HHsearch results for GI: 254780710 and protein with PDBid: 1w61_A

>1w61_A B-cell mitogen; racemase, racemase pyridoxal phosphate-independent, stereo inversion, acid/base catalysis, homodimer, alpha/beta domains; 2.1A {Trypanosoma cruzi} PDB: 1w62_A
Probab=99.08  E-value=9.4e-07  Score=62.99  Aligned_cols=266  Identities=13%  Similarity=0.099  Sum_probs=147.8

Q ss_pred             CCCEEEEECCCCCCEEEE-ECCCCCCCCCHHHH------------HHHCC-CCCC-CCCEEEEEECCCCCCCCEEEEEEE
Q ss_conf             541137851767738999-47788878888899------------87203-5671-435589982588888668999971
Q gi|254780710|r    4 SMVDFAKMEGIGNKILVI-DMRGCHDNITSDAI------------NALST-DDNT-HFDQIMLIHDFQDASVDAFIRIIN   68 (296)
Q Consensus         4 ~mi~F~Kmhg~GNDFiii-D~~~~~~~~~~~~i------------~~~~~-~~gi-G~Dgli~i~~~~~~~~d~~m~~fN   68 (296)
                      .||.-.-||..|.=+=|| +.......-+-...            +.|+. -+|- .-=|-|+ .||.++.+|+-+.|++
T Consensus        44 ~~i~~VD~HT~GEP~RIV~~G~p~l~G~T~~Ekr~~~~~~~D~lR~~Lm~EPRGh~~M~Gail-vpP~~p~Ad~Gvifm~  122 (414)
T 1w61_A           44 KSFTCIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMFGAFL-FDPIEEGADLGIVFMD  122 (414)
T ss_dssp             EEEEEEEEEETTEEEEEEEECCCCCCCSSHHHHHHHHHHHCHHHHHHHHSBTTSCTTCEEEEE-ECCCSTTCSEEEEEEE
T ss_pred             CEEEEEECCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEE-CCCCCCCCCEEEEEEC
T ss_conf             407899756898874799748789999999999999986068999997468988875267896-0899977778899981


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCCC--C------CCEEEEEECCCCEEEEEC-CCC---E-EEECC-CCCCCCHH-HCCCC
Q ss_conf             787621233203322311100135--7------640379835883799985-774---2-77403-68777777-68565
Q gi|254780710|r   69 CDGSEVQSCGNGMRCVVRFLTSRM--K------RKSFTFETIRGILVAKEN-RDG---S-ISVDM-GEPILDWK-LIPLA  133 (296)
Q Consensus        69 ~DGS~A~mCGNG~Rc~a~yl~~~~--~------~~~~~i~T~~g~~~~~~~-~~~---~-v~V~m-G~p~~~~~-~ip~~  133 (296)
                      ++|.. .|||.|+-|++.+|.+.-  .      ...+.|+|.+|++.++.. .++   . .+|.+ -.|+|... ++++.
T Consensus       123 ~~Gy~-~MCGH~tI~v~t~lve~G~V~~~~~~t~~~v~ietPaGlV~a~~~~~~G~~~~v~~Vsf~nVPSF~~~~d~~v~  201 (414)
T 1w61_A          123 TGGYL-NMCGHNSIAAVTAAVETGIVSVPAKATNVPVVLDTPAGLVRGTAHLQSGTESEVSNASIINVPSFLYQQDVVVV  201 (414)
T ss_dssp             SSCCC-SCCHHHHHHHHHHHHHTTSSCCCTTCSEEEEEEEETTEEEEEEEEECTTCSSCEEEEEEECSCBEEEEEEEEEE
T ss_pred             CCCCC-CCCCCCHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCEEEEEEEEEECCCCCEEEEEEEEEECHHHHHCCCEEE
T ss_conf             78666-54363388999999986984478887630489856825899999996893020457999976417856397697


Q ss_pred             CCCCCCCCCEEECCCCCCCEECCEEEEECCCCEEEEECCC---CC---CHHHHHHHHHCCC---------CCCCCCCCCC
Q ss_conf             6565434430110577774021309995587427974255---76---8688876310002---------3323755551
Q gi|254780710|r  134 RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED---DL---YHYDLASFGNLLA---------KHPMFSEGVN  198 (296)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~iGNPH~Vi~v~d---~i---~~~~l~~~g~~i~---------~~~~Fp~gvN  198 (296)
                                    ..........-.+.-||-.+++-.++   ++   +.-+|..+|..|+         .||..|+.-.
T Consensus       202 --------------vp~~~G~V~vDiayGG~fYaiVda~~lGl~l~~~n~~~L~~~g~~I~~a~~~~~~~~HP~~~~i~~  267 (414)
T 1w61_A          202 --------------LPKPYGEVRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINT  267 (414)
T ss_dssp             --------------CCTTTCEEEEEEEESSSEEEEEEGGGGTCCSSSTTHHHHHHHHHHHHHHHHHHCCCCCSSCTTCCS
T ss_pred             --------------CCCCCCEEEEEEEECCEEEEEECHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             --------------578744289999855647999843562876580129999999999999998527543877777771


Q ss_pred             EEEEEECCC------CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC--CCEEEECCCCEE-EEEEE------C--
Q ss_conf             467997288------728999804678766563235899999999817889--807999079579-99995------8--
Q gi|254780710|r  199 LSIARVTSL------ESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN--RAVSVKMLGGGL-LIEWH------D--  261 (296)
Q Consensus       199 V~fv~v~~~------~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~~~--~~v~V~~pGG~L-~v~~~------~--  261 (296)
                      +.++...++      ..-.+-+|.-|.=----||||.+|-.+.++..|++.  .+...++.=|.. .-++.      +  
T Consensus       268 i~~v~~~g~~~~~~~~~rn~vv~~~g~iDRSPcGTGTSARlA~l~akG~L~~Ge~~~~eSIiGS~F~g~i~~~~~~g~~~  347 (414)
T 1w61_A          268 VDCVEIYGPPTNPEANYKNVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEERIPGVK  347 (414)
T ss_dssp             EEEEEEEECCSSTTCSEEEEEEETTTEECSSCCHHHHHHHHHHHHHTTCCCTTCCEEEEETTSCEEEEEEEEEEEEETCC
T ss_pred             EEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCEEEEEEEEEEECCCC
T ss_conf             46999957888888773599997999760598717689999999977997899927998425782799997788605633


Q ss_pred             --------CCE----EEEEECEEEEEEEEEEECCCC
Q ss_conf             --------981----999946289998899841320
Q gi|254780710|r  262 --------NNH----VFMTGEAKKEWEGKLDIKTGK  285 (296)
Q Consensus       262 --------~~~----i~l~Gpa~~vf~G~~~i~~~~  285 (296)
                              .+.    ...+|.|-+.-+.++-+...+
T Consensus       348 ~~~~~~~~~g~~AVip~I~G~A~itG~~~f~~d~~D  383 (414)
T 1w61_A          348 VPVTKDAEEGMLVVTAEITGKAFIMGFNTMLFDPTD  383 (414)
T ss_dssp             CTTCCTTSSEEEEEEEEEEECEEEEEEEEEEECTTC
T ss_pred             CCCCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCC
T ss_conf             332123457863699999999999998899987999