RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] (321 letters) >gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 340 Score = 312 bits (801), Expect = 7e-86 Identities = 136/312 (43%), Positives = 196/312 (62%), Gaps = 10/312 (3%) Query: 4 QKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRR---LDDGVREELEDLLIRSDIGV 60 + E W +L +G + T +GI + + LD+ + EELE+LLI +D+GV Sbjct: 24 EDEEEEKEGWFERLKQGLSKTKKNFGKGIKGLFLKKIKEKLDEDLLEELEELLIEADVGV 83 Query: 61 AVAQKIVEELLTKRYAKDVS------VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVI 114 A++I+EEL KR K V+ L + I + + + P +P VI Sbjct: 84 ETAEEIIEEL-RKREGKKKKIKDEETVKEALREALIEILRPVDKVDLPLEIPKEKKPFVI 142 Query: 115 LVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI 174 L VGVNGVGKTT I KL+K + G V+LAAGDTFR+AAI+QL++W +R + + Sbjct: 143 LFVGVNGVGKTTTIAKLAKYLKQQGKSVLLAAGDTFRAAAIEQLEVWGERLGVPVISGKE 202 Query: 175 GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVL 234 G+D AA+A++A + A+A+ +DV++IDTAGRLHN LM + K++RV+K+ DP APH +L Sbjct: 203 GADPAAVAFDAIQAAKARGIDVVLIDTAGRLHNKKNLMDELKKIVRVIKKDDPDAPHEIL 262 Query: 235 QVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEG 294 VLDATTGQNAL Q ++F+ G G+I+TK+DGTA+GG ++ I IP+ F+GVGEG Sbjct: 263 LVLDATTGQNALSQAKIFNEAVGLDGIILTKLDGTAKGGIILSIAYELGIPIKFIGVGEG 322 Query: 295 INDLEPFVAKDF 306 +DL PF A+ F Sbjct: 323 YDDLRPFDAEWF 334 >gnl|CDD|144151 pfam00448, SRP54, SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins. Length = 196 Score = 248 bits (635), Expect = 2e-66 Identities = 97/202 (48%), Positives = 133/202 (65%), Gaps = 6/202 (2%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV 170 P+VIL+VG+ G GKTT I KL+ + G KV+L A DTFR+AAI+QLK A+R Sbjct: 1 PNVILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAIEQLKQLAERLGVPVF 60 Query: 171 CSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP 230 S GSD AA+A++A ++A+A+ DV+++DTAGRL N+ LM + K+ RV+ P Sbjct: 61 GSGTGSDPAAVAFDAVEKAKAENYDVVLVDTAGRLQNDKNLMDELKKIKRVIA------P 114 Query: 231 HSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLG 290 VL VLDATTGQNAL Q + F+ G TG+I+TK+DG A+GG + I P+ F+G Sbjct: 115 DEVLLVLDATTGQNALNQAKAFNEAVGITGVILTKLDGDAKGGAALSIAAETGKPIKFIG 174 Query: 291 VGEGINDLEPFVAKDFSAVITG 312 VGE I+DLEPF + F + + G Sbjct: 175 VGEKIDDLEPFDPERFVSRLLG 196 >gnl|CDD|30887 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 451 Score = 206 bits (526), Expect = 7e-54 Identities = 102/304 (33%), Positives = 162/304 (53%), Gaps = 22/304 (7%) Query: 21 FASTSLKLKEGITDIISSRRLD-DGVREELEDL---LIRSDIGVAVAQKIVEELLTKRYA 76 F S S +L + + R+ V+E L ++ L+ +D+ + V + ++ + + Sbjct: 2 FESLSDRLSNALKKLRGKGRITEKDVKEALREIRRALLEADVNLKVVKDFIKRIKERALG 61 Query: 77 KDVS--------VQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVI 128 ++V +++Y+ EL+ K+L + N P VIL+VG+ G GKTT Sbjct: 62 EEVPKGLTPGQQFIKIVYE--ELV-KLLGGENSELNLA-KKPPTVILMVGLQGSGKTTTA 117 Query: 129 GKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ 188 GKL+K + G KV+L A DT+R AAI+QLK A++ F S D +A A ++ Sbjct: 118 GKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQVGVPFFGSGTEKDPVEIAKAALEK 177 Query: 189 AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ 248 A+ + DV+I+DTAGRLH + LM + ++ V+ P L V+DA GQ+A+ Sbjct: 178 AKEEGYDVVIVDTAGRLHIDEELMDELKEIKEVIN------PDETLLVVDAMIGQDAVNT 231 Query: 249 VEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSA 308 + F+ G TG+I+TK+DG ARGG + P+ F+G GE I+DLEPF F++ Sbjct: 232 AKAFNEALGITGVILTKLDGDARGGAALSARAITGKPIKFIGTGEKIDDLEPFHPDRFAS 291 Query: 309 VITG 312 I G Sbjct: 292 RILG 295 >gnl|CDD|35999 KOG0780, KOG0780, KOG0780, Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]. Length = 483 Score = 200 bits (509), Expect = 5e-52 Identities = 96/309 (31%), Positives = 149/309 (48%), Gaps = 25/309 (8%) Query: 15 RKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEEL---- 70 R++T F+ S I L+ ++E + L+ SD+ + +++ E + Sbjct: 8 RRITSAFSRMSN------ATSIDETALNTMLKE-ICRALLESDVNPRLVKELRENIRKII 60 Query: 71 ----LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126 L K +Q+ ++D EL+ K+L P +P VI+ VG+ G GKTT Sbjct: 61 NLEKLASGVNKRRIIQKAVFD--ELV-KLLDPGKSALQPKKG-KPSVIMFVGLQGSGKTT 116 Query: 127 VIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAF 186 KL+ G KV L DTFR+ A DQLK A + F S +D +A E Sbjct: 117 TCTKLAYYYKKKGYKVALVCADTFRAGAFDQLKQNATKARVPFYGSYTEADPVKIASEGV 176 Query: 187 KQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNAL 246 + + + DV+I+DT+GR + L +M +V K + P ++ V+DA+ GQ A Sbjct: 177 DRFKKENFDVIIVDTSGRHKQEASLFE---EMKQVSKAIK---PDEIIFVMDASIGQAAE 230 Query: 247 RQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDF 306 Q F +I+TK+DG A+GGG + V K P+ F+G GE ++DLEPF K F Sbjct: 231 AQARAFKETVDVGAVILTKLDGHAKGGGALSAVAATKSPIIFIGTGEHMDDLEPFDPKPF 290 Query: 307 SAVITGCLD 315 + + G D Sbjct: 291 VSRLLGMGD 299 >gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.. Length = 173 Score = 189 bits (483), Expect = 6e-49 Identities = 74/179 (41%), Positives = 107/179 (59%), Gaps = 6/179 (3%) Query: 112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVC 171 VIL+VG+ GVGKTT KL+ + G KV+L A DT+R AAI+QL++ ++ Sbjct: 1 TVILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQVGVPVFE 60 Query: 172 SEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPH 231 G D ++A A + A+ + DV+I+DTAGRL + LM + K+ RV+K P Sbjct: 61 EGEGKDPVSIAKRAIEHAREENFDVVIVDTAGRLQIDENLMEELKKIKRVVK------PD 114 Query: 232 SVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLG 290 VL V+DA TGQ+A+ Q + F+ G TG+I+TK+DG ARGG + I P+ F+G Sbjct: 115 EVLLVVDAMTGQDAVNQAKAFNEALGITGVILTKLDGDARGGAALSIRAVTGKPIKFIG 173 >gnl|CDD|36000 KOG0781, KOG0781, KOG0781, Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]. Length = 587 Score = 130 bits (329), Expect = 4e-31 Identities = 94/314 (29%), Positives = 155/314 (49%), Gaps = 32/314 (10%) Query: 18 TKGFASTSLKLKEGITDIISSRRLDDG-VREELEDLLIRSDIGVAVAQKIVEELLTKRYA 76 TK + L +G+ S D V +++ + LI ++ +A+K+ E + Sbjct: 273 TKKTVGGAFGLFKGLVGSKSLSEEDLNPVLDKMTEHLITKNVAAEIAEKLCESVAASLEG 332 Query: 77 KDV-SVQRVLYDVSELIHKMLMPLSKP-FNWDFSH---------RPHVILVVGVNGVGKT 125 K V S V V E + L+ + P + D RP+VI VGVNGVGK+ Sbjct: 333 KKVGSFSTVESTVKEALRDALVQILTPQRSVDLLRDIMSARRRKRPYVISFVGVNGVGKS 392 Query: 126 TVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR------TSADFVCSEIGSDAA 179 T + K++ + +V++AA DTFRS A++QL+ +R T + G DAA Sbjct: 393 TNLAKIAYWLLQNKFRVLIAACDTFRSGAVEQLRTHVERLSALHGTMVELFEKGYGKDAA 452 Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA 239 +A EA ++A+ + DV++IDTAGR+HNN+ LM + K+I+V K P +L V +A Sbjct: 453 GVAKEAIQEARNQGFDVVLIDTAGRMHNNAPLMTSLAKLIKVNK------PDLILFVGEA 506 