Query         gi|254780710|ref|YP_003065123.1| diaminopimelate epimerase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 296
No_of_seqs    115 out of 2293
Neff          6.6 
Searched_HMMs 13730
Date          Wed Jun  1 08:45:11 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780710.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2gkea2 d.21.1.1 (A:131-274) D 100.0 3.2E-43       0  301.8  14.3  125  156-281    19-144 (144)
  2 d2gkea1 d.21.1.1 (A:1-130) Dia 100.0 4.6E-42       0  294.2  14.4  127    6-132     1-130 (130)
  3 d1u0ka2 d.21.1.2 (A:131-283) H  99.4 2.7E-13   2E-17  104.5   8.1  118  157-279    25-150 (153)
  4 d1qy9a2 d.21.1.2 (A:130-297) H  99.3 1.5E-12 1.1E-16   99.7   6.8  122  158-282    26-167 (168)
  5 d1xuba2 d.21.1.2 (A:129-278) P  99.3 9.5E-11 6.9E-15   87.7  14.1  119  158-281    19-150 (150)
  6 d1s7ja_ d.21.1.2 (A:) Hypothet  99.2 1.5E-09 1.1E-13   79.8  18.0  243    8-281    11-260 (260)
  7 d1xuba1 d.21.1.2 (A:1-128) Phe  98.3 1.3E-06 9.8E-11   60.4   8.0  109    8-123    10-120 (128)
  8 d1tm0a_ d.21.1.3 (A:) Proline   98.2 0.00025 1.8E-08   45.4  19.7  263    3-283     4-324 (332)
  9 d1qy9a1 d.21.1.2 (A:3-129) Hyp  98.0 1.4E-05   1E-09   53.6   7.8  111    8-127     9-125 (127)
 10 d1u0ka1 d.21.1.2 (A:2-130) Hyp  97.4 0.00056 4.1E-08   43.1   8.5   91  162-260    16-109 (129)
 11 d1qy9a1 d.21.1.2 (A:3-129) Hyp  97.2  0.0039 2.8E-07   37.6  11.5   99  162-268    15-117 (127)
 12 d1u0ka1 d.21.1.2 (A:2-130) Hyp  97.2  0.0029 2.1E-07   38.4  10.4  110    8-125    10-126 (129)
 13 d1xuba1 d.21.1.2 (A:1-128) Phe  97.1  0.0034 2.5E-07   37.9   9.9  100  162-270    16-120 (128)
 14 d1s7ja_ d.21.1.2 (A:) Hypothet  95.0    0.11 8.2E-06   27.9  12.1   97  162-268    17-114 (260)
 15 d1qy9a2 d.21.1.2 (A:130-297) H  94.3    0.16 1.2E-05   26.8   9.0   78   12-92     28-111 (168)
 16 d2h9fa2 d.21.1.4 (A:187-395) H  86.4    0.93 6.7E-05   21.9  13.2   78  209-286   115-209 (209)
 17 d1sr8a_ e.54.1.1 (A:) Cobalami  77.9    0.99 7.2E-05   21.7   3.5   12   94-105    63-74  (282)
 18 d1xq4a_ b.1.23.1 (A:) ApaG {Bo  21.2      19  0.0013   13.3   1.5   19   63-81     49-67  (123)
 19 d1bdfa1 d.74.3.1 (A:2-52,A:179  20.8     5.1 0.00037   17.0  -1.5   12  208-219    72-83  (105)

No 1  
>d2gkea2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
Probab=100.00  E-value=3.2e-43  Score=301.81  Aligned_cols=125  Identities=38%  Similarity=0.656  Sum_probs=118.8

Q ss_pred             CEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             30999558742797425576868887631000233237555514679972887289998046787665632358999999
Q gi|254780710|r  156 NPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA  235 (296)
Q Consensus       156 ~~~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~  235 (296)
                      .+++|+|||||+|+|++ +++.+++..+|+.||+|+.||+|+||+|++++++++|++||||||||||+||||||||+|++
T Consensus        19 ~~~~V~vGNPH~Vi~v~-~l~~~~~~~~g~~i~~~~~fp~g~Nv~f~~~~~~~~i~iRt~ERGvGeTlaCGTGA~Aaa~~   97 (144)
T d2gkea2          19 LCGAVSMGNPHCVVQVD-DIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAV   97 (144)
T ss_dssp             EEEEEESSSEEEEEECS-CTTTSCHHHHHHHHHTCTTCTTCCEEEEEEEEETTEEEEEEEETTTEECSCCHHHHHHHHHH
T ss_pred             EEEEEECCCCEEEEEEC-CCCCCCHHHHCCEECCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             99999879985999977-70207656726430046321333551279994288089999368871144433006899999


