HHsearch alignment of GI: 254780710 and MMDB domain: 3g7k_A_

>3g7k_A (A:) 3-methylitaconate isomerase; DAPF family fold, closed conformation, open conformation; 2.70A {Eubacterium barkeri}
Probab=99.85  E-value=3.7e-20  Score=152.35  Aligned_cols=269  Identities=14%  Similarity=0.062  Sum_probs=163.9

Q ss_pred             CEEEEECCCCCCEEEEECCCCCCCCCHHHHHHHCCC--C---C-----CCCCEEEEEECCCCCCCCEEEEEEECCCCCCC
Q ss_conf             113785176773899947788878888899872035--6---7-----14355899825888886689999717876212
Q gi|254780710|r    6 VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD--D---N-----THFDQIMLIHDFQDASVDAFIRIINCDGSEVQ   75 (296)
Q Consensus         6 i~F~Kmhg~GNDFiiiD~~~~~~~~~~~~i~~~~~~--~---g-----iG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~   75 (296)
                      +.|++++.+.+|+-..|         ......+..-  +   |     ...+++.+|.||.++.+|+.+.|++.|+++++
T Consensus        19 ~~~~~~e~l~~~~~~~D---------~lr~~lm~eP~~R~~~gm~G~~~~~skv~ii~pp~~p~aD~~~~f~q~~~~~~~   89 (391)
T 3g7k_A           19 GIFLKGNDLPADQELRD---------KVILRIFGSPDVRQIDGLAGADPLTSKLAIIGPSTHPDADVDYTFAQVSITDAV   89 (391)
T ss_dssp             EEEEEGGGSCSSHHHHH---------HHHHHHHTCSCTTCTTSSSCSSGGGSEEEEEEECCSTTCSEEEEEEEECSSSSC
T ss_pred             EEEECHHHCCCCHHHHH---------HHHHHHHCCCCHHHCCCCCCCCCCCCEEEEEECCCCCCCCEEEEEEEEECCCCE
T ss_conf             53661766898878999---------999997089980212676677666634999915878885047888865226643


Q ss_pred             -----CCCCHHHHHHHHHHCC--C----CCCEEEEE--ECCCCEEEEEC-CCCEEEEC----------CCCCCCCH-HHC
Q ss_conf             -----3320332231110013--5----76403798--35883799985-77427740----------36877777-768
Q gi|254780710|r   76 -----SCGNGMRCVVRFLTSR--M----KRKSFTFE--TIRGILVAKEN-RDGSISVD----------MGEPILDW-KLI  130 (296)
Q Consensus        76 -----mCGNG~Rc~a~yl~~~--~----~~~~~~i~--T~~g~~~~~~~-~~~~v~V~----------mG~p~~~~-~~i  130 (296)
                           ||||+++|++.|+.+.  .    ....++|.  +.++++.++.. .++.+.++          .+.|.+.. .+.
T Consensus        90 vd~~~mCGn~~~~v~~~ave~Glv~~~~~~t~v~i~~~n~~~~v~~~v~~~~G~v~~~g~~~i~gV~~~~~p~~l~~~d~  169 (391)
T 3g7k_A           90 VDYNGNCGNISAGVGPFAIDESFVKAVEPMTRVCIHNTNTGKLLYAEVEVEDGKAKVSGDCKIDGVPGTNAPELMDFSDT  169 (391)
T ss_dssp             EECSSCCHHHHHHHHHHHHHTTSSCCCSSEEEEEEEETTTCCEEEEEEEEETTEECCCCSBCCTTSSSCBCCEEEECGGG
T ss_pred             EECCCCCCCHHHHCCHHHHHCCCCCCCCCCEEEEEEECCCCCEEEEEEECCCCCCCCCCCEECCCCCCCCCCEECCCCCC
T ss_conf             30444544345403056886687246899368999971789778988755898122006623357888888326346787


