS K+ EGI  I   ++LD G  EELE+LLI SD+ V V   I+EE 
Sbjct: 2   ISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAGTLEELEELLISSDMSVLVVTNIIEEF 61

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              ++ K++    V   +++LI + L   + PF     ++ +VILV GVNG GKTT IGK
Sbjct: 62  KKVKFDKEIDSDTVKEALAKLIEQQLSKSAIPFTLS-ENKLNVILVCGVNGAGKTTTIGK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+   S  G KV +AA DTFR+AA++QL  WADR +A  +  E  +D A++AY   +++ 
Sbjct: 121 LAAMYSAQGKKVAVAACDTFRAAAVNQLSTWADRANALLITGEESADPASVAYHGMEESI 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP-HSVLQVLDATTGQNALRQV 249
            + +D+L IDTAGRLHN   LM  + K+++V+K+LD +AP HSVL V+DA TGQN   QV
Sbjct: 181 KQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSVL-VIDAITGQNTYNQV 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F+     TGLI+TK+DG+A+ G ++ +V    +P+YF+G+GE I DL+ F   DF+  
Sbjct: 240 EHFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGIGEKIEDLKIFNQHDFARN 299

Query: 310 ITG 312
           + G
Sbjct: 300 LVG 302


>gi|320661534|gb|EFX28949.1| signal recognition particle-docking protein FtsY [Escherichia coli
           O55:H7 str. USDA 5905]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|153948996|ref|YP_001399236.1| cell division protein FtsY [Yersinia pseudotuberculosis IP 31758]
 gi|152960491|gb|ABS47952.1| cell division protein FtsY [Yersinia pseudotuberculosis IP 31758]
          Length = 541

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 239 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 298

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 299 HASRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 357

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 358 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 417

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 418 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 477

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 478 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 532


>gi|312972271|ref|ZP_07786445.1| signal recognition particle-docking protein FtsY [Escherichia coli
           1827-70]
 gi|310334648|gb|EFQ00853.1| signal recognition particle-docking protein FtsY [Escherichia coli
           1827-70]
          Length = 458

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 156 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 215

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 216 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 274

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 275 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 334

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 335 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 394

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 395 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 449


>gi|215488739|ref|YP_002331170.1| cell division protein FtsY [Escherichia coli O127:H6 str. E2348/69]
 gi|218691749|ref|YP_002399961.1| cell division protein FtsY [Escherichia coli ED1a]
 gi|312968224|ref|ZP_07782434.1| signal recognition particle-docking protein FtsY [Escherichia coli
           2362-75]
 gi|215266811|emb|CAS11252.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218429313|emb|CAR10272.2| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           coli ED1a]
 gi|222035170|emb|CAP77915.1| Cell division protein ftsY [Escherichia coli LF82]
 gi|312287049|gb|EFR14959.1| signal recognition particle-docking protein FtsY [Escherichia coli
           2362-75]
 gi|312948017|gb|ADR28844.1| cell division protein FtsY [Escherichia coli O83:H1 str. NRG 857C]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|15803976|ref|NP_290012.1| cell division protein FtsY [Escherichia coli O157:H7 EDL933]
 gi|15833567|ref|NP_312340.1| cell division protein FtsY [Escherichia coli O157:H7 str. Sakai]
 gi|168747042|ref|ZP_02772064.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4113]
 gi|168753232|ref|ZP_02778239.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4401]
 gi|168759502|ref|ZP_02784509.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4501]
 gi|168765827|ref|ZP_02790834.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4486]
 gi|168772627|ref|ZP_02797634.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4196]
 gi|168779563|ref|ZP_02804570.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4076]
 gi|168785285|ref|ZP_02810292.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC869]
 gi|168797250|ref|ZP_02822257.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC508]
 gi|195934958|ref|ZP_03080340.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4024]
 gi|208809270|ref|ZP_03251607.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4206]
 gi|208813507|ref|ZP_03254836.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4045]
 gi|208819501|ref|ZP_03259821.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4042]
 gi|209398368|ref|YP_002272908.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4115]
 gi|217326123|ref|ZP_03442207.1| cell division protein FtsY [Escherichia coli O157:H7 str. TW14588]
 gi|254795384|ref|YP_003080221.1| cell division protein FtsY [Escherichia coli O157:H7 str. TW14359]
 gi|261224747|ref|ZP_05939028.1| membrane-binding signal recognition particle (SRP) receptor
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254358|ref|ZP_05946891.1| membrane-binding signal recognition particle (SRP) receptor
           [Escherichia coli O157:H7 str. FRIK966]
 gi|12518120|gb|AAG58573.1|AE005569_13 cell division membrane protein [Escherichia coli O157:H7 str.
           EDL933]
 gi|13363787|dbj|BAB37736.1| cell division membrane protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|187771445|gb|EDU35289.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4196]
 gi|188018305|gb|EDU56427.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4113]
 gi|189002631|gb|EDU71617.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4076]
 gi|189358908|gb|EDU77327.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4401]
 gi|189364762|gb|EDU83181.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4486]
 gi|189369833|gb|EDU88249.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4501]
 gi|189374442|gb|EDU92858.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC869]
 gi|189380153|gb|EDU98569.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC508]
 gi|208729071|gb|EDZ78672.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4206]
 gi|208734784|gb|EDZ83471.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4045]
 gi|208739624|gb|EDZ87306.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4042]
 gi|209159768|gb|ACI37201.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC4115]
 gi|209756008|gb|ACI76316.1| cell division membrane protein [Escherichia coli]
 gi|209756010|gb|ACI76317.1| cell division membrane protein [Escherichia coli]
 gi|209756012|gb|ACI76318.1| cell division membrane protein [Escherichia coli]
 gi|209756014|gb|ACI76319.1| cell division membrane protein [Escherichia coli]
 gi|209756016|gb|ACI76320.1| cell division membrane protein [Escherichia coli]
 gi|217322344|gb|EEC30768.1| cell division protein FtsY [Escherichia coli O157:H7 str. TW14588]
 gi|254594784|gb|ACT74145.1| membrane-binding signal recognition particle (SRP) receptor
           [Escherichia coli O157:H7 str. TW14359]
 gi|320191518|gb|EFW66168.1| cell division protein FtsY [Escherichia coli O157:H7 str. EC1212]
 gi|320639748|gb|EFX09342.1| signal recognition particle-docking protein FtsY [Escherichia coli
           O157:H7 str. G5101]
 gi|320645247|gb|EFX14263.1| signal recognition particle-docking protein FtsY [Escherichia coli
           O157:H- str. 493-89]
 gi|320650558|gb|EFX19024.1| signal recognition particle-docking protein FtsY [Escherichia coli
           O157:H- str. H 2687]
 gi|320655751|gb|EFX23674.1| signal recognition particle-docking protein FtsY [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320666557|gb|EFX33540.1| signal recognition particle-docking protein FtsY [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326337566|gb|EGD61401.1| cell division protein FtsY [Escherichia coli O157:H7 str. 1044]
 gi|326344683|gb|EGD68432.1| cell division protein FtsY [Escherichia coli O157:H7 str. 1125]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|191169497|ref|ZP_03031229.1| cell division protein FtsY [Escherichia coli B7A]
 gi|193061759|ref|ZP_03042856.1| cell division protein FtsY [Escherichia coli E22]
 gi|218556015|ref|YP_002388928.1| cell division protein FtsY [Escherichia coli IAI1]
 gi|256020812|ref|ZP_05434677.1| cell division protein FtsY [Shigella sp. D9]
 gi|260846248|ref|YP_003224026.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/hypothetical protein FtsY [Escherichia coli
           O103:H2 str. 12009]
 gi|300907385|ref|ZP_07125033.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 84-1]
 gi|300926838|ref|ZP_07142606.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 182-1]
 gi|301305997|ref|ZP_07212078.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 124-1]
 gi|307311869|ref|ZP_07591507.1| signal recognition particle-docking protein FtsY [Escherichia coli
           W]
 gi|332282019|ref|ZP_08394432.1| cell division protein ftsY [Shigella sp. D9]
 gi|190900458|gb|EDV60275.1| cell division protein FtsY [Escherichia coli B7A]
 gi|192932549|gb|EDV85146.1| cell division protein FtsY [Escherichia coli E22]
 gi|218362783|emb|CAR00409.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           coli IAI1]
 gi|257761395|dbj|BAI32892.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein FtsY [Escherichia coli O103:H2
           str. 12009]
 gi|300400894|gb|EFJ84432.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 84-1]
 gi|300417188|gb|EFK00499.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 182-1]
 gi|300838780|gb|EFK66540.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 124-1]
 gi|306908013|gb|EFN38513.1| signal recognition particle-docking protein FtsY [Escherichia coli
           W]
 gi|315062743|gb|ADT77070.1| fused signal recognition particle (SRP) receptor: membrane binding
           protein/conserved protein [Escherichia coli W]
 gi|315256062|gb|EFU36030.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 85-1]
 gi|320199641|gb|EFW74231.1| cell division protein FtsY [Escherichia coli EC4100B]
 gi|323376669|gb|ADX48937.1| signal recognition particle-docking protein FtsY [Escherichia coli
           KO11]
 gi|332104371|gb|EGJ07717.1| cell division protein ftsY [Shigella sp. D9]
          Length = 497

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|331679532|ref|ZP_08380202.1| cell division protein FtsY [Escherichia coli H591]
 gi|331072704|gb|EGI44029.1| cell division protein FtsY [Escherichia coli H591]
          Length = 527

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 225 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 284

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 285 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 343

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 344 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 403

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 404 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 463

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 464 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 518


>gi|293453769|ref|ZP_06664188.1| cell division protein FtsY [Escherichia coli B088]
 gi|300815331|ref|ZP_07095556.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 107-1]
 gi|309794744|ref|ZP_07689166.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 145-7]
 gi|331670290|ref|ZP_08371129.1| cell division protein FtsY [Escherichia coli TA271]
 gi|291321895|gb|EFE61326.1| cell division protein FtsY [Escherichia coli B088]
 gi|300532223|gb|EFK53285.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 107-1]
 gi|308121794|gb|EFO59056.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 145-7]
 gi|331062352|gb|EGI34272.1| cell division protein FtsY [Escherichia coli TA271]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|326802525|ref|YP_004320344.1| signal recognition particle-docking protein FtsY [Sphingobacterium
           sp. 21]
 gi|326553289|gb|ADZ81674.1| signal recognition particle-docking protein FtsY [Sphingobacterium
           sp. 21]
          Length = 320

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 190/296 (64%), Gaps = 7/296 (2%)

Query: 17  LTKGFASTSLKLKEGITD-IISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           L KG   T       IT  ++    +D+ V ++LE++L+ SD+GV    KI+E +   R 
Sbjct: 20  LDKGLEKTKEGFFTKITKAVVGKSTVDEEVLDDLEEVLVTSDVGVTTTLKIIERI-EDRV 78

