RPSBLAST alignment for GI: 254780709 and conserved domain: PRK11889

>gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional. Length = 436
 Score = 57.0 bits (137), Expect = 6e-09
 Identities = 56/239 (23%), Positives = 101/239 (42%), Gaps = 18/239 (7%)

Query: 64  QKIVEELLTKRYAKDVSVQ---RVLYDVSELIHKMLMPLSKPFNWD--FSHRPHVILVVG 118
           Q  VE+     YA+ + V+     +    E+I  +L  +   FN +  F      I ++G
Sbjct: 189 QNDVEQYFIHAYAEKLKVKFENATMITEEEVIEYILEDMRSHFNTENVFEKEVQTIALIG 248

Query: 119 VNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDA 178
             GVGKTT + K++ +       V     D  R   + QL+ +      + +      D 
Sbjct: 249 PTGVGKTTTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQLQDYVKTIGFEVIAVR---DE 305

Query: 179 AAL--AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV 236
           AA+  A   FK  +  +VD ++IDTAG+ +  S     + +MI  + +++   P  +   
Sbjct: 306 AAMTRALTYFK--EEARVDYILIDTAGKNYRAS---ETVEEMIETMGQVE---PDYICLT 357

Query: 237 LDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGI 295
           L A+     + ++          G++ TK D TA  G L+ I      P+  +  G+ +
Sbjct: 358 LSASMKSKDMIEIITNFKDIHIDGIVFTKFDETASSGELLKIPAVSSAPIVLMTDGQDV 416