HHsearch alignment of GI: 254780710 and MMDB domain: 2gke_A_

>2gke_A (A:) DAP epimerase, diaminopimelate epimerase; enzyme-inhibitor complex, covalently bound inhibitor, isomerase; HET: ZDP; 1.35A {Haemophilus influenzae}
Probab=96.46  E-value=0.072  Score=31.80  Aligned_cols=105  Identities=16%  Similarity=0.181  Sum_probs=70.9

Q ss_pred             EECCCCEEEEECCCC---CCHHHHHHHHHCCCCCCCCCCCCCEEEEEEC--CCCEEEEEECCCCCCCCCCCHHHHHHHHH
Q ss_conf             955874279742557---6868887631000233237555514679972--88728999804678766563235899999
Q gi|254780710|r  160 VSMGNPHAIFFVEDD---LYHYDLASFGNLLAKHPMFSEGVNLSIARVT--SLESLDLRTWERGVGLTAACGSAACASVV  234 (296)
Q Consensus       160 v~iGNPH~Vi~v~d~---i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~--~~~~I~iRt~ERGvGeTlACGTGA~Asa~  234 (296)
                      -..|||=.|+.-.+.   +.......+...-+.+ .+   -.+-|+...  +....++|.|.----|..=||.|+.|++.
T Consensus         7 ~~~GN~~~Vv~~~~~~~~l~~~~~q~ia~e~r~~-~~---~~~~fv~~~~~~~~~~~~r~f~~~G~e~~~CGh~t~a~a~   82 (274)
T 2gke_A            7 HGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGI-GF---DQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCFAR   82 (274)
T ss_dssp             EETTEEEEEEECSSSCCCCCHHHHHHHHCTTTSC-CC---SEEEEEECCSSTTSSEEEEEEETTSCEESCCHHHHHHHHH
T ss_pred             ECCCCEEEEEECCCCCCCCCHHHHHHHHCCCCCC-CC---CEEEEEECCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             6499839999789886789999999875668785-76---5799997277887550689860664576531138899999


Q ss_pred             HHHHHCCCC-CCEEEECCCCEEEEEEECCCEEEEE
Q ss_conf             999817889-8079990795799999589819999
Q gi|254780710|r  235 ASGCLHKTN-RAVSVKMLGGGLLIEWHDNNHVFMT  268 (296)
Q Consensus       235 ~~~~~~~~~-~~v~V~~pGG~L~v~~~~~~~i~l~  268 (296)
                      +....++.. ..+.+.+++|.+.++...++.+++.
T Consensus        83 ~l~~~~~~~~~~~~l~t~~g~~~v~~~~~~~~~~~  117 (274)
T 2gke_A           83 FVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVN  117 (274)
T ss_dssp             HHHHTTSCCCSEEEEECSSCEEEEEECTTSCEEEE
T ss_pred             HHHHHCCCCCCEEEEEECCCCEEEEECCCCEEEEC
T ss_conf             99862235431269996587247752136258741