Query: 240 TTGQNALRQVEMFHAVAG-------TTGLIMTKMDGTA-RGGGLIPIVVTHKIPVYFLGV 291 G +++ Q++ F+ G+++TK D + G + +V P+ F+GV Sbjct: 507 LVGNDSVDQLKKFNRALADHSTPRLIDGILLTKFDTVDDKVGAAVSMVYITGKPILFVGV 566 Query: 292 GEGINDLEPFVAKD 305 G+ +DL K Sbjct: 567 GQTYSDLRKLNVKA 580 >gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion]. Length = 407 Score = 93.1 bits (231), Expect = 1e-19 Identities = 53/189 (28%), Positives = 90/189 (47%), Gaps = 18/189 (9%) Query: 113 VILVVGVNGVGKTTVIGKLSK--KMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV 170 VI +VG GVGKTT + KL+ M KV + DT+R A++QLK +AD Sbjct: 205 VIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAIITTDTYRIGAVEQLKTYADIMGVPLE 264 Query: 171 CSEIGSDAAALAYEAFKQA--QAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPH 228 + + +A + DV+++DTAGR + + + ++I V ++ Sbjct: 265 --------VVYSPKELAEAIEALRDCDVILVDTAGRSQYDKEKIEELKELIDVSHSIE-- 314 Query: 229 APHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYF 288 V VL ATT L+++ ++ GLI TK+D T G L ++ ++PV + Sbjct: 315 ----VYLVLSATTKYEDLKEIIKQFSLFPIDGLIFTKLDETTSLGNLFSLMYETRLPVSY 370 Query: 289 LGVGEGIND 297 + G+ + + Sbjct: 371 VTNGQRVPE 379 >gnl|CDD|145830 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain. Length = 77 Score = 53.4 bits (129), Expect = 9e-08 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Query: 17 LTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYA 76 L +G + T KL I D+ + D + EELE+ L+ +D+GV +KI+E L Sbjct: 1 LKEGLSKTRSKLGGKIKDLFLGEKKIDELLEELEEALLEADVGVETTEKIIERLKELVGR 60 Query: 77 KDVS----VQRVLYD 87 K +S +++ L + Sbjct: 61 KGLSDPEEIKKALKE 75 >gnl|CDD|31889 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]. Length = 323 Score = 43.4 bits (102), Expect = 8e-05 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 10/106 (9%) Query: 108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKIWADR 164 + HVI + GV G GK+T+I L +++ + G +V + A D F +I +I R Sbjct: 48 TGNAHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIRMQR 107 Query: 165 TSAD---FVCS----EIGSDAAALAYEAFKQAQAKKVDVLIIDTAG 203 + D F+ S + EA K A DV+I++T G Sbjct: 108 LAVDPGVFIRSSPSRGTLGGLSRATREAIKLLDAAGYDVIIVETVG 153 >gnl|CDD|112137 pfam03308, ArgK, ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems. Length = 267 Score = 39.3 bits (92), Expect = 0.001 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 10/104 (9%) Query: 110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKIWADRTS 166 R H + + GV G GK+T+I L ++ G +V + A D F +I + R + Sbjct: 28 RAHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRTRMQRLA 87 Query: 167 AD---FVCSEIGSDA----AALAYEAFKQAQAKKVDVLIIDTAG 203 D F+ S A + EA A DV+II+T G Sbjct: 88 VDPGAFIRSSPSRGALGGLSRATREAILLLDAAGFDVIIIETVG 131 >gnl|CDD|30875 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]. Length = 197 Score = 37.1 bits (86), Expect = 0.007 Identities = 15/43 (34%), Positives = 22/43 (51%) Query: 109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR 151 + VI G++G GK+T+ L +K+ G V L GD R Sbjct: 21 QKGAVIWFTGLSGSGKSTIANALEEKLFAKGYHVYLLDGDNVR 63 >gnl|CDD|48378 cd03114, ArgK-like, The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.. Length = 148 Score = 35.6 bits (82), Expect = 0.019 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 10/101 (9%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKIWADRTSAD- 168 VI + GV G GK+T+I L + G +V + A D F AI +I +R ++D Sbjct: 1 VIGITGVPGAGKSTLIDALITALRARGKRVAVLAIDPSSPFSGGAILGDRIRMERHASDP 60 Query: 169 --FVCS----EIGSDAAALAYEAFKQAQAKKVDVLIIDTAG 203 F+ S + E + A DV+I++T G Sbjct: 61 GVFIRSLATRGFLGGLSRATPEVIRVLDAAGFDVIIVETVG 101 >gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.. Length = 99 Score = 35.5 bits (81), Expect = 0.021 Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA 145 VI+V G GVGKTT+ L+ ++ G +V+L Sbjct: 1 VIVVTGKGGVGKTTLAANLAAALAKRGKRVLLI 33 >gnl|CDD|30586 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme metabolism]. Length = 201 Score = 34.1 bits (78), Expect = 0.046 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 8/84 (9%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIW---ADRTSADF 169 +I + G G GK+TV +K +++ G V + A D R + A+R + Sbjct: 4 IIGLTGGIGSGKSTV----AKILAELGFPV-IDADDVAREVVEPGGEALQEIAERFGLEI 58 Query: 170 VCSEIGSDAAALAYEAFKQAQAKK 193 + + G D L + F +A+ Sbjct: 59 LDEDGGLDRRKLREKVFNDPEARL 82 >gnl|CDD|73298 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.. Length = 217 Score = 34.1 bits (78), Expect = 0.046 Identities = 14/36 (38%), Positives = 22/36 (61%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 VI G GVGKTT+ + ++++ G KV+L + D Sbjct: 1 VIFFTGKGGVGKTTIAAATAVRLAEEGKKVLLVSTD 36 >gnl|CDD|110578 pfam01583, APS_kinase, Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif. Length = 157 Score = 34.2 bits (79), Expect = 0.051 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR 151 R + G++G GK+T+ L +K+ G+ V + GD R Sbjct: 1 RGCTVWFTGLSGSGKSTIANALERKLFAQGISVYVLDGDNVR 42 >gnl|CDD|30352 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 322 Score = 33.8 bits (77), Expect = 0.072 Identities = 13/39 (33%), Positives = 23/39 (58%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT 149 ++ G GVGKTT+ + K++++G KV+L + D Sbjct: 2 TRIVFFTGKGGVGKTTIAAATAVKLAESGKKVLLVSTDP 40 >gnl|CDD|39857 KOG4658, KOG4658, KOG4658, Apoptotic ATPase [Signal transduction mechanisms]. Length = 889 Score = 33.0 bits (75), Expect = 0.10 Identities = 28/134 (20%), Positives = 48/134 (35%), Gaps = 21/134 (15%) Query: 9 ESLSWIRKLT--KGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKI 66 + S R+ GF S ++ +R+ +RE +E L + V Sbjct: 92 STRSVERQRLCLCGFCSKNVSDSYKY-----GKRVSKVLRE-VESLGSKGVFEVVGESLD 145 Query: 67 VEELLTKRYAKDVSVQRV-LYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKT 125 E + R S V L + E + LM ++ + G+ GVGKT Sbjct: 146 PREKVETRP--IQSESDVGLETMLEKLWNRLM----------EDDVGIVGIYGMGGVGKT 193 Query: 126 TVIGKLSKKMSDAG 139 T+ ++ K + G Sbjct: 194 TLARQIFNKFDEVG 207 >gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.. Length = 372 Score = 33.3 bits (76), Expect = 0.10 Identities = 23/93 (24%), Positives = 49/93 (52%), Gaps = 14/93 (15%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD---- 168 VIL+ G G+GK+T++ +++ +++ G KV+ +G+ + +Q+K+ ADR Sbjct: 84 VILIGGDPGIGKSTLLLQVAARLAKRGGKVLYVSGE----ESPEQIKLRADRLGISTENL 139 Query: 169 FVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDT 201 ++ +E + + K D++IID+ Sbjct: 140 YLLAETNLEDIL------ASIEELKPDLVIIDS 166 >gnl|CDD|37019 KOG1808, KOG1808, KOG1808, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 1856 Score = 32.7 bits (74), Expect = 0.13 