Query: 76  AKD--VSVQRVLYDVSELIHKMLMPL-SKPF-NWDF-SHRPHVILVVGVNGVGKTTVIGK 130
           A+D  ++   +   + E I ++L    S  F N+++ +H+P+VI+VVGVNGVGKTT IGK
Sbjct: 79  ARDKYINTSELNGILREEIQELLAENNSNDFENFEYGNHKPYVIMVVGVNGVGKTTTIGK 138

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+ K+  AG KV+L A DTFR+AA+DQ+K+W +R     V   +GSD A++A++  + A 
Sbjct: 139 LAHKLKQAGNKVVLGAADTFRAAAVDQIKLWGERVGVRVVAQAMGSDPASVAFDTIQSAV 198

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A + DV IIDTAGRLHN   LM  + K+  V+K++ P APH +L VLDA+TGQNA+ Q +
Sbjct: 199 ANQEDVAIIDTAGRLHNKLALMNELTKIKNVMKKVVPGAPHEILLVLDASTGQNAIEQCK 258

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            F        L +TK+DGTA+GG +I I    KIPV ++GVGEGINDL+ F  K+F
Sbjct: 259 QFTQATDVNALALTKLDGTAKGGVVIGISDQFKIPVKYIGVGEGINDLQLFNKKEF 314


>gi|331655047|ref|ZP_08356046.1| cell division protein FtsY [Escherichia coli M718]
 gi|331047062|gb|EGI19140.1| cell division protein FtsY [Escherichia coli M718]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|293416868|ref|ZP_06659505.1| cell division protein FtsY [Escherichia coli B185]
 gi|291431444|gb|EFF04429.1| cell division protein FtsY [Escherichia coli B185]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|157162941|ref|YP_001460259.1| cell division protein FtsY [Escherichia coli HS]
 gi|170018304|ref|YP_001723258.1| cell division protein FtsY [Escherichia coli ATCC 8739]
 gi|157068621|gb|ABV07876.1| cell division protein FtsY [Escherichia coli HS]
 gi|169753232|gb|ACA75931.1| signal recognition particle-docking protein FtsY [Escherichia coli
           ATCC 8739]
 gi|323939318|gb|EGB35529.1| signal recognition particle-docking protein FtsY [Escherichia coli
           E482]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|226939167|ref|YP_002794238.1| FtsY [Laribacter hongkongensis HLHK9]
 gi|226714091|gb|ACO73229.1| FtsY [Laribacter hongkongensis HLHK9]
          Length = 400

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 191/307 (62%), Gaps = 3/307 (0%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           ++++  A    SW  +L  G + T  KL + +  +    ++D+ + +ELE +L+ SD+GV
Sbjct: 90  VASEAAAPRKQSWSERLKAGLSKTRDKLGKQLAGLFGGGQIDEDLYDELETILLTSDMGV 149

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119
           A  + ++E++  +   K +     L D + E +  ++ PL KP N D S  P VI++ GV
Sbjct: 150 AATRHLLEDVRRRVSLKGLKDASQLKDALKESLMDLIGPLEKPLNLDRSG-PLVIMMAGV 208

Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAA 179
           NG GKTT IGKL+K        V+LAAGDTFR+AA +QL  W  R     V S+ G DAA
Sbjct: 209 NGAGKTTSIGKLAKYFQGHRKSVLLAAGDTFRAAAREQLAEWGARNQVT-VISQQGGDAA 267

Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239
           A+ ++A + AQA+K+D+++ DTAGRL     LM  I K+ RV+ +  P APH +L VLDA
Sbjct: 268 AVCFDAVQAAQARKIDIVLADTAGRLPTQLHLMEEIRKVKRVISKALPQAPHEILLVLDA 327

Query: 240 TTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLE 299
            TGQNAL QV+ F    G TGLI+TK+DGTA+GG +  I     +P+YF+GVGE ++DL 
Sbjct: 328 NTGQNALAQVKAFDDALGLTGLILTKLDGTAKGGVIAAIARERPVPMYFVGVGETLDDLR 387

Query: 300 PFVAKDF 306
           PF A+++
Sbjct: 388 PFSAREY 394


>gi|188492944|ref|ZP_03000214.1| cell division protein FtsY [Escherichia coli 53638]
 gi|194435805|ref|ZP_03067908.1| cell division protein FtsY [Escherichia coli 101-1]
 gi|254163388|ref|YP_003046496.1| cell division protein FtsY [Escherichia coli B str. REL606]
 gi|300930995|ref|ZP_07146353.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 187-1]
 gi|188488143|gb|EDU63246.1| cell division protein FtsY [Escherichia coli 53638]
 gi|194425348|gb|EDX41332.1| cell division protein FtsY [Escherichia coli 101-1]
 gi|242378985|emb|CAQ33783.1| SRP receptor, subunit of Signal Recognition Particle Protein
           Translocation System [Escherichia coli BL21(DE3)]
 gi|253975289|gb|ACT40960.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved hypothetical protein [Escherichia coli
           B str. REL606]
 gi|253979445|gb|ACT45115.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Escherichia coli BL21(DE3)]
 gi|300461173|gb|EFK24666.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 187-1]
 gi|323959684|gb|EGB55335.1| signal recognition particle-docking protein FtsY [Escherichia coli
           H489]
 gi|323970062|gb|EGB65337.1| signal recognition particle-docking protein FtsY [Escherichia coli
           TA007]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|218702209|ref|YP_002409838.1| cell division protein FtsY [Escherichia coli IAI39]
 gi|218372195|emb|CAR20057.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           coli IAI39]
          Length = 495

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 193 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 252

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 253 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 311

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 312 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 371

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 372 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 431

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 432 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 486


>gi|193068822|ref|ZP_03049782.1| cell division protein FtsY [Escherichia coli E110019]
 gi|260857570|ref|YP_003231461.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein FtsY [Escherichia coli O26:H11
           str. 11368]
 gi|260870189|ref|YP_003236591.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/hypothetical protein FtsY [Escherichia coli
           O111:H- str. 11128]
 gi|192957898|gb|EDV88341.1| cell division protein FtsY [Escherichia coli E110019]
 gi|257756219|dbj|BAI27721.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein FtsY [Escherichia coli O26:H11
           str. 11368]
 gi|257766545|dbj|BAI38040.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein FtsY [Escherichia coli O111:H-
           str. 11128]
 gi|323179009|gb|EFZ64583.1| signal recognition particle-docking protein FtsY [Escherichia coli
           1180]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|324009352|gb|EGB78571.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 57-2]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|281602812|gb|ADA75796.1| Cell division membrane protein [Shigella flexneri 2002017]
 gi|332749436|gb|EGJ79853.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           K-671]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-DKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|229525040|ref|ZP_04414445.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           bv. albensis VL426]
 gi|229338621|gb|EEO03638.1| signal recognition particle receptor protein FtsY [Vibrio cholerae
           bv. albensis VL426]
          Length = 401

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 191/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+     I+  L 
Sbjct: 97  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSNIIANLT 156

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   +   +P+VIL+VGVNGVGKTT IGK
Sbjct: 157 AKASRQQLRDGEALYGLLKEEMAEILAQVEQPLVIETEKKPYVILMVGVNGVGKTTTIGK 216

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 217 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 276

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 277 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 336

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 337 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 392


>gi|170682136|ref|YP_001745713.1| cell division protein FtsY [Escherichia coli SMS-3-5]
 gi|170519854|gb|ACB18032.1| cell division protein FtsY [Escherichia coli SMS-3-5]
          Length = 512

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 210 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 269

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 270 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 328

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 329 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 388

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 389 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 448

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 449 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 503


>gi|170766837|ref|ZP_02901290.1| cell division protein FtsY [Escherichia albertii TW07627]
 gi|170124275|gb|EDS93206.1| cell division protein FtsY [Escherichia albertii TW07627]
          Length = 504

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 202 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 261

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 262 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKL 320

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 321 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 380

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 381 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 440

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 441 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 495


>gi|300822730|ref|ZP_07102867.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 119-7]
 gi|300524730|gb|EFK45799.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 119-7]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|320175705|gb|EFW50793.1| cell division protein FtsY [Shigella dysenteriae CDC 74-1112]
          Length = 500

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 198 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 257

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +    VLY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 258 GASRKQLRDAEVLYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 316

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 317 ARQFELQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 376

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 377 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 436

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 437 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 491


>gi|301018551|ref|ZP_07182929.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 69-1]
 gi|300399670|gb|EFJ83208.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 69-1]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|110643704|ref|YP_671434.1| cell division protein FtsY [Escherichia coli 536]
 gi|191170595|ref|ZP_03032148.1| cell division protein FtsY [Escherichia coli F11]
 gi|300987363|ref|ZP_07178171.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 200-1]
 gi|110345296|gb|ABG71533.1| cell division protein FtsY [Escherichia coli 536]
 gi|190909403|gb|EDV68989.1| cell division protein FtsY [Escherichia coli F11]
 gi|300306231|gb|EFJ60751.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 200-1]
 gi|324014562|gb|EGB83781.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 60-1]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|254038632|ref|ZP_04872688.1| cell division protein FtsY [Escherichia sp. 1_1_43]
 gi|226839138|gb|EEH71161.1| cell division protein FtsY [Escherichia sp. 1_1_43]
 gi|309703870|emb|CBJ03211.1| cell division protein [Escherichia coli ETEC H10407]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|167627247|ref|YP_001677747.1| signal recognition particle-docking protein FtsY [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|167597248|gb|ABZ87246.1| signal recognition particle-docking protein FtsY [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 333

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/297 (41%), Positives = 198/297 (66%), Gaps = 2/297 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRL-DDGVREELEDLLIRSDIGVAVAQKIVEELLTKR 74
           +L  G + T+ K   G++ I+  +++ DD + E++E  L+ SD+GV    +IVE L  K 
Sbjct: 30  RLQSGLSKTASKFGSGLSTILMGQKVVDDELLEDIEMQLLTSDVGVEATDEIVEYLRGKV 89

Query: 75  YAKDV-SVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSK 133
              ++ +V ++   + + + ++++P  KP   +  + P+VIL+VGVNGVGKTT IGKL+K
Sbjct: 90  ARNELQTVDKLNEIIQDKLTEIILPCQKPLQINHENTPYVILIVGVNGVGKTTTIGKLTK 149

Query: 134 KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193
           K+   G  V+LAAGDTFR+AA++QL+ W DR +   V  + G+D+A++ Y+A   A+++ 
Sbjct: 150 KLQSEGKSVILAAGDTFRAAAVEQLREWGDRNNTQVVYQKEGADSASVIYDAISSAKSRG 209

Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH 253
           +DV+I DTAGRLHN   LM  + K+++V+K++D  APH  + V+DATTG NAL Q E F+
Sbjct: 210 IDVVIADTAGRLHNKDNLMQELKKVVKVIKKVDDSAPHETMLVVDATTGGNALSQAEAFN 269

Query: 254 AVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            +   TG+ +TK+DGTA+GG +  I     +P+ F+GVGE I+DL+ F AK+F+  +
Sbjct: 270 EIVNLTGITITKLDGTAKGGIVFSIAKKMGLPLRFIGVGEKIDDLQVFNAKNFTKAL 326


