HHsearch alignment for GI: 254780710 and conserved domain: PRK13969

>PRK13969 proline racemase; Provisional.
Probab=98.76  E-value=2.6e-05  Score=54.87  Aligned_cols=266  Identities=13%  Similarity=0.138  Sum_probs=141.7

Q ss_pred             CCCCEEEEECCCCCCEEEEE-CCCCCCCCCH-----------HHHH-HHCC-CCCC-CCCEEEEEECCCCCCCCEEEEEE
Q ss_conf             75411378517677389994-7788878888-----------8998-7203-5671-43558998258888866899997
Q gi|254780710|r    3 SSMVDFAKMEGIGNKILVID-MRGCHDNITS-----------DAIN-ALST-DDNT-HFDQIMLIHDFQDASVDAFIRII   67 (296)
Q Consensus         3 ~~mi~F~Kmhg~GNDFiiiD-~~~~~~~~~~-----------~~i~-~~~~-~~gi-G~Dgli~i~~~~~~~~d~~m~~f   67 (296)
T Consensus         4 ~~~i~~iD~Ht~GEP~RiV~~G~p~l~G~t~~ekr~~~~~~~D~lR~~Lm~EPRGh~~M~Ga-ll~pp~~~~Ad~Gvif~   82 (335)
T PRK13969          4 IKTIQTIESHTMGEPTRIVIGGLPKVPGKTMAEKMEYLEENNDSLRTMLMSEPRGHNDMFGA-IYTEPADETADLGIIFM   82 (335)
T ss_pred             CEEEEEEECCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEE-EEECCCCCCCCEEEEEE
T ss_conf             31788996557988757997398899999999999999866579999976089988761789-97089998888899999


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHCC--C----CCCEEEEEECCCCEEEEEC-CCCE-EEECC-CCCCCCHH-HCCCCCCCC
Q ss_conf             178762123320332231110013--5----7640379835883799985-7742-77403-68777777-685656565
Q gi|254780710|r   68 NCDGSEVQSCGNGMRCVVRFLTSR--M----KRKSFTFETIRGILVAKEN-RDGS-ISVDM-GEPILDWK-LIPLARSFD  137 (296)
Q Consensus        68 N~DGS~A~mCGNG~Rc~a~yl~~~--~----~~~~~~i~T~~g~~~~~~~-~~~~-v~V~m-G~p~~~~~-~ip~~~~~~  137 (296)
T Consensus        83 ~~~gy~-~McGh~tI~~~t~lve~G~v~~~~p~t~v~ietPaGlV~a~~~~~~gkv~~V~f~nVPsf~~~~d~~v~vp--  159 (335)
T PRK13969         83 DGGGYL-NMCGHGSIGAATCAVEMGIVKVEEPYTNIKLEAPAGMINARVKVEDGKAKETSIVNVPAFLYKKDVEIDVP--  159 (335)
T ss_pred             ECCCCC-CCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCEEEEEEEEECCCEEEEEEEEEECHHHHCCCEEECC--
T ss_conf             378677-54353278888899985971466896589998689529999999289502899997401464379689878--


Q ss_pred             CCCCCEEECCCCCCCEECCEEEEECCCCEEEEECC------CCCCHHHHHHHHHCCC---------CCCCCCCCCCEEEE
Q ss_conf             43443011057777402130999558742797425------5768688876310002---------33237555514679
Q gi|254780710|r  138 KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE------DDLYHYDLASFGNLLA---------KHPMFSEGVNLSIA  202 (296)
Q Consensus       138 ~~~~~~~~~~~~~~~~~~~~~~v~iGNPH~Vi~v~------d~i~~~~l~~~g~~i~---------~~~~Fp~gvNV~fv  202 (296)
T Consensus       160 ~~G~--v~-----------vDiayGG~fyaiVd~~~lgl~l~~~~~~~l~~~g~~I~~a~~~~~~~~hP~~~~i~~i~~v  226 (335)
T PRK13969        160 DYGK--LT-----------LDISFGGSFFAMVDAEKVGIDISPANSQKLNDLGMKIVHAVNEQVEIKHPVLEHIKTVDLC  226 (335)
T ss_pred             CCCC--EE-----------EEEEECCEEEEEEEHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEE
T ss_conf             9775--79-----------9997266389998789939876832799999999999999986537879887777716899


Q ss_pred             EECCCCE-----E-EEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC--CCEEEECCCCEE-EEEE------ECCCE--E
Q ss_conf             9728872-----8-999804678766563235899999999817889--807999079579-9999------58981--9
Q gi|254780710|r  203 RVTSLES-----L-DLRTWERGVGLTAACGSAACASVVASGCLHKTN--RAVSVKMLGGGL-LIEW------HDNNH--V  265 (296)
Q Consensus       203 ~v~~~~~-----I-~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~~~--~~v~V~~pGG~L-~v~~------~~~~~--i  265 (296)
T Consensus       227 ~~~~~~~~~~~~~rn~vv~~~g~iDRSPcGTGtSARlA~l~a~G~l~~ge~~~~eSIiGs~F~~~i~~~t~~g~~~aVip  306 (335)
T PRK13969        227 EFYGPAKSEDADVQNVVVFGQGQVDRSPCGTGTSAKMALLYAQGKMKVGEEIVNESIICTKFKGKILEETKVGEYDGIIP  306 (335)
T ss_pred             EECCCCCCCCCCEEEEEEECCCCEECCCCCCCHHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEEEEEEEEECCCCEEEE
T ss_conf             98079888887615689989982626887512899999999769977999099996028769999999999889587999


Q ss_pred             EEEECEEEEEEEEEEECCCC
Q ss_conf             99946289998899841320
Q gi|254780710|r  266 FMTGEAKKEWEGKLDIKTGK  285 (296)
Q Consensus       266 ~l~Gpa~~vf~G~~~i~~~~  285 (296)
T Consensus       307 ~I~G~A~itG~~~~~~d~~D  326 (335)
T PRK13969        307 EITGSAYVTGFSQFLVDEED  326 (335)
T ss_pred             EEEEEEEEEEEEEEEECCCC
T ss_conf             99999999998899967999