HHSEARCH alignment of GI: 254780710 and SCOP domain: d1s7ja_

Alignment
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]}
Probab=94.96  E-value=0.11  Score=27.92  Aligned_cols=97  Identities=15%  Similarity=0.149  Sum_probs=68.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             58742797425576868887631000233237555514679972887289998046787665632358999999998178
Q gi|254780710|r  162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK  241 (296)
Q Consensus       162 iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~  241 (296)
                      .|||-+|++..+.+.......+++.+...+       .-|+.. +.+..++|.|=-. +|-.=||-+..|++.+....+.
T Consensus        17 ~GNp~aVv~~~~~l~~~~mq~IA~e~n~sE-------T~Fv~~-~~~~~~vR~FTp~-~EvpfcGH~Tlaaa~~L~~~~~   87 (260)
T d1s7ja_          17 KGNPAAVYVLEKWLPEAVMQNIAIENNLSE-------TAFTVK-EGQSYALRWFTPE-REIDLCGHATLATAFVLFNYYS   87 (260)
T ss_dssp             SSEEEEEEECSSCCCHHHHHHHHHHHCCSC-------EEEEEE-ETTEEEEEEECSS-SEESCCHHHHHHHHHHHHHHSC
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCC-------EEEECC-CCCCCEEEEEECC-CCCCCCCCHHHHHHHHHHHHCC
T ss_conf             973269998998979999999999869993-------299845-6664047897325-5542125516789999997176


Q ss_pred             CCCC-EEEECCCCEEEEEEECCCEEEEE
Q ss_conf             8980-79990795799999589819999
Q gi|254780710|r  242 TNRA-VSVKMLGGGLLIEWHDNNHVFMT  268 (296)
Q Consensus       242 ~~~~-v~V~~pGG~L~v~~~~~~~i~l~  268 (296)
                      .... ......++.+.+.... +...+.
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~-~~~~~~  114 (260)
T d1s7ja_          88 VAEETLHFTSQSGPLAVTKKE-EYYYLD  114 (260)
T ss_dssp             CCSSEEEEEETTEEEEEEEET-TEEEEE
T ss_pred             CCCCEEEEEEECCCEEEEECC-CCCCCC
T ss_conf             665204588612311222214-641001


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Diaminopimelate epimerase-like
superfamily: Diaminopimelate epimerase-like
family: PhzC/PhzF-like
domain: Hypothetical protein EF0119
species: Enterococcus faecalis [TaxId: 1351]