>gi|331665073|ref|ZP_08365974.1| cell division protein FtsY [Escherichia coli TA143]
 gi|331057583|gb|EGI29569.1| cell division protein FtsY [Escherichia coli TA143]
          Length = 498

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|167468884|ref|ZP_02333588.1| cell division protein [Yersinia pestis FV-1]
          Length = 589

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 287 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 346

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 347 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 405

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 406 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 465

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 466 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 525

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 526 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 580


>gi|333012439|gb|EGK31820.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           K-304]
          Length = 516

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 214 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 273

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 274 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-DKTPFVILMVGVNGVGKTTTIGKL 332

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 333 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 392

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 393 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 452

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 453 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 507


>gi|325499013|gb|EGC96872.1| cell division protein FtsY [Escherichia fergusonii ECD227]
          Length = 512

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 210 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 269

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 270 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 328

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 329 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 388

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 389 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 448

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 449 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 503


>gi|331685110|ref|ZP_08385696.1| cell division protein FtsY [Escherichia coli H299]
 gi|331077481|gb|EGI48693.1| cell division protein FtsY [Escherichia coli H299]
          Length = 498

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|218550726|ref|YP_002384517.1| cell division protein FtsY [Escherichia fergusonii ATCC 35469]
 gi|218358267|emb|CAQ90914.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           fergusonii ATCC 35469]
          Length = 512

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 210 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 269

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 270 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 328

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 329 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 388

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 389 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 448

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 449 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 503


>gi|197249122|ref|YP_002148494.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197212825|gb|ACH50222.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 491

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|323974895|gb|EGB70006.1| signal recognition particle-docking protein FtsY [Escherichia coli
           TW10509]
          Length = 512

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 210 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 269

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 270 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 328

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 329 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 388

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 389 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 448

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 449 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 503


>gi|82778728|ref|YP_405077.1| cell division protein FtsY [Shigella dysenteriae Sd197]
 gi|309785785|ref|ZP_07680416.1| signal recognition particle-docking protein FtsY [Shigella
           dysenteriae 1617]
 gi|81242876|gb|ABB63586.1| cell division membrane protein [Shigella dysenteriae Sd197]
 gi|308926905|gb|EFP72381.1| signal recognition particle-docking protein FtsY [Shigella
           dysenteriae 1617]
          Length = 498

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|16131336|ref|NP_417921.1| Signal Recognition Particle (SRP) receptor [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89110548|ref|AP_004328.1| fused Signal Recognition Particle (SRP) receptor [Escherichia coli
           str. K-12 substr. W3110]
 gi|170082978|ref|YP_001732298.1| fused Signal recognition particle (SRP) receptor: membrane binding
           protein; protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238902555|ref|YP_002928351.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/hypothetical protein [Escherichia coli BW2952]
 gi|253771707|ref|YP_003034538.1| cell division protein FtsY [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|300946787|ref|ZP_07161031.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 116-1]
 gi|300956799|ref|ZP_07169066.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 175-1]
 gi|301021814|ref|ZP_07185778.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 196-1]
 gi|120576|sp|P10121|FTSY_ECOLI RecName: Full=Cell division protein ftsY
 gi|41498|emb|CAA27984.1| unnamed protein product [Escherichia coli K-12]
 gi|466600|gb|AAB18439.1| CG Site No. 18295 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789874|gb|AAC76489.1| Signal Recognition Particle (SRP) receptor [Escherichia coli str.
           K-12 substr. MG1655]
 gi|85676579|dbj|BAE77829.1| fused Signal Recognition Particle (SRP) receptor [Escherichia coli
           str. K12 substr. W3110]
 gi|169890813|gb|ACB04520.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein; conserved protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|238861253|gb|ACR63251.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein/conserved protein [Escherichia coli BW2952]
 gi|253322751|gb|ACT27353.1| signal recognition particle-docking protein FtsY [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260447520|gb|ACX37942.1| signal recognition particle-docking protein FtsY [Escherichia coli
           DH1]
 gi|299881447|gb|EFI89658.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 196-1]
 gi|300316438|gb|EFJ66222.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 175-1]
 gi|300453544|gb|EFK17164.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 116-1]
 gi|315138038|dbj|BAJ45197.1| cell division protein FtsY [Escherichia coli DH1]
          Length = 497

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|300917202|ref|ZP_07133884.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 115-1]
 gi|300415541|gb|EFJ98851.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 115-1]
          Length = 497

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|262363544|gb|ACY60265.1| cell division protein [Yersinia pestis D106004]
          Length = 544

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 242 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 301

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 302 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 360

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 361 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 420

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 421 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 480

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 481 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 535


>gi|229900065|ref|ZP_04515202.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229686845|gb|EEO78924.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis biovar Orientalis str. India 195]
          Length = 556

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 254 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 313

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 314 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 372

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 373 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 432

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 433 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 492

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 493 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 547


>gi|167401838|ref|ZP_02307326.1| cell division protein FtsY [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167048731|gb|EDR60139.1| cell division protein FtsY [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 562

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 260 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 319

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 320 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 378

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 379 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 438

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 439 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 498

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 499 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 553


>gi|167420847|ref|ZP_02312600.1| cell division protein FtsY [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|166960976|gb|EDR56997.1| cell division protein FtsY [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|320013587|gb|ADV97158.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 550

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 248 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 307

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 308 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 366

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 367 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 426

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 427 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 486

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 487 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 541


>gi|165926241|ref|ZP_02222073.1| cell division protein FtsY [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165921765|gb|EDR38962.1| cell division protein FtsY [Yersinia pestis biovar Orientalis str.
           F1991016]
          Length = 568

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 266 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 325

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 326 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 384

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 385 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 444

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 445 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 504

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 505 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 559


>gi|145600681|ref|YP_001164757.1| cell division protein [Yersinia pestis Pestoides F]
 gi|153997129|ref|ZP_02022262.1| cell division protein [Yersinia pestis CA88-4125]
 gi|145212377|gb|ABP41784.1| signal recognition particle-docking protein FtsY [Yersinia pestis
           Pestoides F]
 gi|149289435|gb|EDM39513.1| cell division protein [Yersinia pestis CA88-4125]
          Length = 559

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 257 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 316

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 317 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 375

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 376 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 435

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 436 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 495

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 496 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 550


>gi|108810316|ref|YP_646083.1| cell division protein [Yersinia pestis Nepal516]
 gi|229900489|ref|ZP_04515618.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis Nepal516]
 gi|108773964|gb|ABG16483.1| signal recognition particle-docking protein FtsY [Yersinia pestis
           Nepal516]
 gi|229682508|gb|EEO78595.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis Nepal516]
          Length = 535

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 233 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 292

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 293 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 351

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 352 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 411

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 412 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 471

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 472 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 526


>gi|45442987|ref|NP_994526.1| cell division protein [Yersinia pestis biovar Microtus str. 91001]
 gi|45437854|gb|AAS63403.1| cell division protein [Yersinia pestis biovar Microtus str. 91001]
          Length = 547

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 245 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 304

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 305 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 363

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 364 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 423

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 424 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 483

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 484 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 538


>gi|218930816|ref|YP_002348691.1| cell division protein [Yersinia pestis CO92]
 gi|229837142|ref|ZP_04457307.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis Pestoides A]
 gi|229839502|ref|ZP_04459661.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|115349427|emb|CAL22400.1| cell division protein [Yersinia pestis CO92]
 gi|229695868|gb|EEO85915.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706085|gb|EEO92094.1| membrane-binding signal recognition particle (SRP) receptor
           [Yersinia pestis Pestoides A]
          Length = 541

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 239 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 298

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 299 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 357

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 358 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 417

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 418 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 477

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 478 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 532


>gi|108806206|ref|YP_650122.1| cell division protein [Yersinia pestis Antiqua]
 gi|165939137|ref|ZP_02227688.1| cell division protein FtsY [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011666|ref|ZP_02232564.1| cell division protein FtsY [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213536|ref|ZP_02239571.1| cell division protein FtsY [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|108778119|gb|ABG12177.1| signal recognition particle-docking protein FtsY [Yersinia pestis
           Antiqua]
 gi|165912910|gb|EDR31536.1| cell division protein FtsY [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165989435|gb|EDR41736.1| cell division protein FtsY [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205209|gb|EDR49689.1| cell division protein FtsY [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|262367473|gb|ACY64030.1| cell division protein [Yersinia pestis D182038]
          Length = 538

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 236 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 295

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 296 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 354

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 355 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 414

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 415 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 474

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 475 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 529


>gi|22124331|ref|NP_667754.1| cell division protein [Yersinia pestis KIM 10]
 gi|162420030|ref|YP_001605168.1| cell division protein [Yersinia pestis Angola]
 gi|167426293|ref|ZP_02318046.1| cell division protein FtsY [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|294505479|ref|YP_003569541.1| cell division membrane protein [Yersinia pestis Z176003]
 gi|21957106|gb|AAM84005.1|AE013642_6 cell division membrane protein [Yersinia pestis KIM 10]
 gi|162352845|gb|ABX86793.1| cell division protein FtsY [Yersinia pestis Angola]
 gi|167054812|gb|EDR64616.1| cell division protein FtsY [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|294355938|gb|ADE66279.1| cell division membrane protein [Yersinia pestis Z176003]
          Length = 553

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 251 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 310

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 311 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 369

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 370 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 429

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 430 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 489

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 490 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 544


>gi|332996587|gb|EGK16212.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           K-272]
 gi|333012995|gb|EGK32371.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           K-227]
          Length = 497

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-DKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|332996251|gb|EGK15878.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           VA-6]
          Length = 498

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-DKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|300936475|ref|ZP_07151395.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 21-1]
 gi|300458397|gb|EFK21890.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 21-1]
          Length = 504

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 202 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 261

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 262 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKL 320

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 321 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 380

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 381 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 440

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 441 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 495


>gi|238750712|ref|ZP_04612211.1| Cell division protein ftsY [Yersinia rohdei ATCC 43380]
 gi|238711102|gb|EEQ03321.1| Cell division protein ftsY [Yersinia rohdei ATCC 43380]
          Length = 555

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 192/300 (64%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 253 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 312

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
               K +     LY     ++SE++ K+  PL      D S + P+VIL+VGVNGVGKTT
Sbjct: 313 HASRKQLKDAEALYGKLKEEMSEILSKVDKPL------DVSGKNPYVILMVGVNGVGKTT 366

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGKL+++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A 
Sbjct: 367 TIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAI 426

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ VDVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+
Sbjct: 427 QAAKARGVDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAV 486

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 487 SQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 546


>gi|323164793|gb|EFZ50585.1| signal recognition particle-docking protein FtsY [Shigella sonnei
           53G]
          Length = 454

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 152 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 211

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 212 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 270

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 271 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 330

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 331 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 390

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 391 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 445


>gi|323154303|gb|EFZ40506.1| signal recognition particle-docking protein FtsY [Escherichia coli
           EPECa14]
          Length = 527

