HHsearch alignment of GI: 254780710 and MMDB domain: 1ym5_A_

>1ym5_A (A:) YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region; PHZF enzyme superfamily, double hot-DOG, structural genomics; 2.05A {Saccharomyces cerevisiae}
Probab=100.00  E-value=4.6e-39  Score=276.97  Aligned_cols=263  Identities=15%  Similarity=0.185  Sum_probs=208.2

Q ss_pred             EEEECCCCCCEEEEECCCCC-CCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             37851767738999477888-78888899872035671435589982588888668999971787621233203322311
Q gi|254780710|r    8 FAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVR   86 (296)
Q Consensus         8 F~Kmhg~GNDFiiiD~~~~~-~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~a~   86 (296)
                      |+|||++||+|+||+....+ ..++....+.|+++.+.+.|++|+.  +.+...|++|+|||+||+. .|||||+||+++
T Consensus        13 F~k~~~~GN~~~Vv~~~~~~~~~~~~~~~~~~ar~~~~~~~~fi~~--~~~~~~~~~~r~f~~~ge~-~~CGh~t~~~a~   89 (300)
T 1ym5_A           13 FTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFK--PSDKKYDYKLRIFTPRSEL-PFAGHPTIGSCK   89 (300)
T ss_dssp             TCSSTTSSEEEEEEECTTSCGGGSCHHHHHHHHHHHTSSCEEEEEC--CSSTTCSEEEEEECSSCEE-SCCHHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEC--CCCCCCCEEEEEECCCCCH-HHCCCCCHHEEE
T ss_conf             5599998857499973667867989999999999869987999956--8898864899996378762-003673032046


Q ss_pred             HHHCCC---CCCEEEEEECCCCEEEEECCCCEEEECCCCCCCCHHHCCCCCCCCCCCCCEEECCCCCCCEECCEEEEECC
Q ss_conf             100135---76403798358837999857742774036877777768565656543443011057777402130999558
Q gi|254780710|r   87 FLTSRM---KRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMG  163 (296)
Q Consensus        87 yl~~~~---~~~~~~i~T~~g~~~~~~~~~~~v~V~mG~p~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~iG  163 (296)
                      ||++..   ....+.++|.+|.+.+....+ .++|++..|.+.+...|........         ...........+++|
T Consensus        90 ~l~~~~~~~~~~~~~~~t~~g~~~~~~~~~-~~~v~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~g  159 (300)
T 1ym5_A           90 AFLEFTKNTTATSLVQECKIGAVPITINEG-LISFKAPMADYESISSEMIADYEKA---------IGLKFIKPPALLHTG  159 (300)
T ss_dssp             HHHHHTTCSCCSEEEEEETTEEEEEEEETT-EEEEECSCCEEEECCHHHHHHHHHH---------HTSCCSSCCEEEESS
T ss_pred             EEEEEEECCCCCEEEEEEECCEEEEEEEEC-CCCCCCCCCCCCCCCCHHHHHHHHH---------HHCCCCCCCEEEECC
T ss_conf             454443048873687863010014543101-1001245654445670332013444---------311357881999448


Q ss_pred             CCEEEEECCCCCCH-----HHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCC--CCCCCHHHHHHHHHHH
Q ss_conf             74279742557686-----8887631000233237555514679972887289998046787--6656323589999999
Q gi|254780710|r  164 NPHAIFFVEDDLYH-----YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVG--LTAACGSAACASVVAS  236 (296)
Q Consensus       164 NPH~Vi~v~d~i~~-----~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvG--eTlACGTGA~Asa~~~  236 (296)
                      +||+++++. +.+.     .+++.+....+.+..++..+|+.|....++..+.+|+|+++.|  ||.|||||+||.+++.
T Consensus       160 ~~~~~~~~~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~f~~~~G~~Ed~atGS~~~ala~~l  238 (300)
T 1ym5_A          160 PEWIVALVE-DAETCFNANPNFAMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYL  238 (300)
T ss_dssp             SEEEEEECS-CHHHHHHCCCCHHHHHHHHHHHTCCEEEEEEECTTCSSTTEEEEEEEEGGGTEEEESSCHHHHHHHHHHH
T ss_pred             CCEEEEEEC-CHHHHHHHCCCHHHHHHHHHCCCCCCEEEEEEECCCCCCEEEEEEEEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             997999936-6687300014633422333125765248876520368760799998875055544723231378899999


Q ss_pred             HHHCCCCCCE--EEE-----CCCCEEEEEEECCC----EEEEEECEEEEEEEEEEECCC
Q ss_conf             9817889807--999-----07957999995898----199994628999889984132
Q gi|254780710|r  237 GCLHKTNRAV--SVK-----MLGGGLLIEWHDNN----HVFMTGEAKKEWEGKLDIKTG  284 (296)
Q Consensus       237 ~~~~~~~~~v--~V~-----~pGG~L~v~~~~~~----~i~l~Gpa~~vf~G~~~i~~~  284 (296)
                      .+.++.+...  .+.     .+||.|.++|..++    +|+++|+|.++++|+++|..-
T Consensus       239 ~~~~~~~~~~~~~~~qg~~~~~~g~i~v~~~~~~~~~~~v~i~G~a~~v~~g~~~l~~~  297 (300)
T 1ym5_A          239 QEVYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKVHHH  297 (300)
T ss_dssp             HHHHCCSSCEEEEEEECGGGTCCEEEEEEEEECTTSCEEEEEEECEEEEEEEEEEEC--
T ss_pred             HHHCCCCCCEEEEEECCCCCCCCEEEEEEEEECCCCCCEEEEEEEEEEEEEEEEEEEEE
T ss_conf             98359998579999805313898599999997689863699991599999999999861