HHSEARCH alignment of GI: 254780710 and SCOP domain: d2gkea1

Alignment
>d2gkea1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
Probab=100.00  E-value=4.6e-42  Score=294.19  Aligned_cols=127  Identities=37%  Similarity=0.642  Sum_probs=118.9

Q ss_pred             CEEEEECCCCCCEEEEECCCCCCCCCHHHHHHHCCC-CCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             113785176773899947788878888899872035-6714355899825888886689999717876212332033223
Q gi|254780710|r    6 VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCV   84 (296)
Q Consensus         6 i~F~Kmhg~GNDFiiiD~~~~~~~~~~~~i~~~~~~-~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~   84 (296)
                      |+|+||||+||||||+|.+.....+++++++++|+| +|+||||||+|+++..+.+|++|+|||+|||+|+|||||+||+
T Consensus         1 m~F~Km~g~GNDFviiD~~~~~~~~~~~~i~~i~~r~~giG~Dgli~i~~~~~~~~d~~~~ifN~DGS~Ae~CGNG~RCv   80 (130)
T d2gkea1           1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF   80 (130)
T ss_dssp             CEEEEEEETTEEEEEEECSSSCCCCCHHHHHHHHCTTTSCCCSEEEEEECCSSTTSSEEEEEEETTSCEESCCHHHHHHH
T ss_pred             CEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCHHHHCCCHHHHH
T ss_conf             98999971898499997998868999999998750245888752899842446675517889715876766363378999


Q ss_pred             HHHHHCC--CCCCEEEEEECCCCEEEEECCCCEEEECCCCCCCCHHHCCC
Q ss_conf             1110013--57640379835883799985774277403687777776856
Q gi|254780710|r   85 VRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPL  132 (296)
Q Consensus        85 a~yl~~~--~~~~~~~i~T~~g~~~~~~~~~~~v~V~mG~p~~~~~~ip~  132 (296)
                      |+||+++  ..++++.|+|.+|.+.+...+++.|+|+||.|+|.|++||+
T Consensus        81 a~~l~~~~~~~~~~~~i~T~~g~~~~~~~~~~~i~V~Mg~p~f~~~~IPf  130 (130)
T d2gkea1          81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPF  130 (130)
T ss_dssp             HHHHHHTTSCCCSEEEEECSSCEEEEEECTTSCEEEECCCCBCCGGGTTC
T ss_pred             HHHHHHCCCCCCCCEEEEECCCCEEEEEECCCEEEEECCCCCCCCCCCCC
T ss_conf             99999848755761799988986899993799999999826617223899


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Diaminopimelate epimerase-like
superfamily: Diaminopimelate epimerase-like
family: Diaminopimelate epimerase
domain: Diaminopimelate epimerase
species: Haemophilus influenzae [TaxId: 727]