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 225 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 284

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 285 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 343

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 344 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 403

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 404 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 463

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 464 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 518


>gi|218707058|ref|YP_002414577.1| cell division protein FtsY [Escherichia coli UMN026]
 gi|293407045|ref|ZP_06650969.1| cell division protein FtsY [Escherichia coli FVEC1412]
 gi|300898834|ref|ZP_07117138.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 198-1]
 gi|218434155|emb|CAR15072.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           coli UMN026]
 gi|284923454|emb|CBG36549.1| cell division protein [Escherichia coli 042]
 gi|291425856|gb|EFE98890.1| cell division protein FtsY [Escherichia coli FVEC1412]
 gi|300357519|gb|EFJ73389.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 198-1]
          Length = 498

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|26250079|ref|NP_756119.1| cell division protein FtsY [Escherichia coli CFT073]
 gi|227883610|ref|ZP_04001415.1| cell division protein FtsY [Escherichia coli 83972]
 gi|300985244|ref|ZP_07177341.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 45-1]
 gi|301050311|ref|ZP_07197200.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 185-1]
 gi|26110508|gb|AAN82693.1|AE016768_111 Cell division protein ftsY [Escherichia coli CFT073]
 gi|227839489|gb|EEJ49955.1| cell division protein FtsY [Escherichia coli 83972]
 gi|300297940|gb|EFJ54325.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 185-1]
 gi|300408115|gb|EFJ91653.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 45-1]
 gi|307555558|gb|ADN48333.1| cell division protein FtsY [Escherichia coli ABU 83972]
 gi|315291681|gb|EFU51037.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 153-1]
          Length = 498

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|238784416|ref|ZP_04628426.1| Cell division protein ftsY [Yersinia bercovieri ATCC 43970]
 gi|238714708|gb|EEQ06710.1| Cell division protein ftsY [Yersinia bercovieri ATCC 43970]
          Length = 519

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 217 FFARLKRSLLKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 276

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P VIL+VGVNGVGKTT IGKL
Sbjct: 277 HASRKQLKDAEALYGKLKEEMSEILSTVDKPLDVS-GKNPFVILMVGVNGVGKTTTIGKL 335

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 336 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 395

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 396 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 455

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 456 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 510


>gi|238798003|ref|ZP_04641492.1| Cell division protein ftsY [Yersinia mollaretii ATCC 43969]
 gi|238718106|gb|EEQ09933.1| Cell division protein ftsY [Yersinia mollaretii ATCC 43969]
          Length = 534

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 232 FFARLKRSLLKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 291

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P VIL+VGVNGVGKTT IGKL
Sbjct: 292 HASRKQLKDAEALYGKLKEEMSEILSTVDKPLDVS-GKNPFVILMVGVNGVGKTTTIGKL 350

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 351 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 410

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 411 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 470

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 471 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDF 525


>gi|315295966|gb|EFU55275.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 16-3]
          Length = 498

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|298382791|ref|ZP_06992386.1| cell division protein FtsY [Escherichia coli FVEC1302]
 gi|298276627|gb|EFI18145.1| cell division protein FtsY [Escherichia coli FVEC1302]
          Length = 527

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 225 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 284

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 285 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 343

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 344 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 403

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 404 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 463

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 464 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 518


>gi|213621992|ref|ZP_03374775.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 479

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 177 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 236

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 237 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 295

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 296 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 355

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 356 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 415

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 416 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 470


>gi|24114724|ref|NP_709234.1| cell division protein FtsY [Shigella flexneri 2a str. 301]
 gi|30065259|ref|NP_839430.1| cell division protein FtsY [Shigella flexneri 2a str. 2457T]
 gi|24053940|gb|AAN44941.1| cell division membrane protein [Shigella flexneri 2a str. 301]
 gi|30043521|gb|AAP19241.1| cell division membrane protein [Shigella flexneri 2a str. 2457T]
 gi|313647237|gb|EFS11689.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           2a str. 2457T]
 gi|332750283|gb|EGJ80694.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           4343-70]
          Length = 498

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-DKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|186893578|ref|YP_001870690.1| signal recognition particle-docking protein FtsY [Yersinia
           pseudotuberculosis PB1/+]
 gi|186696604|gb|ACC87233.1| signal recognition particle-docking protein FtsY [Yersinia
           pseudotuberculosis PB1/+]
          Length = 550

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 248 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 307

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 308 HASRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 366

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 367 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 426

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 427 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 486

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 487 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 541


>gi|51594576|ref|YP_068767.1| cell division protein [Yersinia pseudotuberculosis IP 32953]
 gi|51587858|emb|CAH19461.1| cell division protein [Yersinia pseudotuberculosis IP 32953]
          Length = 574

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 272 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 331

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 332 HASRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 390

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 391 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 450

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 451 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 510

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 511 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 565


>gi|323934550|gb|EGB30950.1| signal recognition particle-docking protein FtsY [Escherichia coli
           E1520]
          Length = 516

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 214 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 273

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 274 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 332

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 333 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 392

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 393 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 452

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 453 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 507


>gi|74314064|ref|YP_312483.1| cell division protein FtsY [Shigella sonnei Ss046]
 gi|73857541|gb|AAZ90248.1| cell division membrane protein [Shigella sonnei Ss046]
          Length = 498

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|330505416|ref|YP_004382285.1| signal recognition particle-docking protein FtsY [Pseudomonas
           mendocina NK-01]
 gi|328919702|gb|AEB60533.1| signal recognition particle-docking protein FtsY [Pseudomonas
           mendocina NK-01]
          Length = 443

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 132/297 (44%), Positives = 197/297 (66%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  L EG+  + +  + +DD + ++LE  L+ +D+GV     I+  L 
Sbjct: 137 FFARLKQGLSKTSASLGEGMASLFLGKKAIDDDLLDDLETRLLTADVGVEATTTIIGNL- 195

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D + +P+VILVVGVNGVGKTT IG
Sbjct: 196 TKRVARKELADSGALYKALQEELVTLLKPVEQPLLIDSAKQPYVILVVGVNGVGKTTTIG 255

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ ++A + A
Sbjct: 256 KLAKKLQQDGKKVMLAAGDTFRAAAVEQLQVWGERNNIAVIAQHTGADSASVIFDAVQAA 315

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +++ VDVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 316 KSRGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAISQA 375

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL PF A+ F
Sbjct: 376 KQFNQTVNLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRPFEAQAF 432


>gi|270488845|ref|ZP_06205919.1| signal recognition particle-docking protein FtsY [Yersinia pestis
           KIM D27]
 gi|270337349|gb|EFA48126.1| signal recognition particle-docking protein FtsY [Yersinia pestis
           KIM D27]
          Length = 580

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 278 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 337

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 338 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 396

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 397 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 456

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 457 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 516

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 517 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 571


>gi|238910428|ref|ZP_04654265.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 491

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|224585363|ref|YP_002639162.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224469891|gb|ACN47721.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 491

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|78048306|ref|YP_364481.1| cell division protein FtsY [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78036736|emb|CAJ24429.1| cell division protein FtsY [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 551

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 173/264 (65%), Gaps = 3/264 (1%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDV--SELIHKMLM 97
           +LDD + +E+E  LI +D+G+     +++ L  +  +++    + L+    ++LI  +L 
Sbjct: 273 KLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQALFKALRADLIA-LLQ 331

Query: 98  PLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ 157
           P+SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ Q
Sbjct: 332 PVSKPLVIDRSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQ 391

Query: 158 LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGK 217
           L+ W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK
Sbjct: 392 LQAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGK 451

Query: 218 MIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIP 277
           + RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  
Sbjct: 452 IRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFA 511

Query: 278 IVVTHKIPVYFLGVGEGINDLEPF 301
           +     IP+ F G+GE   DL  F
Sbjct: 512 LAREFNIPIRFAGIGERPEDLRVF 535


>gi|148358595|ref|YP_001249802.1| cell division membrane protein FtsY [Legionella pneumophila str.
           Corby]
 gi|148280368|gb|ABQ54456.1| cell division membrane protein FtsY [Legionella pneumophila str.
           Corby]
          Length = 355

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 189/309 (61%), Gaps = 3/309 (0%)

Query: 5   KVASESLSWIRKLTKGFASTSLKLKEGITDII-SSRRLDDGVREELEDLLIRSDIGVAVA 63
           K  S   S   +  KG + T  +L EGI+ ++   + +   + EELE LLI +D+G+   
Sbjct: 41  KEPSPKESIFARFRKGLSKTRHQLGEGISRLLLGKKEISQELLEELETLLISADLGLDTT 100

Query: 64  QKIVEELLTKRYAKDVSVQRVLYDVSEL-IHKMLMPLSKPFNWDFSH-RPHVILVVGVNG 121
           Q ++++L      K +S    +Y   +     +L P  KP + +     P VIL+VGVNG
Sbjct: 101 QDVLKQLNEGLARKQLSNGEAVYQTLKTNFATILSPEEKPLSIETEDGSPFVILMVGVNG 160

Query: 122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAAL 181
            GKTT IGKL+K+    G KVMLAAGDTFR+AA++QL +W +R     +    G+D+A++
Sbjct: 161 AGKTTTIGKLAKQFQKQGKKVMLAAGDTFRAAAVEQLHVWGERNGIPVIAQHTGADSASV 220

Query: 182 AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATT 241
            ++A + A+A+K+DVLI DTAGRLH  S LM  + K+ RV+++LDP APH  + VLDA+ 
Sbjct: 221 IFDALQAAKARKIDVLIADTAGRLHTQSNLMEELKKVKRVMQKLDPKAPHETMLVLDASI 280

Query: 242 GQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPF 301
           GQNAL Q + FH     TG+ MTK+DGTA+GG L  I     IP  +LGVGEGI DL PF
Sbjct: 281 GQNALAQAKQFHEAVQLTGITMTKLDGTAKGGILFAIANDLGIPFRYLGVGEGIEDLRPF 340

Query: 302 VAKDFSAVI 310
            A  F + I
Sbjct: 341 DAAQFVSAI 349


>gi|324111785|gb|EGC05765.1| signal recognition particle-docking protein FtsY [Escherichia
           fergusonii B253]
          Length = 512

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 210 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 269

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 270 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 328

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 329 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 388

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 389 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 448

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 449 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 503


>gi|323966128|gb|EGB61565.1| signal recognition particle-docking protein FtsY [Escherichia coli
           M863]
 gi|327251100|gb|EGE62793.1| signal recognition particle-docking protein FtsY [Escherichia coli
           STEC_7v]
          Length = 512

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 210 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 269

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 270 GATRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 328

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 329 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 388

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 389 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 448

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 449 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 503


>gi|283787901|ref|YP_003367766.1| cell division protein [Citrobacter rodentium ICC168]
 gi|282951355|emb|CBG91054.1| cell division protein [Citrobacter rodentium ICC168]
          Length = 494

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 185/292 (63%), Gaps = 2/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L     
Sbjct: 195 RLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGAS 254