Identities = 24/128 (18%), Positives = 42/128 (32%), Gaps = 13/128 (10%) Query: 105 WDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR 164 H ++LV G GVGKT+V+ L+ + L V+ + + S + K D Sbjct: 60 VCVQHNEPLLLV-GETGVGKTSVVQYLA-VLLGFKLTVVNVSQQSDSSDLLGGYKPVNDY 117 Query: 165 TSADF-----------VCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMA 213 S + A + K + L+I+ + N M Sbjct: 118 LSLPLSKPFEKIFNLTFLLKKNQKFIKNASRCLSSGRHKDLISLMIEICSKAELNPNPMK 177 Query: 214 GIGKMIRV 221 +R+ Sbjct: 178 RAELEMRL 185 >gnl|CDD|30200 cd02027, APSK, Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.. Length = 149 Score = 32.7 bits (75), Expect = 0.13 Identities = 14/40 (35%), Positives = 22/40 (55%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRS 152 VI + G++G GK+T+ L +K+ G V + GD R Sbjct: 1 VIWLTGLSGSGKSTIARALEEKLFQRGRPVYVLDGDNVRH 40 >gnl|CDD|145402 pfam02223, Thymidylate_kin, Thymidylate kinase. Length = 186 Score = 32.6 bits (75), Expect = 0.13 Identities = 11/27 (40%), Positives = 19/27 (70%) Query: 118 GVNGVGKTTVIGKLSKKMSDAGLKVML 144 G++G GKTT L +++ + G+KV+L Sbjct: 3 GLDGAGKTTQAELLKERLKEQGIKVVL 29 >gnl|CDD|73214 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (ArsA). This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life. ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities. To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates. A divalent cation, typically Mg2+, is required for its enzymatic activity.. Length = 254 Score = 32.5 bits (74), Expect = 0.14 Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 I G GVGKTT+ + ++++ G KV+L + D Sbjct: 2 YIFFGGKGGVGKTTISAATAVRLAEQGKKVLLVSTD 37 >gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]. Length = 530 Score = 32.5 bits (74), Expect = 0.15 Identities = 37/158 (23%), Positives = 62/158 (39%), Gaps = 26/158 (16%) Query: 4 QKVASESLSWIRKLTKGFASTSLKLKEGIT--DIISSRRLDDGVREELEDLLIRSDIGVA 61 QK ++ WIR+ AS + K K I + + +R ++ EE + L R Sbjct: 257 QKELAKEQEWIRRGKAA-ASKAKKAKSRIKRLEKLEARLAEERPVEEGKPLAFRFPPPGK 315 Query: 62 VAQKIVEEL--LTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGV 119 K+V E ++K Y L K ++ R I +VG Sbjct: 316 RLGKLVLEFENVSKGYDGG------------------RLLLKDLSFRID-RGDRIAIVGP 356 Query: 120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQ 157 NG GK+T++ L+ ++ L + G+T + DQ Sbjct: 357 NGAGKSTLLKLLAGEL--GPLSGTVKVGETVKIGYFDQ 392 >gnl|CDD|31805 COG1618, COG1618, Predicted nucleotide kinase [Nucleotide transport and metabolism]. Length = 179 Score = 32.5 bits (74), Expect = 0.17 Identities = 29/120 (24%), Positives = 44/120 (36%), Gaps = 29/120 (24%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVM--------------------LAAGDTF 150 I + G GVGKTT++ K+++K+ + G KV LA G+ Sbjct: 5 AMKIFITGRPGVGKTTLVLKIAEKLREKGYKVGGFITPEVREGGKRIGFKIVDLATGEEG 64 Query: 151 RSAAIDQLKIWADRTSADF-VCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNS 209 A + + + + EI A A E DV+IID G + S Sbjct: 65 ILARVGFSRPRVGKYGVNVEGLEEIAIPALRRALEE--------ADVIIIDEIGPMELKS 116 >gnl|CDD|30190 cd01672, TMPK, Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).. Length = 200 Score = 31.8 bits (72), Expect = 0.23 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAA--GDTFRSAAIDQLKIWADRTSAD 168 I+ G++G GKTT+I L++++ G +V+L G T AI +L + + D Sbjct: 2 FIVFEGIDGAGKTTLIELLAERLEARGYEVVLTREPGGTPIGEAIRELLLDPEDEKMD 59 >gnl|CDD|146036 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop. Length = 122 Score = 32.0 bits (73), Expect = 0.23 Identities = 13/30 (43%), Positives = 18/30 (60%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKV 142 ++LVVG GKTT+I KL + G +V Sbjct: 2 IVLVVGPKDSGKTTLIRKLLNYLKRRGYRV 31 >gnl|CDD|146080 pfam03266, DUF265, Protein of unknown function, DUF265. Length = 168 Score = 31.8 bits (73), Expect = 0.23 Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKV 142 I + G GVGKTT++ K+ + + G+KV Sbjct: 1 RIFITGPPGVGKTTLVKKVIELLKSEGVKV 30 >gnl|CDD|38564 KOG3354, KOG3354, KOG3354, Gluconate kinase [Carbohydrate transport and metabolism]. Length = 191 Score = 31.9 bits (72), Expect = 0.24 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA 154 +VI+V+GV+G GK+T+ LS++ L + GD A Sbjct: 12 KYVIVVMGVSGSGKSTIGKALSEE-----LGLKFIDGDDLHPPA 50 >gnl|CDD|31299 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism]. Length = 179 Score = 31.8 bits (72), Expect = 0.24 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA 154 VI + G+ G GKTTV +L++ + GLK+ ++AG FR A Sbjct: 2 VITISGLPGSGKTTVARELAEHL---GLKL-VSAGTIFREMA 39 >gnl|CDD|111283 pfam02374, ArsA_ATPase, Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304 Score = 31.6 bits (72), Expect = 0.29 Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 I G GVGKTTV + ++S+ G KV+L + D Sbjct: 3 WIFFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTD 38 >gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]. Length = 300 Score = 31.4 bits (71), Expect = 0.31 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 111 PHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 H+ILV+ G GVGK+TV L+ ++ G KV L D Sbjct: 47 KHIILVLSGKGGVGKSTVTVNLALALASEGKKVGLLDAD 85 >gnl|CDD|35293 KOG0070, KOG0070, KOG0070, GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport]. Length = 181 Score = 31.4 bits (71), Expect = 0.35 Identities = 15/37 (40%), Positives = 23/37 (62%) Query: 95 MLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKL 131 M + SK F+ F + IL+VG++ GKTT++ KL Sbjct: 1 MGLIFSKLFSGLFGKKEMRILMVGLDAAGKTTILYKL 37 >gnl|CDD|30194 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.. Length = 150 Score = 31.0 bits (70), Expect = 0.44 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA 154 +I+V+GV+G GK+TV L+++ L GD A Sbjct: 1 IIVVMGVSGSGKSTVGKALAER-----LGAPFIDGDDLHPPA 37 >gnl|CDD|32202 COG2019, AdkA, Archaeal adenylate kinase [Nucleotide transport and metabolism]. Length = 189 Score = 30.7 bits (69), Expect = 0.51 Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMSD 137 V+++ GV GVGKTTV+ K++ Sbjct: 4 RKVVVITGVPGVGKTTVLKIALKELVK 30 >gnl|CDD|30474 COG0125, Tmk, Thymidylate kinase [Nucleotide transport and metabolism]. Length = 208 Score = 30.6 bits (69), Expect = 0.52 Identities = 12/31 (38%), Positives = 22/31 (70%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVML 144 I++ G++G GKTT L +++ + G+KV+L Sbjct: 6 IVIEGIDGAGKTTQAELLKERLEERGIKVVL 36 >gnl|CDD|37016 KOG1805, KOG1805, KOG1805, DNA replication helicase [Replication, recombination and repair]. Length = 1100 Score = 30.7 bits (69), Expect = 0.55 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKI 160 L++G+ G GKTT I L K + G KV+L + + +A+D + I Sbjct: 686 DYALILGMPGTGKTTTISLLIKILVALGKKVLLTS---YTHSAVDNILI 731 >gnl|CDD|133282 cd01882, BMS1, Bms1. Bms1 is an essential, evolutionarily conserved, nucleolar protein. Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits. Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit. The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly. It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes. Length = 225 Score = 30.7 bits (70), Expect = 0.57 Identities = 14/26 (53%), Positives = 17/26 (65%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMS 136 P V+ VVG GVGKTT+I L K + Sbjct: 39 PLVVAVVGPPGVGKTTLIKSLVKNYT 64 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 30.6 bits (69), Expect = 0.60 Identities = 18/104 (17%), Positives = 29/104 (27%), Gaps = 17/104 (16%) Query: 104 NWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD 163 P +L+ G G GKTT+ ++ ++ G + + Sbjct: 12 EALELPPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHF 71 Query: 164 RTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHN 207 L F+ A+ K VL ID L Sbjct: 72 -----------------LVRLLFELAEKAKPGVLFIDEIDSLSR 98 >gnl|CDD|30727 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]. Length = 202 Score = 30.5 bits (69), Expect = 0.61 Identities = 37/164 (22%), Positives = 62/164 (37%), Gaps = 34/164 (20%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQL-KIWADRT---SAD 168 I V G G GKT +I K + + D K+ + GD + D+L K+ + Sbjct: 15 RIGVGGPPGSGKTALIEKTLRALKD-EYKIAVITGDIYTKEDADRLRKLPGEPIIGVETG 73 Query: 169 FVCSEIGSDAAALAYEAFKQ--AQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLD 226 C A++ EA ++ +D+L I++ G L Sbjct: 74 KGCHL----DASMNLEAIEELVLDFPDLDLLFIESVGNLVC----------------PFS 113 Query: 227 PH-APHSVLQVLDATTGQNALRQV--EMFHAVAGTTGLIMTKMD 267 P H + V+D T G++ R+ +F A L++ K D Sbjct: 114 PDLGDHLRVVVIDVTEGEDIPRKGGPGIFKADL----LVINKTD 153 >gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 265 Score = 30.4 bits (68), Expect = 0.74 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 111 PHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 +VI V G GVGK+TV L+ ++ G +V+L D Sbjct: 57 KNVIAVTSGKGGVGKSTVAVNLAAALAQLGKRVLLLDAD 95 >gnl|CDD|144975 pfam01580, FtsK_SpoIIIE, FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif. It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer. Length = 202 Score = 30.0 bits (68), Expect = 0.81 Identities = 27/136 (19%), Positives = 49/136 (36%), Gaps = 26/136 (19%) Query: 101 KPFNWDFSHRPHVILVVGVNGVGKT----TVIGKLSKKMSDAGLKVMLAAGDTFRSAAID 156 P D PH+ L+ G G GK+ T+I L+ + S +++ L + + Sbjct: 29 NPVVADLVKMPHL-LIAGATGSGKSTFLNTLILSLAARHSPEEVRLYLID---PKGGELA 84 Query: 157 QLKIWADRTSADFVCSEIGSDAAALA---------YEAFKQAQAKKVDV-------LIID 200 L+ SA V ++ +AL Y KQ + ++ I+ Sbjct: 85 ALEDLPHLLSA--VATDPEDALSALRALVAEMERRYALLKQLGVRSIEEYNGEIAEDILG 142 Query: 201 TAGRLHNNSILMAGIG 216 AG L ++ + Sbjct: 143 GAGWLEELPPIVVIVD 158 >gnl|CDD|31673 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair]. Length = 254 Score = 30.0 bits (67), Expect = 1.00 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 20/87 (22%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSE 173 ++++G GVGKT + + ++ AG+ V+ T+ D + S+ Sbjct: 108 LVLLGPPGVGKTHLAIAIGNELLKAGISVLFI-------------------TAPDLL-SK 147 Query: 174 IGSDAAALAYEAFKQAQAKKVDVLIID 200 + + E + KKVD+LIID Sbjct: 148 LKAAFDEGRLEEKLLRELKKVDLLIID 174 >gnl|CDD|32257 COG2074, COG2074, 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]. Length = 299 Score = 29.9 bits (67), Expect = 1.0 Identities = 23/91 (25%), Positives = 46/91 (50%), Gaps = 7/91 (7%) Query: 53 LIRSDIGVAVAQKI---VEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFN-WDF- 107 L + + +A I ++E L K + V+ + +L+ K ++K + W Sbjct: 24 LTAAGVDPDLAYSIAIEIQEELKKEGIRLVTKDEIREVYQKLLEKGDPEVAKRYLLWRRI 83 Query: 108 --SHRPHVILVVGVNGVGKTTVIGKLSKKMS 136 RP +IL+ G +GVGK+T+ G+L++++ Sbjct: 84 RKMKRPLIILIGGASGVGKSTIAGELARRLG 114 >gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 4600 Score = 29.7 bits (66), Expect = 1.0 Identities = 20/90 (22%), Positives = 32/90 (35%), Gaps = 19/90 (21%) Query: 49 LEDLLIRSDIGVAVAQKI---VEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNW 105 + +L DIG K + L +A +L + W Sbjct: 415 VLNLKHEIDIGRCALTKTEIPIISLSGNSFAFTSCSLWLLEQLL---------------W 459 Query: 106 DFSHRPHVILVVGVNGVGKTTVIGKLSKKM 135 + + +LV G G GKTT+I L+ K+ Sbjct: 460 NIQNNEPTLLV-GETGTGKTTMIQYLALKL 488 Score = 27.0 bits (59), Expect = 7.2 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Query: 109 HRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA 145 +P IL+ G GVGKT++I L++K +++ L+ Sbjct: 1543 GKP--ILLEGSPGVGKTSLITALARKTGKKLIRINLS 1577 >gnl|CDD|31564 COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only]. Length = 398 Score = 29.6 bits (66), Expect = 1.0 Identities = 12/25 (48%), Positives = 17/25 (68%) Query: 110 RPHVILVVGVNGVGKTTVIGKLSKK 134 RP +IL++G VGKTT++ L K Sbjct: 36 RPFIILILGPRQVGKTTLLKLLIKG 60 >gnl|CDD|37566 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only, Transcription]. Length = 291 Score = 29.6 bits (66), Expect = 1.1 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 8/88 (9%) Query: 68 EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127 E +A +VS + Y VS+ P+ FN D L+VG NG GKTT+ Sbjct: 5 EAEAVSDFAIEVSGLQFKYKVSD-------PIFFDFNLDLPAGSRC-LLVGANGAGKTTL 56 Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAI 155 + LS K G V + F ++ Sbjct: 57 LKILSGKHMVGGGVVQVLGRSAFHDTSL 84 >gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]. Length = 456 Score = 29.8 bits (67), Expect = 1.1 Identities = 25/103 (24%), Positives = 55/103 (53%), Gaps = 17/103 (16%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCS 172 VIL+ G G+GK+T++ +++ +++ G KV+ +G+ ++ Q+K+ ADR Sbjct: 95 VILIGGDPGIGKSTLLLQVAARLAKRG-KVLYVSGEE----SLQQIKLRADRL------- 142 Query: 173 EIGSDAAALAYEA-----FKQAQAKKVDVLIIDTAGRLHNNSI 210 + ++ L E + + +K D+++ID+ L++ I Sbjct: 143 GLPTNNLYLLAETNLEDIIAELEQEKPDLVVIDSIQTLYSEEI 185 >gnl|CDD|147760 pfam05783, DLIC, Dynein light intermediate chain (DLIC). This family consists of several eukaryotic dynein light intermediate chain proteins. The light intermediate chains (LICs) of cytoplasmic dynein consist of multiple isoforms, which undergo post-translational modification to produce a large number of species. DLIC1 is known to be involved in assembly, organisation, and function of centrosomes and mitotic spindles when bound to pericentrin. DLIC2 is a subunit of cytoplasmic dynein 2 that may play a role in maintaining Golgi organisation by binding cytoplasmic dynein 2 to its