RPSBLAST alignment for GI: 254780709 and conserved domain: PRK06995

>gnl|CDD|180787 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated. Length = 484
 Score = 42.7 bits (101), Expect = 1e-04
 Identities = 57/193 (29%), Positives = 89/193 (46%), Gaps = 44/193 (22%)

Query: 117 VGVNGVGKTTVIGKLSKK--MSDAGLKVMLAAGDTFRSAAIDQLKIW---------ADRT 165
           +G  GVGKTT   KL+ +  M     KV L   D++R    +QL+I+         A + 
Sbjct: 262 MGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKILGVPVHAVK- 320

Query: 166 SADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAG-----RLHNNSILM-AGIGKMI 219
                      DAA L   A  + + K + VLI DT G     R+ +  I M  G G  +
Sbjct: 321 -----------DAADLRL-ALSELRNKHI-VLI-DTIGMSQRDRMVSEQIAMLHGAGAPV 366

Query: 220 RVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIV 279
              KRL          +L+AT+  + L +V   +   G  G I+TK+D  A  GG + +V
Sbjct: 367 ---KRL---------LLLNATSHGDTLNEVVQAYRGPGLAGCILTKLDEAASLGGALDVV 414

Query: 280 VTHKIPVYFLGVG 292
           + +K+P++++  G
Sbjct: 415 IRYKLPLHYVSNG 427