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LY +  + + ++L  + +P N D    P VIL+VGVNGVGKTT IGKL+++
Sbjct: 255 RKQLRDAEALYGLLKDEMSEILAKVDEPLNVD-GKTPFVILMVGVNGVGKTTTIGKLARQ 313

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A+ +
Sbjct: 314 FEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNI 373

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q  +FH 
Sbjct: 374 DVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEVMLTIDASTGQNAVSQARLFHE 433

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 AVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 485


>gi|170026190|ref|YP_001722695.1| signal recognition particle-docking protein FtsY [Yersinia
           pseudotuberculosis YPIII]
 gi|169752724|gb|ACA70242.1| signal recognition particle-docking protein FtsY [Yersinia
           pseudotuberculosis YPIII]
          Length = 523

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 190/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   + S +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 221 FFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 280

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + KP +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 281 HTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVS-GKSPYVILMVGVNGVGKTTTIGKL 339

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     V    G+D+A++ ++A + A+A
Sbjct: 340 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA 399

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+ Q ++
Sbjct: 400 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKL 459

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I    +IP+ ++GVGEGI DL PF A +F
Sbjct: 460 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEF 514


>gi|168241723|ref|ZP_02666655.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449622|ref|YP_002047596.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194407926|gb|ACF68145.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205338916|gb|EDZ25680.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 491

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|153214853|ref|ZP_01949661.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           1587]
 gi|124115096|gb|EAY33916.1| signal recognition particle-docking protein FtsY [Vibrio cholerae
           1587]
          Length = 383

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 191/296 (64%), Gaps = 1/296 (0%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71
           S+  +L +  + T   +  G   +   +++DD + EELE+ L+ +D+G+    KI+  L 
Sbjct: 79  SFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLT 138

Query: 72  TKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
            K   + +     LY +  E + ++L  + +P   D   + +VIL+VGVNGVGKTT IGK
Sbjct: 139 AKASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTEKKTYVILMVGVNGVGKTTTIGK 198

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+K+    G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ Y+A + A+
Sbjct: 199 LAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAK 258

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE 250
           A+ +DV+I DTAGRL N S LM  + K++RV+K++D  APH ++  LDA TGQNA+ Q +
Sbjct: 259 ARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAK 318

Query: 251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           +F  VA  TG+ +TK+DGTA+GG +  I    +IP+ ++GVGE I+DL PF  ++F
Sbjct: 319 LFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEF 374


>gi|21243285|ref|NP_642867.1| cell division protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108823|gb|AAM37403.1| cell division protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 554

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     +++ L  +  +++ V  Q +   +   +  +L P
Sbjct: 276 KLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQAMFKALRADLIALLQP 335

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 336 VSKPLVIDRSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 395

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 396 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 455

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 456 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 515

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 516 AREFNIPIRFAGIGERPEDLRVF 538


>gi|156936373|ref|YP_001440289.1| cell division protein FtsY [Cronobacter sakazakii ATCC BAA-894]
 gi|156534627|gb|ABU79453.1| hypothetical protein ESA_04273 [Cronobacter sakazakii ATCC BAA-894]
          Length = 517

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 215 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVDTTRKIIANLTE 274

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 275 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 333

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 334 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 393

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD +APH V+  +DA+TGQNA+ Q ++
Sbjct: 394 RGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDENAPHEVMLTIDASTGQNAVSQAKL 453

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 454 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDF 508


>gi|166711627|ref|ZP_02242834.1| cell division protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 553

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 118/263 (44%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     ++E L  +  +++ +  Q +   +   +  +L P
Sbjct: 275 KLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFIDAQAMFKALRADLIALLQP 334

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D + +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 335 VSKPLVIDRARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 394

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 395 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 454

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 455 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 514

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 515 AREFNIPIRFAGIGERPEDLRVF 537


>gi|294667547|ref|ZP_06732762.1| cell division protein FtsY [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292602667|gb|EFF46103.1| cell division protein FtsY [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 497

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     +++ L  +  +++ V  Q +   +   +  +L P
Sbjct: 219 KLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQAMFKALRADLIALLQP 278

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 279 VSKPLVIDRSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 338

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 339 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 398

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 399 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 458

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 459 AREFNIPIRFAGIGERPEDLRVF 481


>gi|332345419|gb|AEE58753.1| signal recognition particle-docking protein FtsY [Escherichia coli
           UMNK88]
          Length = 498

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|254876344|ref|ZP_05249054.1| signal recognition particle receptor ftsY [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254842365|gb|EET20779.1| signal recognition particle receptor ftsY [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 334

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 196/297 (65%), Gaps = 2/297 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRL-DDGVREELEDLLIRSDIGVAVAQKIVEELLTKR 74
           +L  G + T+ K   G++ I+  +++ DD + E++E  L+ SD+GV    +I+E L  K 
Sbjct: 31  RLQSGLSKTASKFGSGLSTILMGQKVVDDELLEDIEMQLLTSDVGVEATDEIIEYLRGKV 90

Query: 75  YAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSK 133
              ++     L ++  + + ++++P  KP   +  + P+VIL+VGVNGVGKTT IGKL+K
Sbjct: 91  ARNELQTADKLNEIIQDKLTEIILPCQKPLQINHENTPYVILIVGVNGVGKTTTIGKLTK 150

Query: 134 KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193
           K+   G  V+LAAGDTFR+AA++QL+ W DR +   V  + G+D+A++ Y+A   A+++ 
Sbjct: 151 KLQSEGKSVILAAGDTFRAAAVEQLREWGDRNNTQVVYQKEGADSASVIYDAISSAKSRG 210

Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH 253
           +DV+I DTAGRLHN   LM  + K+++V+K++D  APH  + V+DATTG NAL Q E F+
Sbjct: 211 IDVVIADTAGRLHNKDNLMQELKKVVKVIKKVDDSAPHETMLVVDATTGGNALSQAEAFN 270

Query: 254 AVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            +   TG+ +TK+DGTA+GG +  I     +P+ F+GVGE I+DL+ F AK+F+  +
Sbjct: 271 EIVNLTGITITKLDGTAKGGIVFSIAKKMGLPLRFIGVGEKIDDLQVFNAKNFTKAL 327


>gi|168260700|ref|ZP_02682673.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168465148|ref|ZP_02699040.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195632106|gb|EDX50590.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205350194|gb|EDZ36825.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 491

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|204928517|ref|ZP_03219716.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204321950|gb|EDZ07148.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 491

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|168232718|ref|ZP_02657776.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194470486|ref|ZP_03076470.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194456850|gb|EDX45689.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205333169|gb|EDZ19933.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 491

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|194442699|ref|YP_002042816.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194401362|gb|ACF61584.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 491

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|16762733|ref|NP_458350.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144220|ref|NP_807562.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213053204|ref|ZP_03346082.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213426831|ref|ZP_03359581.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213585937|ref|ZP_03367763.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213650000|ref|ZP_03380053.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213859529|ref|ZP_03385233.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289829448|ref|ZP_06547060.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25300177|pir||AG0991 cell division protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16505039|emb|CAD08059.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139857|gb|AAO71422.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
          Length = 491

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|107099358|ref|ZP_01363276.1| hypothetical protein PaerPA_01000370 [Pseudomonas aeruginosa PACS2]
          Length = 454

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 148 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 206

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 207 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 266

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 267 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 326

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 327 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 386

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 387 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 443


>gi|254237391|ref|ZP_04930714.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           C3719]
 gi|126169322|gb|EAZ54833.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           C3719]
          Length = 456

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 150 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 208

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 209 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 268

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 269 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 328

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 329 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 388

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 389 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 445


>gi|332763553|gb|EGJ93792.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           2930-71]
 gi|332997161|gb|EGK16777.1| signal recognition particle-docking protein FtsY [Shigella flexneri
           K-218]
          Length = 516

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 214 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 273

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 274 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-DKTPFVILMVGVNGVGKTTTIGKL 332

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 333 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 392

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 393 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 452

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 453 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 507


>gi|16766857|ref|NP_462472.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|161616619|ref|YP_001590584.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167990787|ref|ZP_02571886.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197264581|ref|ZP_03164655.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|200388762|ref|ZP_03215374.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|16422131|gb|AAL22431.1| GTPase domain of cell division membrane protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|161365983|gb|ABX69751.1| hypothetical protein SPAB_04436 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197242836|gb|EDY25456.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|199605860|gb|EDZ04405.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205330664|gb|EDZ17428.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261248724|emb|CBG26562.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267995802|gb|ACY90687.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160110|emb|CBW19630.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914594|dbj|BAJ38568.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321226620|gb|EFX51670.1| Signal recognition particle receptor protein FtsY [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323131930|gb|ADX19360.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990422|gb|AEF09405.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 491

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|241667800|ref|ZP_04755378.1| signal recognition particle-docking protein FtsY [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 333

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 196/297 (65%), Gaps = 2/297 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRL-DDGVREELEDLLIRSDIGVAVAQKIVEELLTKR 74
           +L  G + T+ K   G++ I+  +++ DD + E++E  L+ SD+GV    +I+E L  K 
Sbjct: 30  RLQSGLSKTASKFGSGLSTILMGQKVVDDELLEDIEMQLLTSDVGVEATDEIIEYLRGKV 89

Query: 75  YAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSK 133
              ++     L ++  + + ++++P  KP   +  + P+VIL+VGVNGVGKTT IGKL+K
Sbjct: 90  ARNELQTADKLNEIIQDKLTEIILPCQKPLQINHENTPYVILIVGVNGVGKTTTIGKLTK 149

Query: 134 KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK 193
           K+   G  V+LAAGDTFR+AA++QL+ W DR +   V  + G+D+A++ Y+A   A+++ 
Sbjct: 150 KLQSEGKSVILAAGDTFRAAAVEQLREWGDRNNTQVVYQKEGADSASVIYDAISSAKSRG 209

Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFH 253
           +DV+I DTAGRLHN   LM  + K+++V+K++D  APH  + V+DATTG NAL Q E F+
Sbjct: 210 IDVVIADTAGRLHNKDNLMQELKKVVKVIKKVDDSAPHETMLVVDATTGGNALSQAEAFN 269

Query: 254 AVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVI 310
            +   TG+ +TK+DGTA+GG +  I     +P+ F+GVGE I+DL+ F AK+F+  +
Sbjct: 270 EIVNLTGITITKLDGTAKGGIVFSIAKKMGLPLRFIGVGEKIDDLQVFNAKNFTKAL 326


>gi|218889114|ref|YP_002437978.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           LESB58]
 gi|218769337|emb|CAW25097.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           LESB58]
          Length = 456

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 150 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 208

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 209 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 268

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 269 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 328

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 329 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 388

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 389 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 445


>gi|157964925|ref|YP_001499749.1| Signal recognition particle-docking protein FtsY [Rickettsia
           massiliae MTU5]
 gi|157844701|gb|ABV85202.1| Signal recognition particle-docking protein FtsY [Rickettsia
           massiliae MTU5]
          Length = 303