Golgi-associated cargo. Length = 490 Score = 29.4 bits (66), Expect = 1.3 Identities = 11/18 (61%), Positives = 15/18 (83%) Query: 114 ILVVGVNGVGKTTVIGKL 131 +LV+G +G GKTT+I KL Sbjct: 48 VLVLGEDGSGKTTLIAKL 65 >gnl|CDD|32539 COG2403, COG2403, Predicted GTPase [General function prediction only]. Length = 449 Score = 29.5 bits (66), Expect = 1.3 Identities = 23/127 (18%), Positives = 47/127 (37%), Gaps = 27/127 (21%) Query: 31 GITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSE 90 G T+ I L+ + GV + + + L K ++ V V+ S+ Sbjct: 44 GGTERIYPPSLEGVLYPL----------GVPILPEKDYDDLEK-IIREKDVDIVVLAYSD 92 Query: 91 LIHKMLMPLS-------------KPFNW-DFSHRPHVILVVGV-NGVGKTTVIGKLSKKM 135 + ++ + ++ P +P VI V GVGK+ V +++ + Sbjct: 93 VSYEHVFRIASRVLSAGADFKELGPKETMLKLEKP-VIAVTATRTGVGKSAVSRYVARLL 151 Query: 136 SDAGLKV 142 + G +V Sbjct: 152 RERGYRV 158 >gnl|CDD|31663 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]. Length = 366 Score = 29.6 bits (66), Expect = 1.4 Identities = 9/35 (25%), Positives = 18/35 (51%) Query: 108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKV 142 RP I++ G G GKT + + +++ ++ V Sbjct: 39 GERPSNIIIYGPTGTGKTATVKFVMEELEESSANV 73 >gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.. Length = 179 Score = 29.4 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 +++ G GVGKTT L ++ G KV+L D Sbjct: 2 IVVTSGKGGVGKTTTTANLGTALAQLGYKVVLIDAD 37 >gnl|CDD|30633 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism]. Length = 427 Score = 29.1 bits (65), Expect = 1.5 Identities = 36/148 (24%), Positives = 62/148 (41%), Gaps = 36/148 (24%) Query: 90 ELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKV------- 142 E I ++L L P P VI V G N GK + L + +AG KV Sbjct: 28 ERISRLLERLGNPQK-----SPPVIHVAGTN--GKGSTCAFLESILREAGYKVGVYTSPH 80 Query: 143 MLAAGDTFR-----------SAAIDQLKIWADRTSADFVCS--EIGSDAAALAYEAFKQA 189 +L+ + R +AA ++++ A + + E+ + A+A+ F +A Sbjct: 81 LLSFNERIRINGEPISDEELAAAFERVEE-AAGSLDLISLTYFEVLT---AMAFLYFAEA 136 Query: 190 QAKKVDVLIIDT--AGRLHNNSILMAGI 215 KVDV I++ GRL +++ + Sbjct: 137 ---KVDVAILEVGLGGRLDATNVIEPDV 161 >gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 325 Score = 29.1 bits (65), Expect = 1.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR 151 ++ +G NG GK+T + L+ + KV + D FR Sbjct: 52 IVGFLGANGAGKSTTLKMLTGLLLPTSGKVRVNGKDPFR 90 >gnl|CDD|37181 KOG1970, KOG1970, KOG1970, Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Energy production and conversion, Replication, recombination and repair]. Length = 634 Score = 29.3 bits (65), Expect = 1.6 Identities = 23/127 (18%), Positives = 53/127 (41%), Gaps = 13/127 (10%) Query: 12 SWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELL 71 S +K + S +L + + D E+ E + + ++ EL Sbjct: 14 SLKKKASNIRKSEKPRLSSK-SSTTKPSSIPDIHEEDFEAFDDEESVHLNNEKEDEFELW 72 Query: 72 TKRY----AKDVSV-QRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTT 126 ++Y ++++V ++ + +V + + ++ K R ++L+ G +G GK+T Sbjct: 73 VEKYKPRTLEELAVHKKKISEVKQWLKQVAEFTPK-----LGSR--ILLLTGPSGCGKST 125 Query: 127 VIGKLSK 133 + LSK Sbjct: 126 TVKVLSK 132 >gnl|CDD|30189 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.. Length = 194 Score = 29.0 bits (65), Expect = 1.7 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA 153 IL++G G GK T +L+KK GL ++ GD R Sbjct: 1 RILLLGPPGSGKGTQAERLAKKY---GL-PHISTGDLLREE 37 >gnl|CDD|48369 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.. Length = 270 Score = 29.0 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 I + G G+GK+T LS +++ G KVM+ D Sbjct: 4 IAIYGKGGIGKSTTTQNLSAALAEMGKKVMIVGCD 38 >gnl|CDD|29996 cd01130, VirB11-like_ATPase, Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.. Length = 186 Score = 29.1 bits (65), Expect = 1.8 Identities = 12/40 (30%), Positives = 16/40 (40%) Query: 93 HKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS 132 PL + W IL+ G G GKTT++ L Sbjct: 7 QGTFSPLQAAYLWLAVEARKNILISGGTGSGKTTLLNALL 46 >gnl|CDD|35294 KOG0071, KOG0071, KOG0071, GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport]. Length = 180 Score = 28.8 bits (64), Expect = 1.8 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 95 MLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD 137 M +SK + F ++ IL++G++ GKTT++ KL S Sbjct: 1 MGNYMSKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSV 43 >gnl|CDD|48371 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.. Length = 212 Score = 29.0 bits (65), Expect = 1.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 I + G G+GK+T LS +++ G KV+ D Sbjct: 2 QIAIYGKGGIGKSTTSQNLSAALAEMGKKVLQVGCD 37 >gnl|CDD|111395 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans. Length = 174 Score = 28.7 bits (65), Expect = 1.9 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 12/101 (11%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV-- 170 V ++ G G GKTT++ L + + GLK+ + D F ID + T A+ V Sbjct: 2 VTVLTGFLGSGKTTLLEHLLRDNRE-GLKIAVIVND-FGETGIDAELL--RETGAEIVEL 57 Query: 171 -----CSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLH 206 C I D ++ EA + + ++D+L I+T G Sbjct: 58 NNGCICCTIRED-LSMVLEALLELKLPRLDLLFIETTGLAC 97 >gnl|CDD|35296 KOG0073, KOG0073, KOG0073, GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport, Cytoskeleton]. Length = 185 Score = 28.7 bits (64), Expect = 2.1 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAID--QLKIW 161 IL++G++ GKTT++ KL + +D + G ++ L IW Sbjct: 19 ILILGLDNSGKTTIVKKLLGEDTD---TISPTLGFQIKTLEYKGYTLNIW 65 >gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arl9/Arfrp2-like subfamily. Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project. It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2). This is a novel subfamily identified in human cancers that is uncharacterized to date. Length = 164 Score = 28.6 bits (64), Expect = 2.2 Identities = 11/23 (47%), Positives = 18/23 (78%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMS 136 ILV+G++G GKT+++ LS + S Sbjct: 2 ILVLGLDGAGKTSLLHSLSSERS 24 >gnl|CDD|48380 cd03116, MobB, Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.. Length = 159 Score = 28.7 bits (64), Expect = 2.2 Identities = 15/32 (46%), Positives = 20/32 (62%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKV 142 VI VG +G GKTT++ KL +S GL+V Sbjct: 1 MKVIGFVGYSGSGKTTLLEKLIPALSARGLRV 32 >gnl|CDD|30909 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism]. Length = 178 Score = 28.7 bits (64), Expect = 2.3 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSA 153 IL++G G GK+T+ KL+KK+ L GD R+A Sbjct: 3 ILILGPPGAGKSTLAKKLAKKLG----LPHLDTGDILRAA 38 >gnl|CDD|147726 pfam05729, NACHT, NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931. Length = 165 Score = 28.8 bits (65), Expect = 2.3 Identities = 19/100 (19%), Positives = 35/100 (35%), Gaps = 25/100 (25%) Query: 112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT----------FRSAAIDQLKIW 161 +++ G G GKTT++ KL +L A + + Sbjct: 1 RTVILQGEAGSGKTTLLQKL----------ALLWAQGKLPQDFDFVFFLPCRELSRSG-- 48 Query: 162 ADRTSADFVCSE-IGSDAAALAYEAFKQAQAKKVDVLIID 200 + + AD + S+ A A ++V +LI+D Sbjct: 49 -EASLADLLFSQWPEPAAPVSEVWAVILELPERV-LLILD 86 >gnl|CDD|31949 COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]. Length = 161 Score = 28.4 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKV 142 ++ +VG GKTT+I KL +K+ G +V Sbjct: 4 ILGIVGYKNSGKTTLIEKLVRKLKARGYRV 33 >gnl|CDD|73301 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.. Length = 139 Score = 28.6 bits (64), Expect = 2.