Q ss_pred             HHHHCCCCCCEEEECCCCEEEEEEEC-CCEEEEEECEEEEEEEEEEE
Q ss_conf             99817889807999079579999958-98199994628999889984
Q gi|254780710|r  236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI  281 (296)
Q Consensus       236 ~~~~~~~~~~v~V~~pGG~L~v~~~~-~~~i~l~Gpa~~vf~G~~~i  281 (296)
                      +.++++.+++++|.+|||.|.|+|++ +++|+|+|||++||+|+++|
T Consensus        98 ~~~~~~~~~~i~V~~~GG~l~V~~~~~~~~i~L~Gpa~~vf~G~i~l  144 (144)
T d2gkea2          98 GIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL  144 (144)
T ss_dssp             HHHTTSSCSEEEEEETTEEEEEEECCTTSCEEEEECCEEEEEEECCC
T ss_pred             HHHCCCCCCCEEEEECCCEEEEEEECCCCEEEEEECCEEEEEEEEEC
T ss_conf             99809999739999789879999988999899991679999999989


No 2  
>d2gkea1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
Probab=100.00  E-value=4.6e-42  Score=294.19  Aligned_cols=127  Identities=37%  Similarity=0.642  Sum_probs=118.9

Q ss_pred             CEEEEECCCCCCEEEEECCCCCCCCCHHHHHHHCCC-CCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             113785176773899947788878888899872035-6714355899825888886689999717876212332033223
Q gi|254780710|r    6 VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCV   84 (296)
Q Consensus         6 i~F~Kmhg~GNDFiiiD~~~~~~~~~~~~i~~~~~~-~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~   84 (296)
                      |+|+||||+||||||+|.+.....+++++++++|+| +|+||||||+|+++..+.+|++|+|||+|||+|+|||||+||+
T Consensus         1 m~F~Km~g~GNDFviiD~~~~~~~~~~~~i~~i~~r~~giG~Dgli~i~~~~~~~~d~~~~ifN~DGS~Ae~CGNG~RCv   80 (130)
T d2gkea1           1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF   80 (130)
T ss_dssp             CEEEEEEETTEEEEEEECSSSCCCCCHHHHHHHHCTTTSCCCSEEEEEECCSSTTSSEEEEEEETTSCEESCCHHHHHHH
T ss_pred             CEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCHHHHCCCHHHHH
T ss_conf             98999971898499997998868999999998750245888752899842446675517889715876766363378999


Q ss_pred             HHHHHCC--CCCCEEEEEECCCCEEEEECCCCEEEECCCCCCCCHHHCCC
Q ss_conf             1110013--57640379835883799985774277403687777776856
Q gi|254780710|r   85 VRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPL  132 (296)
Q Consensus        85 a~yl~~~--~~~~~~~i~T~~g~~~~~~~~~~~v~V~mG~p~~~~~~ip~  132 (296)
                      |+||+++  ..++++.|+|.+|.+.+...+++.|+|+||.|+|.|++||+
T Consensus        81 a~~l~~~~~~~~~~~~i~T~~g~~~~~~~~~~~i~V~Mg~p~f~~~~IPf  130 (130)
T d2gkea1          81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPF  130 (130)
T ss_dssp             HHHHHHTTSCCCSEEEEECSSCEEEEEECTTSCEEEECCCCBCCGGGTTC
T ss_pred             HHHHHHCCCCCCCCEEEEECCCCEEEEEECCCEEEEECCCCCCCCCCCCC
T ss_conf             99999848755761799988986899993799999999826617223899


No 3  
>d1u0ka2 d.21.1.2 (A:131-283) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=99.42  E-value=2.7e-13  Score=104.53  Aligned_cols=118  Identities=18%  Similarity=0.133  Sum_probs=90.2

Q ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCC-CCCCCCCCHHHHHHHHHH
Q ss_conf             0999558742797425576868887631000233237555514679972887289998046-787665632358999999
Q gi|254780710|r  157 PFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWER-GVGLTAACGSAACASVVA  235 (296)
Q Consensus       157 ~~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ER-GvGeTlACGTGA~Asa~~  235 (296)
                      +..+++|+||+++.++ +....   .. +.+.........+|+.++.+.+++.+..|+|+| |+.|+.+|||++||.+.+
T Consensus        25 ~~~vs~G~~~l~v~v~-~~~~~---~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~fp~~Gi~EDpaTGSa~~ala~y   99 (153)
T d1u0ka2          25 PRVVSTGLPYLLLPVT-AEALG---RA-RQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAY   99 (153)
T ss_dssp             CEEEESSSCEEEEEBC-HHHHH---TC-CCCSCCHHHHHHHTCSEEEEEETTTTEEECBCTTSCSBCSCCHHHHHHHHHH
T ss_pred             CEEEECCCCEEEEEEC-CHHHH---CC-CCCHHHHHHHHHCCCEEEEEEECCCCEEEECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             5899638998999965-66770---46-7837999877635933999981896344113566878875501879999999