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 193/303 (63%), Gaps = 3/303 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           +S   KL +  + TS K+ EGI  I   ++LD    EELE+LLI SD+ V+V   I+EEL
Sbjct: 2   ISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAETLEELEELLISSDMSVSVVTNIIEEL 61

Query: 71  LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGK 130
              ++ K++    V   +++LI + L     PF     ++ +VILV GVNG GKTT IGK
Sbjct: 62  KKVKFDKEIDNHTVKEALAKLIEQQLSKSEIPFTLS-KNKLNVILVCGVNGAGKTTTIGK 120

Query: 131 LSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ 190
           L+   S  G KV +AA DTFR+AAI+QL  WADR +A  +  E  +D A++AY   +++ 
Sbjct: 121 LAAMYSAQGKKVAVAACDTFRAAAINQLSTWADRANALLITGEESADPASVAYRGMEESI 180

Query: 191 AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP-HSVLQVLDATTGQNALRQV 249
            + +D+L IDTAGRLHN   LM  + K+++V+K+LD +AP HSVL V+DA TGQN   QV
Sbjct: 181 KQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSVL-VIDAITGQNTYNQV 239

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAV 309
           E F+     TGLI+TK+DG+A+ G ++ +V    +P+YF+G+GE I DL+ F   DF+  
Sbjct: 240 EHFNDATNLTGLIVTKLDGSAKAGVIVRVVQKFNLPLYFIGIGEKIEDLKIFNRHDFARN 299

Query: 310 ITG 312
           + G
Sbjct: 300 LVG 302


>gi|311277611|ref|YP_003939842.1| signal recognition particle-docking protein FtsY [Enterobacter
           cloacae SCF1]
 gi|308746806|gb|ADO46558.1| signal recognition particle-docking protein FtsY [Enterobacter
           cloacae SCF1]
          Length = 475

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 173 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 232

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 233 GASRKQLRDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 291

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 292 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 351

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 352 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAISQAKL 411

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 412 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 466


>gi|168818612|ref|ZP_02830612.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205344537|gb|EDZ31301.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
          Length = 491

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|167549211|ref|ZP_02342970.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205354811|ref|YP_002228612.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858809|ref|YP_002245460.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|205274592|emb|CAR39642.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205325845|gb|EDZ13684.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|206710612|emb|CAR34970.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326629955|gb|EGE36298.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 491

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 482


>gi|134299913|ref|YP_001113409.1| signal recognition particle-docking protein FtsY [Desulfotomaculum
           reducens MI-1]
 gi|134052613|gb|ABO50584.1| signal recognition particle-docking protein FtsY [Desulfotomaculum
           reducens MI-1]
          Length = 309

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 194/304 (63%), Gaps = 3/304 (0%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  +L +    T     E I  +++ R  +D+ + EELE++LI++D+GV+ A K+VE 
Sbjct: 1   MGFFDRLKESLTKTRQSFIEKIDQVVTGRTGIDEDLYEELEEVLIQADVGVSTAMKLVER 60

Query: 70  LLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           +     A++V     L ++  E +  ++     P   +    P VI+VVGVNGVGKTT I
Sbjct: 61  VRKGVKARNVQEASRLKEIFQEELEYLMGEKITPIQLN-PEGPTVIMVVGVNGVGKTTTI 119

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GK++    + G KV+LAAGDTFR+AAIDQL+IWADR   D +  + GSD  A+AY+A   
Sbjct: 120 GKMAHNFKEQGKKVLLAAGDTFRAAAIDQLEIWADRVGVDIIKHQEGSDPGAVAYDAVHA 179

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+++K D+L++DTAGRLHN S LM  + K+ +++ R  P APH VL VLDATTGQNAL Q
Sbjct: 180 ARSRKADILLVDTAGRLHNKSNLMDELRKVHKIVAREMPGAPHEVLLVLDATTGQNALNQ 239

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308
           V++F      TG+ +TK+DGTA+GG +  IV    IPV  +G+GE ++DL PF  KDF  
Sbjct: 240 VKIFSEAVNVTGIALTKLDGTAKGGVVTSIVTEMAIPVKLIGIGERMDDLRPFNPKDFIN 299

Query: 309 VITG 312
            + G
Sbjct: 300 ALYG 303


>gi|294626162|ref|ZP_06704768.1| cell division protein FtsY [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292599514|gb|EFF43645.1| cell division protein FtsY [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 492

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 171/263 (65%), Gaps = 1/263 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     +++ L  +  +++ V  Q +   +   +  +L P
Sbjct: 214 KLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQAMFKALRADLIALLQP 273

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 274 VSKPLVIDRSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQL 333

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  DVLI DTAGRLH  + LM  +GK+
Sbjct: 334 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKI 393

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 394 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 453

Query: 279 VVTHKIPVYFLGVGEGINDLEPF 301
                IP+ F G+GE   DL  F
Sbjct: 454 AREFNIPIRFAGIGERPEDLRVF 476


>gi|294789648|ref|ZP_06754882.1| signal recognition particle-docking protein FtsY [Simonsiella
           muelleri ATCC 29453]
 gi|294482449|gb|EFG30142.1| signal recognition particle-docking protein FtsY [Simonsiella
           muelleri ATCC 29453]
          Length = 480

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 193/313 (61%), Gaps = 14/313 (4%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGV 60
           M  +++ S+ L W  +L +G   +  ++ + +  +    ++D+ + EELE  L+ SD+G+
Sbjct: 168 MPPEQIESDKLGWTARLKQGLTKSRNQMAKSLAGVFGGGKIDEDLYEELETTLLISDMGI 227

Query: 61  AVAQKIVEELLTKRYAKDVSVQRVLYDVSEL-------IHKMLMPLSKPFNWDFSHRPHV 113
              ++++ E+      K VS+ + L D +EL       ++++L PL KP     + +P V
Sbjct: 228 EATEQLMNEV-----RKRVSL-KGLKDGNELRTTLKDALYELLKPLEKPLEIPNNGQPFV 281

Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSE 173
           I++ G+NG GKTT IGKL+K     G  VMLAAGDTFR+AA +QL+ W  R     V S+
Sbjct: 282 IMMAGINGAGKTTSIGKLAKYFQAQGKSVMLAAGDTFRAAAREQLQEWGARNGV-TVISQ 340

Query: 174 IGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSV 233
              D+AA+ ++A + A+AKK+DV++ DTAGRL     LM  I K+ RVL++  P APH V
Sbjct: 341 ASGDSAAVCFDAVESAKAKKIDVVLADTAGRLPTQLHLMEEIKKVKRVLQKSMPDAPHEV 400

Query: 234 LQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGE 293
           + VLDA  GQNA+ QV  F    G TGLI+TK+DGTA+GG L  +     IPV ++GVGE
Sbjct: 401 MVVLDANIGQNAINQVVAFDDALGVTGLIVTKLDGTAKGGVLAALASNRPIPVRYIGVGE 460

Query: 294 GINDLEPFVAKDF 306
           GI+DL PF A+ F
Sbjct: 461 GIDDLRPFDARAF 473


>gi|325053854|pdb|2XXA|B Chain B, The Crystal Structure Of The Signal Recognition Particle
           (Srp) In Complex With Its Receptor(Sr)
 gi|325053856|pdb|2XXA|D Chain D, The Crystal Structure Of The Signal Recognition Particle
           (Srp) In Complex With Its Receptor(Sr)
          Length = 302

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 186/292 (63%), Gaps = 2/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L     
Sbjct: 3   RLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGAS 62

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL+++
Sbjct: 63  RKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKLARQ 121

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A+ +
Sbjct: 122 FEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNI 181

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++FH 
Sbjct: 182 DVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHE 241

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 242 AVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 293


>gi|296386871|ref|ZP_06876370.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           PAb1]
          Length = 453

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 147 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 205

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 206 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 265

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 266 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 325

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 326 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 385

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 386 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 442


>gi|15595570|ref|NP_249064.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           PAO1]
 gi|9946225|gb|AAG03762.1|AE004475_4 signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           PAO1]
          Length = 455

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 149 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 207

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 208 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 267

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 268 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 327

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 328 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 387

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 388 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 444


>gi|116054103|ref|YP_788546.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115589324|gb|ABJ15339.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 451

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 189/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 145 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 203

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 204 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 263

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 264 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 323

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 324 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 383

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           + F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 384 KQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 440


>gi|157368470|ref|YP_001476459.1| signal recognition particle-docking protein FtsY [Serratia
           proteamaculans 568]
 gi|157320234|gb|ABV39331.1| signal recognition particle-docking protein FtsY [Serratia
           proteamaculans 568]
          Length = 535

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 189/295 (64%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 233 FFARLKRSLVKTKQNLGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTQ 292

Query: 73  KRYAKDVSVQRVLY-DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY  + E + ++L  + +P +      P+VIL+VGVNGVGKTT IGKL
Sbjct: 293 HASRKQLKDAEALYGKLKEEMSEILAKVDQPLDVG-GKNPYVILMVGVNGVGKTTTIGKL 351

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A+A
Sbjct: 352 ARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKA 411

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVL+ DTAGRL N + LM  + K++RV+K+LD  APH V+ +LDA+TGQNA+ Q ++
Sbjct: 412 RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDDQAPHEVMLILDASTGQNAVSQAKL 471

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 472 FNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDF 526


>gi|158430492|pdb|2QY9|A Chain A, Structure Of The Ng+1 Construct Of The E. Coli Srp
           Receptor Ftsy
          Length = 309

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 186/292 (63%), Gaps = 2/292 (0%)

Query: 16  KLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRY 75
           +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L     
Sbjct: 4   RLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGAS 63

Query: 76  AKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKK 134
            K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL+++
Sbjct: 64  RKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKAPFVILMVGVNGVGKTTTIGKLARQ 122

Query: 135 MSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKV 194
               G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A+ +
Sbjct: 123 FEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNI 182

Query: 195 DVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA 254
           DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++FH 
Sbjct: 183 DVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHE 242

Query: 255 VAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 243 AVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 294


>gi|56415470|ref|YP_152545.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364399|ref|YP_002144036.1| cell division protein FtsY [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56129727|gb|AAV79233.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197095876|emb|CAR61450.1| cell division protein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 491

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 189 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIIANLTE 248

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 249 GASRKQLKDAEALYGLLKDEMGEILAKVDEPLNIE-GKTPFVILMVGVNGVGKTTTIGKL 307

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 308 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 367

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 368 RNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKL 427

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 428 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKAGDF 482


>gi|51892595|ref|YP_075286.1| signal recognition particle [Symbiobacterium thermophilum IAM
           14863]
 gi|51856284|dbj|BAD40442.1| signal recognition particle [Symbiobacterium thermophilum IAM
           14863]
          Length = 320

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 199/301 (66%), Gaps = 8/301 (2%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISS-RRLDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           +S+  +L  G   T   L   +  ++S  R++DD + +ELE+ LIR D+GVA + K+VEE
Sbjct: 16  VSFFERLKAGLQKTKEALIGQVNTVMSVFRKIDDDLFDELEEALIRGDVGVATSAKLVEE 75