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 118 GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 G GVGKT + L+ ++ G +V+L D Sbjct: 7 GKGGVGKTNISANLALALAKLGKRVLLLDAD 37 >gnl|CDD|99895 cd05834, HDGF_related, The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF. This family of endogenous nuclear-targeted mitogens includes HRP (HDGF-related proteins 1, 2, 3, 4, or HPR1, HPR2, HPR3, HPR4, respectively) and lens epithelium-derived growth factor, LEDGF. Members of the HDGF family have been linked to human diseases, and HDGF is a prognostic factor in several types of cancer. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.. Length = 83 Score = 28.4 bits (64), Expect = 2.7 Identities = 10/24 (41%), Positives = 11/24 (45%), Gaps = 4/24 (16%) Query: 283 KIPVYFLGVGE----GINDLEPFV 302 K PVYF G E DL P+ Sbjct: 35 KYPVYFFGTHETAFLKPEDLFPYT 58 >gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 28.3 bits (63), Expect = 2.8 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 106 DFSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVML 144 RP V+ ++G NG GK+T++ LS ++S +V L Sbjct: 21 SLDLRPGEVLAILGPNGAGKSTLLKALSGELSPDSGEVTL 60 >gnl|CDD|33697 COG3910, COG3910, Predicted ATPase [General function prediction only]. Length = 233 Score = 28.3 bits (63), Expect = 2.9 Identities = 9/39 (23%), Positives = 18/39 (46%) Query: 97 MPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKM 135 +P + R + + G NG GK+T++ ++ M Sbjct: 23 LPAFRHLEERLEFRAPITFITGENGSGKSTLLEAIAAGM 61 >gnl|CDD|144171 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family. Length = 467 Score = 28.4 bits (64), Expect = 2.9 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 6/37 (16%) Query: 194 VDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP 230 VDV++ID+A H +S + +MI+ +K+ P Sbjct: 236 VDVIVIDSA---HGHSE---YVLEMIKWIKKKYPDLD 266 >gnl|CDD|35430 KOG0209, KOG0209, KOG0209, P-type ATPase [Inorganic ion transport and metabolism]. Length = 1160 Score = 28.4 bits (63), Expect = 3.0 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 184 EAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDP--HAPHSVLQVL 237 E F+ A KVDV D G L + +++ G+ + L P AP+ + VL Sbjct: 469 EPFRIPFAGKVDVCCFDKTGTLTEDDLVVEGVAGLSADEGALTPASKAPNETVLVL 524 >gnl|CDD|33438 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning]. Length = 255 Score = 28.3 bits (63), Expect = 3.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA 145 I + G GVGKTT+ L K++ G +L Sbjct: 2 KIAITGKGGVGKTTIAALLLKRLLSKGGYNVLV 34 >gnl|CDD|145920 pfam03029, ATP_bind_1, Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity. Length = 234 Score = 28.1 bits (63), Expect = 3.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Query: 116 VVGVNGVGKTTVIGKLSKKMSDAGLKV 142 VVG G GKTT +G LS+ + G V Sbjct: 1 VVGGAGSGKTTFVGALSEILPLRGRSV 27 >gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain. This family includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho. Length = 213 Score = 28.2 bits (64), Expect = 3.1 Identities = 13/48 (27%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA--IDQLK 159 I + G +G GKT ++G +++ ++V + G+ R A I++L Sbjct: 18 IGIFGGSGTGKTVLLGMIARNAKADVVEVYVLIGERGREVAEFIEELL 65 >gnl|CDD|31539 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism]. Length = 278 Score = 28.3 bits (63), Expect = 3.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 I + G G+GK+T L+ +++ G KV++ D Sbjct: 4 IAIYGKGGIGKSTTSQNLAAALAELGKKVLIVGCD 38 >gnl|CDD|147573 pfam05461, ApoL, Apolipoprotein L. Apo L belongs to the high density lipoprotein family that plays a central role in cholesterol transport. The cholesterol content of membranes is important in cellular processes such as modulating gene transcription and signal transduction both in the adult brain and during neurodevelopment. There are six apo L genes located in close proximity to each other on chromosome 22q12 in humans. 22q12 is a confirmed high-susceptibility locus for schizophrenia and close to the region associated with velocardiofacial syndrome that includes symptoms of schizophrenia. Length = 313 Score = 28.1 bits (63), Expect = 3.2 Identities = 34/153 (22%), Positives = 53/153 (34%), Gaps = 24/153 (15%) Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI-DQLKIWADRTSADFVCSEIGSDAA 179 G+ S +S GL + AA T S +I + + + A S + + Sbjct: 116 GLALAPFTAGGSLVLSATGLGLGAAAAVTSISTSIVENVSNSSAEAKA----SRLVPTSM 171 Query: 180 ALAYEAFKQAQAKKVDVLIIDTAGRLHNNSI-LMAGIGKMIRVLK------RLDPHAPHS 232 + K+ I L N + + GIGK IR ++ RL A Sbjct: 172 D-ELKVLKECLKF-----IAPNVLTLVENVLRALKGIGKNIRAIRLARANPRLGAAAKRL 225 Query: 233 VLQVLDATTGQNALRQVEMFHAVAGTTGLIMTK 265 + TTG+ + + G T L MTK Sbjct: 226 M------TTGRISAQSAVQVQRAFGGTALAMTK 252 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 28.0 bits (61), Expect = 3.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKI 160 I+V+G GVGKTT++ +L G + D ++ + I Sbjct: 8 IVVLGDGGVGKTTLLNRLVGDEFPEGYPPTIGNLDPAKTIEPYRRNI 54 >gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165 Score = 28.2 bits (62), Expect = 3.3 Identities = 28/139 (20%), Positives = 55/139 (39%), Gaps = 9/139 (6%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF--V 170 +ILV G G GKTT+ +L+ ++ G KV+ + ++L + + + D + Sbjct: 1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLII 60 Query: 171 CSEIGSDAAALAYEAF--KQAQAKKVDVLIIDTAGRLHNNSILMAG-----IGKMIRVLK 223 D AA + + + D++I+D RL + + + +R L Sbjct: 61 VFATADDPAAARLLSKAERLRERGGDDLIILDELTRLVRALREIREGYPGELDEELRELL 120 Query: 224 RLDPHAPHSVLQVLDATTG 242 +V+ L +G Sbjct: 121 ERARKGGVTVIFTLQVPSG 139 >gnl|CDD|34695 COG5092, NMT1, N-myristoyl transferase [Lipid metabolism]. Length = 451 Score = 28.1 bits (62), Expect = 3.4 Identities = 16/66 (24%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Query: 33 TDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELI 92 T I +L DG+ E E +I D+ + V LL + Y +D+ E + Sbjct: 63 TISIEQPKLPDGLLFEFEWCVI--DVANKKQLEDVFVLLEENYVEDIYAGHRFRYSVEFL 120 Query: 93 HKMLMP 98 L Sbjct: 121 QWALDG 126 >gnl|CDD|36745 KOG1532, KOG1532, KOG1532, GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]. Length = 366 Score = 28.0 bits (62), Expect = 3.