Q ss_pred             CCCCCC--CCCCCCEEECCCCCCCEECCEEEEECCCCEEEEECCCCCC------H------HHHHHHHHCCCC-------
Q ss_conf             565656--5434430110577774021309995587427974255768------6------888763100023-------
Q gi|254780710|r  131 PLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY------H------YDLASFGNLLAK-------  189 (296)
Q Consensus       131 p~~~~~--~~~~~~~~~~~~~~~~~~~~~~~v~iGNPH~Vi~v~d~i~------~------~~l~~~g~~i~~-------  189 (296)
                      +.....  -.+......+..  ........+++.||||+++-.+ ++-      .      ..+..++..|+.       
T Consensus       170 ~~~~~G~llPtg~~~d~i~~--~~g~v~v~~v~~G~p~~iV~a~-~lGl~~~~~~~~~~~~~~l~~~~e~iR~~a~~~mg  246 (391)
T 3g7k_A          170 AGAATGKVLPTGNVVDVLST--SKGDIDVSIVDVANPCIFVHAK-DVNMTGTETPDVINGNADLLAYLEEIRAKCCVKIG  246 (391)
T ss_dssp             BTTTTSSSSTTSCSCEEECC--TTCCEEEEEEEBSSEEEEEESG-GGTCCSCCCHHHHHTCHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCCEEEEC--CCCEEEEEEEECCCCEEEEEHH-HCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHC
T ss_conf             77778877789997507955--8980899999678848999867-75887754798784389999999999999999707


Q ss_pred             -----------CCCCCCCCCE-----------EEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC----
Q ss_conf             -----------3237555514-----------67997288728999804678766563235899999999817889----
Q gi|254780710|r  190 -----------HPMFSEGVNL-----------SIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN----  243 (296)
Q Consensus       190 -----------~~~Fp~gvNV-----------~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~~~----  243 (296)
                                 |+.+|.-.-|           ...+..+...+.+|+|++|...+..||||+||.+++++..|.+.    
T Consensus       247 l~~~~~~~~~~~~~~pki~~v~~~~~~~~~~~g~~~~~~~~~~~~r~~~~g~~drs~~GTGa~A~~aa~~~~G~l~~~~~  326 (391)
T 3g7k_A          247 MAATEKEASEKSPAFPMIAFVTKPEDYVDFSTGNTISGDDVDLVSRLMFMQVLHKTYAGTATACTGSAARIPGTIVNQVL  326 (391)
T ss_dssp             SCSSHHHHHHHCSSSSEEEEEESCCCEECTTTCCEECTTSCSEEEEEECSSSBCSSCCHHHHHHHHHHHHSTTSHHHHHC
T ss_pred             CCCCHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHH
T ss_conf             77784574303688887999568765666556751336666668898258986323316778888887707984066650


Q ss_pred             ------CCEEEECCCCEEEEEEEC-CC---EEEEEECEEEEEEEEEEECCCCC
Q ss_conf             ------807999079579999958-98---19999462899988998413200
Q gi|254780710|r  244 ------RAVSVKMLGGGLLIEWHD-NN---HVFMTGEAKKEWEGKLDIKTGKW  286 (296)
Q Consensus       244 ------~~v~V~~pGG~L~v~~~~-~~---~i~l~Gpa~~vf~G~~~i~~~~~  286 (296)
                            ..+++..|.|.+.+.+.. +.   .+.++|.|..+++|++.+..--|
T Consensus       327 ~~~~~~~~~~i~~~~G~i~~~~~~~~~~av~~~v~gtA~~~~~g~~~v~~d~~  379 (391)
T 3g7k_A          327 RDTGDEDTVRIGHPAGVIPVVSIVKDGKVEKAALIRTARRIMEGYVYVEKAKL  379 (391)
T ss_dssp             CCCTTCCEEEEEETTEEEEEEEEEETTEEEEEEEEECEEEEEEEEEEEEGGGC
T ss_pred             CCCCCCCEEEEECCCCEEEEEEECCCCCEEEEEEEEEHHHHCEEEEECCHHHC
T ss_conf             36788765999789937999998589958999998630212207897667771