HHsearch results for GI: 254780710 and protein with PDBid: 1u0k_A

>1u0k_A Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.21.1.2 d.21.1.2
Probab=92.77  E-value=0.5  Score=25.24  Aligned_cols=92  Identities=10%  Similarity=0.056  Sum_probs=64.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEE-CCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             5874279742557686888763100023323755551467997-288728999804678766563235899999999817
Q gi|254780710|r  162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARV-TSLESLDLRTWERGVGLTAACGSAACASVVASGCLH  240 (296)
Q Consensus       162 iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v-~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~  240 (296)
                      .|||=+|++..+.+....+..+++.+....       .-|+.- .+....++|.|=-+ +|-.-||-+..|++.+....+
T Consensus        19 ~GNpaaVv~~~~~l~~~~~q~iA~e~~~se-------T~Fv~~~~~~~~~~lr~Ftp~-~E~~~cGHatlaaa~~l~~~~   90 (288)
T 1u0k_A           19 TGNGLAVFDDASALDDAAMQAWTRELRQFE-------SIFLLPGDDPRAFRARIFTLE-EELPFAGHPLLGAAALLHHLR   90 (288)
T ss_dssp             CSEEEEEESCCTTCCHHHHHHHHHHHCCSE-------EEEEEECSCTTEEEEEEEESS-CBCCSCCTHHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCE-------EEEEECCCCCCEEEEEEECCC-CCHHHCCCCHHHHHHHHHHHC
T ss_conf             886569998899989999999999869987-------999966888771899997799-734206852888999886530


Q ss_pred             CCC--CCEEEECCCCEEEEEEEC
Q ss_conf             889--807999079579999958
Q gi|254780710|r  241 KTN--RAVSVKMLGGGLLIEWHD  261 (296)
Q Consensus       241 ~~~--~~v~V~~pGG~L~v~~~~  261 (296)
                      ...  ....+...+|.+.+.+..
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~  113 (288)
T 1u0k_A           91 GGDNEQHWTLHLASKSVALRSVR  113 (288)
T ss_dssp             CCSSCEEEEEECSSCEEEEEEEE
T ss_pred             CCCCCCEEEEEECCCCEEEEEEE
T ss_conf             25787158999604540577761