HHsearch alignment for GI: 254780710 and conserved domain: TIGR00654

>TIGR00654 PhzF_family phenazine biosynthesis protein PhzF family; InterPro: IPR003719 Five genes, phzF, phzA, phzB, phzC and phzD, encode enzymes for phenazine biosynthesis in the biological control bacterium Pseudomonas chlororaphis (Pseudomonas aureofaciens). Protein PhzF is similar to 3-deoxy-D-arabino-heptulosonate-7-phosphate synthases of solanaceous plants. PhzC is responsible for the conversion of phenazine-I-carboxylic acid to 2-hydroxy-phenazine-I-carboxylic acid .; GO: 0003824 catalytic activity, 0009058 biosynthetic process.
Probab=99.04  E-value=1.6e-07  Score=69.51  Aligned_cols=265  Identities=17%  Similarity=0.167  Sum_probs=170.2

Q ss_pred             EEEECCCCCCEEEEECCCC-CCCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             3785176773899947788-878888899872035671435589982588888668999971787621233203322311
Q gi|254780710|r    8 FAKMEGIGNKILVIDMRGC-HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVR   86 (296)
Q Consensus         8 F~Kmhg~GNDFiiiD~~~~-~~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~a~   86 (296)
T Consensus        11 FT~~pF~GNp~aV~~~~e~dene~s~~~mQ~IA~~~ny--SET~F~~~P~~~~~d~~LR~FTP-~~El~~aGHaTigs~y   87 (314)
T TIGR00654        11 FTSQPFKGNPAAVVLDAEDDENELSEEEMQLIAEEINY--SETAFLLKPVSEKADLRLRIFTP-KSELPFAGHATIGSLY   87 (314)
T ss_pred             EECCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCC--CEEEEEECCCCCCCCEEEEEECC-CCCCCCCCCHHHHHHH
T ss_conf             74689898744887057687000587899999997188--40255317878766637887648-7534777864389999


Q ss_pred             HH--HCC---CCCCEEEEEECCCCEEEEECCC-C--EEEECCCCCCCCHHHCCCCCCCCCCCCCEEECCCCCCCEE-CCE
Q ss_conf             10--013---5764037983588379998577-4--2774036877777768565656543443011057777402-130
Q gi|254780710|r   87 FL--TSR---MKRKSFTFETIRGILVAKENRD-G--SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFL-RNP  157 (296)
Q Consensus        87 yl--~~~---~~~~~~~i~T~~g~~~~~~~~~-~--~v~V~mG~p~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~-~~~  157 (296)
T Consensus        88 ~~Gl~~~~~~~~~~t~~~~~~~G~~Pvti~~~~g~l~is~~~~~~~f~~~---~~~~~~~~l~~aLGLt~d~~~~~elpi  164 (314)
T TIGR00654        88 ALGLLEVTKLEVATTLVQEEKAGLVPVTIEEKDGQLRISLEQAAPDFEPK---LSGESRADLAKALGLTEDDFLKGELPI  164 (314)
T ss_pred             HHHHHCCCCCCCEEEEEEECCCCEEEEEEECCCCCEEEEEECCCCCCCCC---CCHHHHHHHHHHHCCCHHHHCCCCCCC
T ss_conf             87620057875102388703676056788615892788600258888889---876889999998387756816887660


Q ss_pred             EEEECCCCEEEEECCCCCC----HHHHHHHHHCCC---CCCCCCCCCCEEEEEECCCCE---EEEEECC-CCCC--CCCC
Q ss_conf             9995587427974255768----688876310002---332375555146799728872---8999804-6787--6656
Q gi|254780710|r  158 FVVSMGNPHAIFFVEDDLY----HYDLASFGNLLA---KHPMFSEGVNLSIARVTSLES---LDLRTWE-RGVG--LTAA  224 (296)
Q Consensus       158 ~~v~iGNPH~Vi~v~d~i~----~~~l~~~g~~i~---~~~~Fp~gvNV~fv~v~~~~~---I~iRt~E-RGvG--eTlA  224 (296)
T Consensus       165 ~~~~tG~~~~~ipl~~~e~~~~~~P~~~~l~~~~~~~~~~gv~~~~~~~~---~~~~~~nkl~~gR~FasP~~gi~EDPv  241 (314)
T TIGR00654       165 QLLSTGLEFVVIPLKDEEALKKLSPDLKVLAELLKKLDKDGVYPFAPKKE---AAGKSDNKLLHGRMFASPVIGIVEDPV  241 (314)
T ss_pred             EEECCCCEEEEEECCCHHHHHHHCCCHHHHHHHHHCCCCCEEEECCCCCC---CCCCCCCHHHCCEEECCCCCCCEECCC
T ss_conf             45406753798851786998651788889999985078765886366776---788763101026000278776255572


Q ss_pred             CHHHHHHHHHHHHHHCCC--CCCEEEE----CCCC------EEEEEEE--CC--CEEEEEECEEEEEEEEEEE
Q ss_conf             323589999999981788--9807999----0795------7999995--89--8199994628999889984
Q gi|254780710|r  225 CGSAACASVVASGCLHKT--NRAVSVK----MLGG------GLLIEWH--DN--NHVFMTGEAKKEWEGKLDI  281 (296)
Q Consensus       225 CGTGA~Asa~~~~~~~~~--~~~v~V~----~pGG------~L~v~~~--~~--~~i~l~Gpa~~vf~G~~~i  281 (296)
T Consensus       242 tG~g~~~lg~YL~~~~~~~~~h~~~i~rvkGhqG~~Lgr~g~~~~~v~~~~~~~~~v~iaG~Av~~~~~~~~~  314 (314)
T TIGR00654       242 TGSGSGALGAYLKHVLDNEKSHDITIERVKGHQGKALGRDGKLEVTVKKEGDNSEKVKIAGTAVLVIEGKLKI  314 (314)
T ss_pred             CCCCCHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCEEEEEEEECCCCEEEEEEEEEEEEEEEEEECC
T ss_conf             1565367778898750686675348998505567301789618999994178847999977899875224519