Query: 70  LLTKRYAKDVSVQ---RVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126
           L  +R A+   ++    +L  + EL+ + L   + P   +      VILVVGVNGVGKTT
Sbjct: 76  L--RREARQKGLKNGDELLPLLKELVAERLGSGAAPLRLNEGGL-TVILVVGVNGVGKTT 132

Query: 127 VIGKLSKKM-SDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEA 185
            IGKL++ +  D GLKV+LAA DTFR+AA+DQLK+W +R  A+ V    G+D AA+A++ 
Sbjct: 133 TIGKLARHLREDRGLKVVLAAADTFRAAAMDQLKVWGERAGAEVVAGPEGADPAAVAFDG 192

Query: 186 FKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNA 245
            K A+A   DVLI+DTAGRLHN + LMA +GK+ RVL R  P APH  L VLDATTGQNA
Sbjct: 193 VKAARASGADVLIVDTAGRLHNKAHLMAELGKIARVLGREVPGAPHETLLVLDATTGQNA 252

Query: 246 LRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKD 305
           ++Q  +F      TG+ +TK+DGTA+GG ++ I  T ++PV F+GVGE ++DL+PF  + 
Sbjct: 253 IQQTRLFKETVPVTGIALTKLDGTAKGGVVVAIADTEQVPVKFIGVGERLDDLQPFDPRQ 312

Query: 306 F 306
           F
Sbjct: 313 F 313


>gi|322834886|ref|YP_004214913.1| signal recognition particle-docking protein FtsY [Rahnella sp.
           Y9602]
 gi|321170087|gb|ADW75786.1| signal recognition particle-docking protein FtsY [Rahnella sp.
           Y9602]
          Length = 493

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 190/300 (63%), Gaps = 12/300 (4%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 191 FFARLKRSLVKTKQNLGSGFVGLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTE 250

Query: 73  KRYAKDVSVQRVLY-----DVSELIHKMLMPLSKPFNWDFSHR-PHVILVVGVNGVGKTT 126
               K +     LY     ++SE++ K+  PL      D S + P+VIL+VGVNGVGKTT
Sbjct: 251 HASRKQLKDADALYGKLKEEMSEILAKVDEPL------DVSGKTPYVILMVGVNGVGKTT 304

Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186
            IGK++++    G  VMLAAGDTFR+AA++QL++W  R     +    G+D+A++ ++A 
Sbjct: 305 TIGKMARQFEAQGKSVMLAAGDTFRAAAVEQLQVWGQRNKIPVIAQHTGADSASVIFDAI 364

Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246
           + A+A+ +DVLI DTAGRL N + LM  + K++RV+K+LD  APH V+  LDA+TGQNA+
Sbjct: 365 QAAKARNIDVLIADTAGRLQNKTHLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAV 424

Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            Q ++F+   G TG+ +TK+DGTA+GG +  I     IP+ ++GVGEGI DL PF A DF
Sbjct: 425 SQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFKADDF 484


>gi|194427035|ref|ZP_03059587.1| cell division protein FtsY [Escherichia coli B171]
 gi|194414996|gb|EDX31266.1| cell division protein FtsY [Escherichia coli B171]
          Length = 497

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 186/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 DASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD   PH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVETPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|152972338|ref|YP_001337484.1| cell division protein FtsY [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|150957187|gb|ABR79217.1| cell division membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 507

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 205 FFARLKRSLLKTKQNLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 264

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 265 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 323

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 324 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 383

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 384 RHVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPHEVMLTIDASTGQNAISQAKL 443

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 444 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDF 498


>gi|152987106|ref|YP_001345863.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa
           PA7]
 gi|150962264|gb|ABR84289.1| cell division protein FtsY [Pseudomonas aeruginosa PA7]
          Length = 447

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 188/297 (63%), Gaps = 4/297 (1%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDL-LIRSDIGVAVAQKIVEELL 71
           +  +L +G + TS  + EG+  +   R+  D    +  +  L+ +D+GV     IV+ L 
Sbjct: 141 FFARLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNL- 199

Query: 72  TKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIG 129
           TKR A K+++    LY  + E +  +L P+ +P   D +  P+VILVVGVNGVGKTT IG
Sbjct: 200 TKRVARKELADSGALYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIG 259

Query: 130 KLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA 189
           KL+KK+   G KVMLAAGDTFR+AA++QL++W +R     +    G+D+A++ ++A + A
Sbjct: 260 KLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAA 319

Query: 190 QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV 249
           +A+ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q 
Sbjct: 320 KARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQA 379

Query: 250 EMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
             F+     TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL  F A  F
Sbjct: 380 RQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAF 436


>gi|238896927|ref|YP_002921672.1| cell division protein FtsY [Klebsiella pneumoniae NTUH-K2044]
 gi|238549254|dbj|BAH65605.1| cell division membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 507

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 205 FFARLKRSLLKTKQNLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 264

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 265 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 323

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 324 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 383

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 384 RHVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPHEVMLTIDASTGQNAISQAKL 443

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 444 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDF 498


>gi|21231854|ref|NP_637771.1| cell division protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66768019|ref|YP_242781.1| cell division protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188991144|ref|YP_001903154.1| Cell division protein FtsY [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113573|gb|AAM41695.1| cell division protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66573351|gb|AAY48761.1| cell division protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167732904|emb|CAP51100.1| Cell division protein FtsY [Xanthomonas campestris pv. campestris]
          Length = 546

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 172/268 (64%), Gaps = 1/268 (0%)

Query: 40  RLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKD-VSVQRVLYDVSELIHKMLMP 98
           +LDD + +E+E  LI +D+G+     +VE L  +  +++ V  Q +       +  +L P
Sbjct: 268 KLDDDLLDEIETALITADVGIGATTALVEGLRKRMKSREFVDAQAMFKAFRADLIALLQP 327

Query: 99  LSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL 158
           +SKP   D S +P V+L VGVNGVGKTT IGKL+K+  D G  +MLAAGDTFR+AA+ QL
Sbjct: 328 VSKPLVIDRSVKPFVVLTVGVNGVGKTTTIGKLAKRFKDDGHSLMLAAGDTFRAAAVAQL 387

Query: 159 KIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKM 218
           + W DR     +     +DAA++A++A + A+A+  +VLI DTAGRLH  + LM  +GK+
Sbjct: 388 QAWGDRNGVAVIAQGQNADAASVAFDALQAAKARGTEVLIADTAGRLHTQTGLMNELGKI 447

Query: 219 IRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPI 278
            RVL ++D  APH VL V+D TTGQNA+ Q+  FHA  G TGL++TK+DGTA+GG +  +
Sbjct: 448 RRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFAL 507

Query: 279 VVTHKIPVYFLGVGEGINDLEPFVAKDF 306
                IP+ F G+GE   DL  F  + F
Sbjct: 508 AREFGIPIRFAGIGERPEDLRVFDPEAF 535


>gi|288942586|ref|YP_003444826.1| signal recognition particle-docking protein FtsY [Allochromatium
           vinosum DSM 180]
 gi|288897958|gb|ADC63794.1| signal recognition particle-docking protein FtsY [Allochromatium
           vinosum DSM 180]
          Length = 422

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 167/258 (64%), Gaps = 1/258 (0%)

Query: 56  SDIGVAVAQKIVEELLTKRYAKDVS-VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVI 114
           +D+G+  + +++ +L  +   K ++  + +L  + E +  +L  +  P       +P V+
Sbjct: 165 ADVGIETSTRLIADLTARVKRKKITDPEALLAALKEDLRTILRAVDGPVKQPAPGKPQVV 224

Query: 115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI 174
           L+VGVNG GKTT IGKL+K++ + G  VMLAAGDTFR+AA++QL+ W +R     V    
Sbjct: 225 LMVGVNGAGKTTTIGKLAKRLQEEGNSVMLAAGDTFRAAAVEQLETWGERNGVPVVAQHT 284

Query: 175 GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL 234
           G+D+A++ ++A + A A+  DVLI DTAGRLH  + LM  + K+ RVLK+LDP APH V+
Sbjct: 285 GADSASVIFDALQAATARGADVLIADTAGRLHTKTNLMDELSKVARVLKKLDPEAPHEVM 344

Query: 235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG 294
            V+DATTGQNAL Q E FH   G TG+ +TK+DGTA+GG L  I    ++P+ F+GVGE 
Sbjct: 345 LVVDATTGQNALNQAEHFHRAVGLTGITLTKLDGTAKGGILFAIAERLRVPIRFIGVGES 404

Query: 295 INDLEPFVAKDFSAVITG 312
           I DL PF   +F   + G
Sbjct: 405 IEDLRPFDPDEFVEALLG 422


>gi|262040530|ref|ZP_06013771.1| signal recognition particle-docking protein FtsY [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|329999134|ref|ZP_08303335.1| signal recognition particle-docking protein FtsY [Klebsiella sp. MS
           92-3]
 gi|259042123|gb|EEW43153.1| signal recognition particle-docking protein FtsY [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|328538428|gb|EGF64549.1| signal recognition particle-docking protein FtsY [Klebsiella sp. MS
           92-3]
          Length = 517

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 215 FFARLKRSLLKTKQNLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 274

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 275 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 333

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 334 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 393

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 394 RHVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPHEVMLTIDASTGQNAISQAKL 453

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 454 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDF 508


>gi|290511957|ref|ZP_06551325.1| cell division protein FtsY [Klebsiella sp. 1_1_55]
 gi|289775747|gb|EFD83747.1| cell division protein FtsY [Klebsiella sp. 1_1_55]
          Length = 504

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 202 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 261

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 262 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 320

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 321 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 380

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 381 RHVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPHEVMLTIDASTGQNAISQAKL 440

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 441 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDF 495


>gi|281180493|dbj|BAI56823.1| ABC transporter permease component [Escherichia coli SE15]
          Length = 498

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGLRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|206578548|ref|YP_002236165.1| cell division protein FtsY [Klebsiella pneumoniae 342]
 gi|206567606|gb|ACI09382.1| cell division protein FtsY [Klebsiella pneumoniae 342]
          Length = 507

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 205 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 264

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 265 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 323

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 324 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 383

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + VDVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 384 RHVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPHEVMLTIDASTGQNAISQAKL 443

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 444 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDF 498


>gi|91212953|ref|YP_542939.1| cell division protein FtsY [Escherichia coli UTI89]
 gi|218560532|ref|YP_002393445.1| cell division protein FtsY [Escherichia coli S88]
 gi|237703211|ref|ZP_04533692.1| cell division protein FtsY [Escherichia sp. 3_2_53FAA]
 gi|91074527|gb|ABE09408.1| cell division protein FtsY [Escherichia coli UTI89]
 gi|218367301|emb|CAR05079.1| fused Signal Recognition Particle (SRP) receptor: membrane binding
           protein ; conserved hypothetical protein [Escherichia
           coli S88]
 gi|226902475|gb|EEH88734.1| cell division protein FtsY [Escherichia sp. 3_2_53FAA]
 gi|294490549|gb|ADE89305.1| cell division protein FtsY [Escherichia coli IHE3034]
 gi|307628537|gb|ADN72841.1| cell division protein FtsY [Escherichia coli UM146]
 gi|315286125|gb|EFU45563.1| signal recognition particle-docking protein FtsY [Escherichia coli
           MS 110-3]
 gi|323950132|gb|EGB46015.1| signal recognition particle-docking protein FtsY [Escherichia coli
           H252]
          Length = 498

