HHsearch alignment of GI: 254780710 and MMDB domain: 2otn_A_97-293

>2otn_A (A:97-293) Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str}
Probab=100.00  E-value=0  Score=392.56  Aligned_cols=188  Identities=37%  Similarity=0.654  Sum_probs=168.0

Q ss_pred             CCHHHHHHHHHHCC--CCCCEEEEEECCCCEEEEECCCC----EEEECCCCCCCCHHHCCCCCCCCCCCCC-EEECCCCC
Q ss_conf             20332231110013--57640379835883799985774----2774036877777768565656543443-01105777
Q gi|254780710|r   78 GNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISVDMGEPILDWKLIPLARSFDKMDRD-RFHIGPVN  150 (296)
Q Consensus        78 GNG~Rc~a~yl~~~--~~~~~~~i~T~~g~~~~~~~~~~----~v~V~mG~p~~~~~~ip~~~~~~~~~~~-~~~~~~~~  150 (296)
                      |||+||+++||+++  ..++++.|+|.+|++.++...++    .|+|+||.|+|.++++|+....+....+ .+..    
T Consensus         1 GNG~Rc~a~~l~~~g~~~~~~~~i~T~aG~~~~~~~~~~~~~~~v~V~MG~p~~~~~~ip~~~~~~~~~~~~~~~~----   76 (197)
T 2otn_A            1 GNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLY----   76 (197)
T ss_dssp             TTTHHHHHHHHHHTTSCSSSEEEEEETTEEEEEEEEESSSSEEEEEEEEECCBCSGGGTTCCSSCCSSSEEEEEEE----
T ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEECCCCCEEEEEEECCCEEEEEEEECCCCEECHHHCCCCCCCCCCCCCEEEEC----
T ss_conf             5168888857655277644211101048717899973276158998633685644001332122466332101320----


Q ss_pred             CCEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             74021309995587427974255768688876310002332375555146799728872899980467876656323589
Q gi|254780710|r  151 HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC  230 (296)
Q Consensus       151 ~~~~~~~~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~  230 (296)
                      ......+++|+|||||||+|++ +++.+++..+|+.+++||.||+|+||+|+|++++++|++||||||+|||+|||||||
T Consensus        77 ~~~~~~~~~v~~GnPH~V~fv~-~~~~~~~~~~g~~i~~~~~FP~g~NV~fv~v~~~~~i~~Rt~ERG~geTlACGTGac  155 (197)
T 2otn_A           77 NNHRYAFTAVSMGNPHAVIFVD-DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGAC  155 (197)
T ss_dssp             TTEEEEEEEEESSSEEEEEECS-CGGGSCTTTHHHHHHTCTTCTTCCEEEEEEEEETTEEEEEEECSSSCBCSCCHHHHH
T ss_pred             CCCCEEEEEEECCCCEEEEEEE-EECCCCHHCCCCCCCCCCCCCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             4761026999638950899984-001233110064001434476543224678740433899996478863335005689


Q ss_pred             HHHHHHHHHCCCC--CCEEEECCCCEEEEEEECCCEEEEEEC
Q ss_conf             9999999817889--807999079579999958981999946
Q gi|254780710|r  231 ASVVASGCLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGE  270 (296)
Q Consensus       231 Asa~~~~~~~~~~--~~v~V~~pGG~L~v~~~~~~~i~l~Gp  270 (296)
                      |+|+++.++++++  .+++|++|||+|.|+|.++++|+|+||
T Consensus       156 Aaa~~a~~~g~~~~~~~v~V~~~GG~L~V~~~~~~~i~ltGP  197 (197)
T 2otn_A          156 AAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGP  197 (197)
T ss_dssp             HHHHHHHHTTSSCTTCCEEEECSSCEEEEEECTTSCEEEEEE
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCEEEEEEECCCCEEEEEC
T ss_conf             999999984756789879999799789999957995999927