HHsearch alignment for GI: 254780710 and conserved domain: PRK13971

>PRK13971 hydroxyproline-2-epimerase; Provisional.
Probab=98.67  E-value=2.9e-05  Score=54.55  Aligned_cols=273  Identities=15%  Similarity=0.121  Sum_probs=140.1

Q ss_pred             CCCCCCEEEEECCCCCCEEEEEC-CCCCCCCCHHH-----------HH-HHCC-CCCC-CCCEEEEEECCCCCCCCEEEE
Q ss_conf             98754113785176773899947-78887888889-----------98-7203-5671-435589982588888668999
Q gi|254780710|r    1 MQSSMVDFAKMEGIGNKILVIDM-RGCHDNITSDA-----------IN-ALST-DDNT-HFDQIMLIHDFQDASVDAFIR   65 (296)
Q Consensus         1 ~~~~mi~F~Kmhg~GNDFiiiD~-~~~~~~~~~~~-----------i~-~~~~-~~gi-G~Dgli~i~~~~~~~~d~~m~   65 (296)
T Consensus         1 ~~~~~~~~ID~Ht~GEp~RII~~G~p~l~G~T~~ekr~~~~~~~D~lR~~Lm~EPRGh~~M~Ga-ll~pp~~~~Ad~Gvi   79 (333)
T PRK13971          1 MMRHTFFCIDGHTCGNPVRLVAGGGPLLEGATMSEKRAHFLREYDWIRTALMFEPRGHDMMSGS-ILYPPTRPDCDAAIL   79 (333)
T ss_pred             CCCCEEEEEECCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEE-EEECCCCCCCCEEEE
T ss_conf             9652689996568988768997088899998999999999875368999975678888741889-981899987888999


Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHCC--C---CCCEEEEEECCCCEEEEECCC-C-EEEECC-CCCCCCHH-HCCCCCCC
Q ss_conf             97178762123320332231110013--5---764037983588379998577-4-277403-68777777-68565656
Q gi|254780710|r   66 IINCDGSEVQSCGNGMRCVVRFLTSR--M---KRKSFTFETIRGILVAKENRD-G-SISVDM-GEPILDWK-LIPLARSF  136 (296)
Q Consensus        66 ~fN~DGS~A~mCGNG~Rc~a~yl~~~--~---~~~~~~i~T~~g~~~~~~~~~-~-~v~V~m-G~p~~~~~-~ip~~~~~  136 (296)
T Consensus        80 f~~~~gy~-~McGh~tI~~~t~lve~G~v~~~ep~~v~ietPaG~V~v~~~~~~gkv~~V~f~nVPsf~~~~d~~V~vp-  157 (333)
T PRK13971         80 FIETSGCL-PMCGHGTIGTVTAAIEEGLVTPKEPGKLTIDTPAGQVDIEYEQDGEKVESVRLTNVPSYLHAEDVEVEVP-  157 (333)
T ss_pred             EEECCCCC-CCCCCCHHEEEHHHHHCCCCCCCCCCEEEEECCCEEEEEEEEECCCEEEEEEEEEEEHHHHHCCCEEECC-
T ss_conf             99278776-6425430012226888598567898579986683689999998599288999996143574489689889-


Q ss_pred             CCCCCCEEECCCCCCCEECCEE-EEECCCCEEEEECCCCCCHHHHHHHHHCCCC---------CCCCCCCCCEEEEEECC
Q ss_conf             5434430110577774021309-9955874279742557686888763100023---------32375555146799728
Q gi|254780710|r  137 DKMDRDRFHIGPVNHLFLRNPF-VVSMGNPHAIFFVEDDLYHYDLASFGNLLAK---------HPMFSEGVNLSIARVTS  206 (296)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~~~-~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~---------~~~Fp~gvNV~fv~v~~  206 (296)
T Consensus       158 -g~G~--v~v---DiayGG~~yaiVda--~~~g~~l-~~~~~~~l~~~g~~ik~a~~~~~~~~hP~~~~i~~i~~v~~~~  228 (333)
T PRK13971        158 -GLGP--LKV---DVAYGGNFYAIVEP--QENFPGL-DHWSAADILAWSPVLRQALNEKYEFVHPDDPRIRGVSHVLWTG  228 (333)
T ss_pred             -CCCC--EEE---EEEECCEEEEEEEH--HHCCCCC-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEC
T ss_conf             -9775--789---99826648999867--8937776-8458999999999999999854577588887657604899955


Q ss_pred             CC-----E-EEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC--CCEEEECCCCEE-E--E----EEECCCE--EEEEE
Q ss_conf             87-----2-8999804678766563235899999999817889--807999079579-9--9----9958981--99994
Q gi|254780710|r  207 LE-----S-LDLRTWERGVGLTAACGSAACASVVASGCLHKTN--RAVSVKMLGGGL-L--I----EWHDNNH--VFMTG  269 (296)
Q Consensus       207 ~~-----~-I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~~~--~~v~V~~pGG~L-~--v----~~~~~~~--i~l~G  269 (296)
T Consensus       229 ~~~~~~~~~rn~v~~~~g~iDRSPcGTGtsARlA~l~a~G~l~~ge~~~~eSIiGs~F~~~i~~~~~vg~~~aVip~I~G  308 (333)
T PRK13971        229 KPISPGADGRNAVFYGDKAIDRSPCGTGTSARMAQLAAKGKLKVGDEFVHESIIGSLFEGRVEAAATVGGRPAILPSIAG  308 (333)
T ss_pred             CCCCCCCCEEEEEEECCCCEECCCCCHHHHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEEEEEEEEECCCCEEEEEEEE
T ss_conf             89887776168999699845448872518999999997799779985999842588099999999998992789999999


Q ss_pred             CEEEEEEEEEEECCCC
Q ss_conf             6289998899841320
Q gi|254780710|r  270 EAKKEWEGKLDIKTGK  285 (296)
Q Consensus       270 pa~~vf~G~~~i~~~~  285 (296)
T Consensus       309 ~A~itG~~~f~~d~~D  324 (333)
T PRK13971        309 WARVTGHNTIFVDDRD  324 (333)
T ss_pred             EEEEEEEEEEEECCCC
T ss_conf             9999998899977999