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 186/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQN + Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNGVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|146309189|ref|YP_001189654.1| signal recognition particle-docking protein FtsY [Pseudomonas
           mendocina ymp]
 gi|145577390|gb|ABP86922.1| signal recognition particle-docking protein FtsY [Pseudomonas
           mendocina ymp]
          Length = 475

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 197/298 (66%), Gaps = 4/298 (1%)

Query: 12  SWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL 70
           S+  +L +G + TS  L EG+  + +  + +DD + ++LE  L+ +D+GV     I+  L
Sbjct: 168 SFFARLKQGLSKTSASLGEGMASLFLGKKAIDDDLLDDLETRLLTADVGVEATTTIIGNL 227

Query: 71  LTKRYA-KDVSVQRVLYD-VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
            TKR A K+++    LY  + E +  +L P+ +P   D + +P+VILVVGVNGVGKTT I
Sbjct: 228 -TKRVARKELADSGALYKALQEELVTLLKPVEQPLVIDSAKQPYVILVVGVNGVGKTTTI 286

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+KK+   G KVMLAAGDTFR+AA++QL++W +R +   +    G+D+A++ ++A + 
Sbjct: 287 GKLAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNNIAVIAQHTGADSASVIFDAVQA 346

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+++ +DVLI DTAGRLH    LM  + K+ RV+ +LD  APH VL VLDA TGQNA+ Q
Sbjct: 347 AKSRGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAISQ 406

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            + F      TGL +TK+DGTA+GG +  +     +P+ ++GVGEGI+DL PF A+ F
Sbjct: 407 AKQFDQTVNLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRPFEAQAF 464


>gi|258546171|ref|ZP_05706405.1| signal recognition particle-docking protein FtsY [Cardiobacterium
           hominis ATCC 15826]
 gi|258518596|gb|EEV87455.1| signal recognition particle-docking protein FtsY [Cardiobacterium
           hominis ATCC 15826]
          Length = 428

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 189/304 (62%), Gaps = 7/304 (2%)

Query: 5   KVASESLSWIRKLTKGFASTSLKLKEGITDI-ISSRRLDDGVREELEDLLIRSDIGVAVA 63
           K  +ES  +  ++ +G A T    + G  D+ +  + LD  + ++LE  L+ +D+G+ V 
Sbjct: 122 KPKNESGGYFARIRQGLAKT----RRGFADLFLGKKTLDQDLIDDLETQLLTADVGIEVT 177

Query: 64  QKIVEELLTKRYAKDVS-VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGV 122
           + I++ +  +   K++  V+ V   V + + ++L P ++P +   + +P VIL+ G+NG 
Sbjct: 178 RNIIDSVTAQIDRKELKDVEAVKAAVRDHMQQLLAPYAQPLDTSRT-KPFVILMTGINGA 236

Query: 123 GKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA 182
           GKTT IGKL++     G KVMLAAGDTFR+AA++QL+ W  R +   +    G+DAA++A
Sbjct: 237 GKTTTIGKLARYFQQEGKKVMLAAGDTFRAAAVEQLQTWGARHNVPVIAQGTGADAASVA 296

Query: 183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG 242
           Y+A + A A+ +DVLIIDTAGRLH    LM  + K+ RV+ +LDP APH  + ++DA  G
Sbjct: 297 YDALQSATARGIDVLIIDTAGRLHTQDHLMEELKKIKRVIAKLDPAAPHETMLIIDAGNG 356

Query: 243 QNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFV 302
           QNALRQ E FH       + +TK+DGTA+GG L  I     IP+ ++GVGE   DL PF 
Sbjct: 357 QNALRQAEQFHKAMQLDSITVTKLDGTAKGGILFAISEKLGIPIRYIGVGEQPEDLRPFN 416

Query: 303 AKDF 306
           A++F
Sbjct: 417 AQEF 420


>gi|331674949|ref|ZP_08375706.1| cell division protein FtsY [Escherichia coli TA280]
 gi|331067858|gb|EGI39256.1| cell division protein FtsY [Escherichia coli TA280]
          Length = 527

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 225 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 284

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  + + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 285 GASRKQLRDAEALYGLLKDEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 343

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 344 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 403

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 404 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 463

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 464 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 518


>gi|82545827|ref|YP_409774.1| cell division protein FtsY [Shigella boydii Sb227]
 gi|187733547|ref|YP_001882149.1| cell division protein FtsY [Shigella boydii CDC 3083-94]
 gi|81247238|gb|ABB67946.1| cell division membrane protein [Shigella boydii Sb227]
 gi|187430539|gb|ACD09813.1| cell division protein FtsY [Shigella boydii CDC 3083-94]
 gi|320187768|gb|EFW62443.1| cell division protein FtsY [Shigella flexneri CDC 796-83]
          Length = 497

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 195 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 254

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 255 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 313

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 314 ARQFELQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 373

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQNA+ Q ++
Sbjct: 374 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKL 433

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 434 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 488


>gi|254482617|ref|ZP_05095855.1| signal recognition particle-docking protein FtsY [marine gamma
           proteobacterium HTCC2148]
 gi|214036976|gb|EEB77645.1| signal recognition particle-docking protein FtsY [marine gamma
           proteobacterium HTCC2148]
          Length = 372

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 130/318 (40%), Positives = 199/318 (62%), Gaps = 4/318 (1%)

Query: 1   MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIG 59
            +N     +      +L +G   TS  L +G+ ++   R+ +D+ + EELE  L+ +D+G
Sbjct: 54  FTNDAAPQDKPGIFGRLRRGLGRTSDSLVQGLGNLFLGRKEIDEELLEELESRLLMADVG 113

Query: 60  VAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLM-PLSKPFNWDFSHRPHVILVVG 118
           +     I+++L+ +   K+++   +L    +     L+ P  +P +    H+P+VIL+VG
Sbjct: 114 IEATMDIIDKLMLRVSRKELTNPELLQGALKEELLSLLKPCEQPLSVS-GHQPYVILMVG 172

Query: 119 VNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA 178
           VNGVGKTT IGKL+K+    G  VMLAAGDTFR+AA++QL++W DR S   V    G+D+
Sbjct: 173 VNGVGKTTTIGKLAKRFQSQGKSVMLAAGDTFRAAAVEQLQVWGDRNSVPVVAQHTGADS 232

Query: 179 AALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLD 238
           A++ ++A + AQA+ +DVLI DTAGRLHN   LM  + K++RV+ +LD  APH V+ VLD
Sbjct: 233 ASVIFDALQAAQARNIDVLIADTAGRLHNKDNLMEELKKVVRVMGKLDQSAPHEVMLVLD 292

Query: 239 ATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDL 298
           A TGQNAL Q + F    G +G+ +TK+DGTA+GG +  I     +P+ F+G+GE ++DL
Sbjct: 293 AGTGQNALAQADHFQQWVGVSGISLTKLDGTAKGGVIFAIAKKLGLPIRFIGIGEAVDDL 352

Query: 299 EPFVAKDF-SAVITGCLD 315
            PF A+ F  A+  G  D
Sbjct: 353 RPFEAEPFIEALFAGNED 370


>gi|117625742|ref|YP_859065.1| cell division protein FtsY [Escherichia coli APEC O1]
 gi|115514866|gb|ABJ02941.1| cell division protein FtsY [Escherichia coli APEC O1]
          Length = 498

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 186/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 196 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 255

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 256 GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVE-GKTPFVILMVGVNGVGKTTTIGKL 314

Query: 132 SKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQA 191
           +++    G  VMLAAGDTFR+AA++QL++W  R +   +    G+D+A++ ++A + A+A
Sbjct: 315 ARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKA 374

Query: 192 KKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEM 251
           + +DVLI DTAGRL N S LM  + K++RV+K+LD  APH V+  +DA+TGQN + Q ++
Sbjct: 375 RNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNGVSQAKL 434

Query: 252 FHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
           FH   G TG+ +TK+DGTA+GG +  +     IP+ ++GVGE I DL PF A DF
Sbjct: 435 FHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDF 489


>gi|296133560|ref|YP_003640807.1| signal recognition particle-docking protein FtsY [Thermincola sp.
           JR]
 gi|296032138|gb|ADG82906.1| signal recognition particle-docking protein FtsY [Thermincola
           potens JR]
          Length = 304

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 194/298 (65%), Gaps = 3/298 (1%)

Query: 11  LSWIRKLTKGFASTSLKLKEGITDIISSRR-LDDGVREELEDLLIRSDIGVAVAQKIVEE 69
           + +  KL +    T     E I  +++ R+ +D+ + EELE+ LI+SD+G+  A ++VEE
Sbjct: 1   MGFFSKLKEKLTKTREGFVEKIESLVTGRKKIDEELYEELEEALIQSDVGINTALELVEE 60

Query: 70  LLTKRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128
           L  +   + V     L ++  E+I ++LM        +   +P+VI+VVGVNGVGKTT I
Sbjct: 61  LRRRVKERKVEDAAELKNILQEIITEVLMDDESRLELE-KGKPNVIMVVGVNGVGKTTTI 119

Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188
           GKL+ ++   G KV+LAAGDTFR+AAIDQL+IW++R   D +  +  +D AA+ ++A + 
Sbjct: 120 GKLAYQIKVGGRKVLLAAGDTFRAAAIDQLEIWSNRVGCDIIKHKENADPAAVVFDAIQA 179

Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248
           A+A+ +DVLIIDTAGRLH  S LM  + K+ RV+ R  P APH VL VLDATTGQNA+ Q
Sbjct: 180 ARARNIDVLIIDTAGRLHTKSNLMEELKKVYRVINREMPDAPHEVLLVLDATTGQNAISQ 239

Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306
            ++F    G TG+++TK+DGTA+GG +I I     +PV  +GVGE I DL PF   +F
Sbjct: 240 AKLFGEAVGVTGIVLTKLDGTAKGGVIIGIKKELDVPVKLIGVGEQIEDLRPFKPGEF 297


>gi|288933155|ref|YP_003437214.1| signal recognition particle-docking protein FtsY [Klebsiella
           variicola At-22]
 gi|288887884|gb|ADC56202.1| signal recognition particle-docking protein FtsY [Klebsiella
           variicola At-22]
          Length = 507

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 13  WIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT 72
           +  +L +    T   L  G   +   +++DD + EELE+ L+ +D+GV   +KI+  L  
Sbjct: 205 FFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE 264

Query: 73  KRYAKDVSVQRVLYDV-SELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131
               K +     LY +  E + ++L  + +P N +    P VIL+VGVNGVGKTT IGKL
Sbjct: 26