RPSBLAST alignment for GI: 254780709 and conserved domain: COG1703

>gnl|CDD|31889 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]. Length = 323
 Score = 43.4 bits (102), Expect = 8e-05
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 10/106 (9%)

Query: 108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKIWADR 164
           +   HVI + GV G GK+T+I  L +++ + G +V + A D    F   +I   +I   R
Sbjct: 48  TGNAHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIRMQR 107

Query: 165 TSAD---FVCS----EIGSDAAALAYEAFKQAQAKKVDVLIIDTAG 203
            + D   F+ S          +    EA K   A   DV+I++T G
Sbjct: 108 LAVDPGVFIRSSPSRGTLGGLSRATREAIKLLDAAGYDVIIVETVG 153