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 107 FSHRPHVILVVGVNGVGKTTVIGKLSKKMSD 137 RP +ILVVG+ G GKTT + +L+ + Sbjct: 15 AIQRPVIILVVGMAGSGKTTFMQRLNSHLHA 45 >gnl|CDD|36180 KOG0962, KOG0962, KOG0962, DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]. Length = 1294 Score = 28.0 bits (62), Expect = 3.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Query: 113 VILVVGVNGVGKTTVI 128 + L+VG NG GKTT+I Sbjct: 29 LTLIVGANGTGKTTII 44 Score = 26.8 bits (59), Expect = 7.8 Identities = 13/60 (21%), Positives = 26/60 (43%) Query: 14 IRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTK 73 I +L++ K+KE + I + + + E E+L + +AQK ++ K Sbjct: 887 IEELSEEITRLDSKVKELLERIQPLKVELEEAQSEKEELKNERNTSEKLAQKKRNDINEK 946 >gnl|CDD|34256 COG4637, COG4637, Predicted ATPase [General function prediction only]. Length = 373 Score = 28.0 bits (62), Expect = 3.6 Identities = 7/22 (31%), Positives = 11/22 (50%) Query: 111 PHVILVVGVNGVGKTTVIGKLS 132 V +++G NG GK+ L Sbjct: 22 RRVNVIIGANGAGKSNFYDALR 43 >gnl|CDD|133254 cd00878, Arf_Arl, Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases. Arf proteins are activators of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. Arfs are N-terminally myristoylated. Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner. They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site. Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins. Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus. Most other Arf family proteins are so far relatively poorly characterized. Thus, despite their significant sequence homologies, Arf family proteins may regulate unrelated functions. Length = 158 Score = 27.9 bits (63), Expect = 4.1 Identities = 10/18 (55%), Positives = 16/18 (88%) Query: 114 ILVVGVNGVGKTTVIGKL 131 IL++G++G GKTT++ KL Sbjct: 2 ILILGLDGAGKTTILYKL 19 >gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. Length = 131 Score = 27.6 bits (62), Expect = 4.3 Identities = 19/87 (21%), Positives = 34/87 (39%), Gaps = 23/87 (26%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSE 173 +L+ G G GKTT+ ++K++ G + +G ++ V Sbjct: 1 LLLYGPPGTGKTTLAKAVAKEL---GAPFIEISG-------------------SELVSKY 38 Query: 174 IGSDAAALAYEAFKQAQAKKVDVLIID 200 +G L E F+ A+ V+ ID Sbjct: 39 VGESEKRLR-ELFEAAKKLAPCVIFID 64 >gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.. Length = 116 Score = 27.9 bits (62), Expect = 4.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 I + G GVGKTT+ L++ +++ G V+ D Sbjct: 1 KIAITGKGGVGKTTIAALLARYLAEKGKPVLAIDAD 36 >gnl|CDD|32119 COG1936, COG1936, Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]. Length = 180 Score = 27.5 bits (61), Expect = 4.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 114 ILVVGVNGVGKTTVIGKLSK 133 I + G GVGKTTV L + Sbjct: 3 IAITGTPGVGKTTVCKLLRE 22 >gnl|CDD|107330 cd06335, PBP1_ABC_ligand_binding_like_2, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally. Length = 347 Score = 27.6 bits (62), Expect = 4.8 Identities = 26/116 (22%), Positives = 45/116 (38%), Gaps = 23/116 (19%) Query: 106 DFSHRPHVILVVG-VNGVGKTTVIGKLSKKMSDAGLKVML---AAGDTFRSAAIDQLKIW 161 + + V+ V+G ++ T V + + + ++ A R+ A + Sbjct: 61 ELAADEKVVAVLGGLH----TPVALANLEFIQQNKIPLIGPWAAGTPITRNGAPPN---Y 113 Query: 162 ADRTSADFVCSEIGSD---AAALAYEAFKQAQAKKVDVLIIDTA-GRLHNNSILMA 213 R SAD D A L EA K+ KKV +L+ +T GR + + A Sbjct: 114 IFRVSAD--------DSIQAPFLVDEAVKRGGFKKVALLLDNTGWGRSNRKDLTAA 161 >gnl|CDD|57927 cd01856, YlqF, YlqF. Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.. Length = 171 Score = 27.5 bits (61), Expect = 5.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Query: 110 RPHVILVVGVNGVGKTTVIGKLSKK 134 R +VVG+ VGK+T+I +L K Sbjct: 114 RGIRAMVVGIPNVGKSTLINRLRGK 138 >gnl|CDD|34791 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]. Length = 1077 Score = 27.4 bits (60), Expect = 5.1 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 111 PHVILVVGVNGVGKTTVIGKLSKKMS 136 P ++ VVG G GK+T+I L ++ + Sbjct: 69 PFIVAVVGPPGTGKSTLIRSLVRRFT 94 >gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]. Length = 591 Score = 27.5 bits (61), Expect = 5.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 109 HRPHVILVVGVNGVGKTTVIGKLS 132 + VI ++G NG+GKTT + L+ Sbjct: 365 YDGEVIGILGPNGIGKTTFVKLLA 388 >gnl|CDD|31710 COG1521, COG1521, Putative transcriptional regulator, homolog of Bvg accessory factor [Transcription]. Length = 251 Score = 27.2 bits (60), Expect = 5.6 Identities = 20/101 (19%), Positives = 37/101 (36%), Gaps = 14/101 (13%) Query: 172 SEIGSDAAALAYEAFKQAQAKKVDVLIID----------TAGRLHNNSILMAGIGKMIRV 221 E+G+D A A A+ + V+++D G + ++ GI Sbjct: 103 EELGADRIANAVAAYHKY---GKAVVVVDFGTATTIDLVDEGGRYLGGAILPGITLSFEA 159 Query: 222 LKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLI 262 L P + ++ G+N + ++ V G GLI Sbjct: 160 LFARAAKLPRVEIARPESVPGKNTVEAIQS-GVVYGYVGLI 199 >gnl|CDD|57926 cd01855, YqeH, YqeH. YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts. Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.. Length = 190 Score = 27.5 bits (61), Expect = 5.7 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 9/51 (17%) Query: 86 YDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMS 136 + V ELI+ + K + + VVG VGK+T+I L KK + Sbjct: 111 WGVEELINAIKKLAKKGGD---------VYVVGATNVGKSTLINALLKKDN 152 >gnl|CDD|32410 COG2229, COG2229, Predicted GTPase [General function prediction only]. Length = 187 Score = 27.2 bits (60), Expect = 5.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 114 ILVVGVNGVGKTTVIGKLSKKMS 136 I+V+G G GKTT + LS K Sbjct: 13 IVVIGPVGAGKTTFVRALSDKPL 35 >gnl|CDD|36760 KOG1547, KOG1547, KOG1547, Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms, Cytoskeleton]. Length = 336 Score = 27.2 bits (60), Expect = 5.9 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 10/53 (18%) Query: 88 VSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSK-KMSDAG 139 + E + K M FN I+VVG +G+GK+T+I L K +SD+ Sbjct: 32 IIEQMRKKTMKTGFDFN---------IMVVGQSGLGKSTLINTLFKSHVSDSS 75 >gnl|CDD|73174 COG0470, HolB, ATPase involved in DNA replication [DNA replication, recombination, and repair]. Length = 325 Score = 26.8 bits (58), Expect = 7.2 Identities = 26/111 (23%), Positives = 41/111 (36%), Gaps = 11/111 (9%) Query: 103 FNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIW- 161 + PH +L G GVGKTT L+K++ +L G I Sbjct: 16 QALESGRLPHALLFYGPPGVGKTTAALALAKELLCENPTGLLPCGHCRSCKLIPAGNHPD 75 Query: 162 ------ADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLH 206 +D D + ++ + A E+ + K V+IID A +L Sbjct: 76 FLELNPSDLRKIDIIVEQVR-ELAEFLSESPLEGGYK---VVIIDEADKLT 122 >gnl|CDD|133307 cd04107, Rab32_Rab38, Rab38/Rab32 subfamily. Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Length = 201 Score = 26.9 bits (60), Expect = 7.2 Identities = 9/15 (60%), Positives = 13/15 (86%) Query: 114 ILVVGVNGVGKTTVI 128 +LV+G GVGKT++I Sbjct: 3 VLVIGDLGVGKTSII 17 >gnl|CDD|39620 KOG4419, KOG4419, KOG4419, 5' nucleotidase [Nucleotide transport and metabolism]. Length = 602 Score = 26.8 bits (59), Expect = 7.4 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 7/49 (14%) Query: 163 DRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSIL 211 R ADF D AA A + A K VDVL++DT G LH+ + L Sbjct: 62 ARYDADF------GDFAAFALRMKELADRKGVDVLLVDT-GDLHDGTGL 103 >gnl|CDD|72999 cd03240, ABC_Rad50, The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.. Length = 204 Score = 27.1 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 110 RPHVILVVGVNGVGKTTVI 128 + L+VG NG GKTT+I Sbjct: 21 FSPLTLIVGQNGAGKTTII 39 >gnl|CDD|99798 cd06201, SiR_like2, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 289 Score = 26.9 bits (60), Expect = 7.8 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Query: 38 SRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDV 79 SR + GV LE++L + + + L RYA+DV Sbjct: 253 SRAMAQGVAAVLEEILAPQPLSLDELK------LQGRYAEDV 288 >gnl|CDD|133355 cd04155, Arl3, Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension. In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form. The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector. Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2). It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery. In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation. Length = 173 Score = 26.9 bits (60), Expect = 8.0 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 11/53 (20%) Query: 114 ILVVGVNGVGKTTVIGKLSKK-----MSDAGLKVMLAAGDTFRSAAIDQLKIW 161 IL++G++ GKTT++ +L+ + G + D F+ L +W Sbjct: 17 ILILGLDNAGKTTILKQLASEDISHITPTQGFNIKTVQSDGFK------LNVW 63 >gnl|CDD|35286 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC superfamily [RNA processing and modification]. Length = 592 Score = 26.8 bits (59), Expect = 8.5 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 110 RP-HVILVVGVNGVGKTTVIGKLSKKM 135 RP V+ +VG NG+GK+T + L+ K Sbjct: 98 RPGQVLGLVGTNGIGKSTALKILAGKQ 124 >gnl|CDD|114364 pfam05636, DUF795, Protein of unknown function (DUF795). This family consists of several bacterial proteins of unknown function. Length = 389 Score = 26.6 bits (59), Expect = 8.7 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 15/85 (17%) Query: 44 GVREELEDLLIRSDIGVAVAQKI---VEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLS 100 V E LE+ + ++ + AQ VE + TKRY K +QR+L + L+ + Sbjct: 264 DVEEGLENRIKKA---IKKAQNFDDLVELVKTKRYTK-ARIQRILTHI-------LLNIK 312 Query: 101 KPFNWDFSHRPHVILVVGVNGVGKT 125 K + P I ++G G+ Sbjct: 313 KNDTEEKD-LPPYIRILGFTKKGQK 336 >gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.. Length = 104 Score = 26.8 bits (59), Expect = 8.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 121 GVGKTTVIGKLSKKMSDAGLKVMLAAGD 148 GVGKTT L+ ++ G +V+L D Sbjct: 10 GVGKTTTAVNLAAALARRGKRVLLIDLD 37 >gnl|CDD|31114 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]. Length = 448 Score = 26.8 bits (59), Expect = 9.0 Identities = 11/41 (26%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Query: 105 WDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLA 145 + S ++ + G N GKTT ++ + AGL +L Sbjct: 104 YRLSGEAPIVAITGTN--GKTTTTSLIAHLLKAAGLDALLG 142 >gnl|CDD|133357 cd04157, Arl6, Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily. Length = 162 Score = 26.6 bits (59), Expect = 9.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Query: 114 ILVVGVNGVGKTTVIGKL 131 ILVVG++ GKTT+I +L Sbjct: 2 ILVVGLDNSGKTTIINQL 19 >gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.. Length = 144 Score = 26.6 bits (59), Expect = 9.2 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Query: 98 PLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAID 156 L K + + + LV G NG GK+T++ ++ ++ D G ++ G T + + Sbjct: 14 LLLKDISLTINPGDRIGLV-GRNGAGKSTLLKLIAGELEPDEG---IVTWGSTVKIGYFE 69 Query: 157 QL 158 QL Sbjct: 70 QL 71 >gnl|CDD|133259 cd01850, CDC_Septin, CDC/Septin. Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells. They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis. In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments. Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities. Length = 276 Score = 26.7 bits (60), Expect = 9.3 Identities = 9/15 (60%), Positives = 13/15 (86%) Query: 114 ILVVGVNGVGKTTVI 128 I+VVG +G+GK+T I Sbjct: 7 IMVVGESGLGKSTFI 21 >gnl|CDD|39108 KOG3905, KOG3905, KOG3905, Dynein light intermediate chain [Cell motility]. Length = 473 Score = 26.5 bits (58), Expect = 9.8 Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 114 ILVVGVNGVGKTTVIGKLSK 133 +LV+G NG GKT++I KL Sbjct: 55 VLVLGDNGSGKTSLISKLQG 74 >gnl|CDD|29995 cd01129, PulE-GspE, PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP). It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.. Length = 264 Score = 26.7 bits (59), Expect = 9.8 Identities = 27/111 (24%), Positives = 44/111 (39%), Gaps = 8/111 (7%) Query: 34 DIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIH 93 DI R+ DG R L+ D+ V+ I E + R + D+ +L Sbjct: 9 DIAERRKPQDG-RIRLKLKGREIDLRVSTLPTIYGESVVLRILDKKNQI---LDLEKLG- 63 Query: 94 KMLMPLSKPFNWDFSHRPH-VILVVGVNGVGKTTVIGKLSKKMSDAGLKVM 143 L P + +PH +ILV G G GKTT + +++ ++ Sbjct: 64 --LKPENLEIFRKLLEKPHGIILVTGPTGSGKTTTLYSALSELNTPEKNII 112 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.136 0.383 Gapped Lambda K H 0.267 0.0626 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,683,853 Number of extensions: 194815 Number of successful extensions: 1049 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1035 Number of HSP's successfully gapped: 175 Length of query: 321 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 227 Effective length of database: 4,232,491 Effective search space: 960775457 Effective search space used: 960775457 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (26.0 bits)