Q ss_pred             HHHHCCCCC--CEEEEC-----CCCEEEEEEECCCEEEEEECEEEEEEEEE
Q ss_conf             998178898--079990-----79579999958981999946289998899
Q gi|254780710|r  236 SGCLHKTNR--AVSVKM-----LGGGLLIEWHDNNHVFMTGEAKKEWEGKL  279 (296)
Q Consensus       236 ~~~~~~~~~--~v~V~~-----pGG~L~v~~~~~~~i~l~Gpa~~vf~G~~  279 (296)
                      ..+.++...  .+.+++     ..|.|.+++..++.|++.|+|..|++|++
T Consensus       100 l~~~~~~~~~~~~~~~QG~~~grps~l~v~~~~~~~V~vgG~av~v~~G~l  150 (153)
T d1u0ka2         100 LVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAEL  150 (153)
T ss_dssp             HHHTTSSCTTSCEEEEECGGGTCCEEEEEEECSSSEEEEEEEEEEEEEEEE
T ss_pred             HHHHHCCCCCCEEEEECCCCCCCCCEEEEEECCCCCEEEEEEEEEEEEEEE
T ss_conf             998515577837998376323787289999878994999978999999999


No 4  
>d1qy9a2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
Probab=99.32  E-value=1.5e-12  Score=99.71  Aligned_cols=122  Identities=11%  Similarity=0.095  Sum_probs=79.2

Q ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEE----EECCCCEEEEEECCCCCCCCCCCHHHHHHHH
Q ss_conf             999558742797425576868887631000233237555514679----9728872899980467876656323589999
Q gi|254780710|r  158 FVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIA----RVTSLESLDLRTWERGVGLTAACGSAACASV  233 (296)
Q Consensus       158 ~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv----~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa  233 (296)
                      ..+++||||+++.++ +.+  .|..+.+-++....|++..|+.++    .......+.+|+|++++|.+..|+||++|++
T Consensus        26 ~~vs~G~~~~~v~v~-~~~--~l~~~~pd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~R~F~p~~Gi~EDpaTGsaa~a  102 (168)
T d1qy9a2          26 QVATTGHSKVMIPLK-PEV--DIDALSPDLNALTAISKKIGCNGFFPFQIRPGKNETDGRMFSPAIGIVEDPVTGNANGP  102 (168)
T ss_dssp             EEEESSSCEEEEEBC-TTS--CGGGCCCCHHHHHHHHHHHTCCCEEEEEECTTSSEEEECEEEGGGTEEEESCCHHHHHH
T ss_pred             EEEECCCCEEEEEEC-CHH--HHHHCCCCHHHHHHHHHCCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHH
T ss_conf             999569986999978-989--96325999899996540058448999996698886999961576754553231045788


Q ss_pred             HHHHH--HCCCC---CC--EEEEC-----CCCEEEEEEECCC----EEEEEECEEEEEEEEEEEC
Q ss_conf             99998--17889---80--79990-----7957999995898----1999946289998899841
Q gi|254780710|r  234 VASGC--LHKTN---RA--VSVKM-----LGGGLLIEWHDNN----HVFMTGEAKKEWEGKLDIK  282 (296)
Q Consensus       234 ~~~~~--~~~~~---~~--v~V~~-----pGG~L~v~~~~~~----~i~l~Gpa~~vf~G~~~i~  282 (296)
                      ++++.  .+..+   ..  +.+.+     ..|.|.+++..++    .|++.|+|.+|++|+|.|.
T Consensus       103 la~yL~~~~~~~~~~~~~~~~~~QG~~~gr~~~l~v~~~~~~~~~~~V~vgG~av~v~~G~i~i~  167 (168)
T d1qy9a2         103 MGAWLVHHNVLPHDGNVLRVKGHQGRALGRDGMIEVTVTIRDNQPEKVTISGTAVILFHAEWAIE  167 (168)
T ss_dssp             HHHHHHHTTCSCCCSSEEEEEEEECGGGTCCEEEEEEEEEETTEEEEEEEEECEEEEEEEECSSC
T ss_pred             HHHHHHHCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEEECCCCCCEEEEEEEEEEEEEEEEEEE
T ss_conf             99999971777776670017985438848980589999705898877999836999999899996


No 5  
>d1xuba2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
Probab=99.27  E-value=9.5e-11  Score=87.74  Aligned_cols=119  Identities=15%  Similarity=0.078  Sum_probs=90.9

Q ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEEC--CCCCCCCCCCHHHHHHHHHH
Q ss_conf             9995587427974255768688876310002332375555146799728872899980--46787665632358999999
Q gi|254780710|r  158 FVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTW--ERGVGLTAACGSAACASVVA  235 (296)
Q Consensus       158 ~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~--ERGvGeTlACGTGA~Asa~~  235 (296)
                      ..+++|+||+++.++ +.  ..|..+.|-++....|+...++-|..-  ...+..|.|  +.|+.|.-||||+++|.+.+
T Consensus        19 ~~~~~G~~~~~v~v~-~~--~al~~~~pd~~~~~~~~~~~~~~~~~~--~~~~~~R~F~p~~Gi~EDpaTGSa~~aLa~y   93 (150)
T d1xuba2          19 EIYHNGPRHVFVGLP-SI--DALSALHPDHRALSNFHDMAINCFAGA--GRRWRSRMFSPAYGVVEDAATGSAAGPLAIH   93 (150)
T ss_dssp             EEEESSSEEEEEECS-SH--HHHHHCCCCHHHHTTSCSCEEEEEEEE--TTEEEEEEEBGGGTBSSCSCCHHHHHHHHHH
T ss_pred             EEEECCCCEEEEEEC-CH--HHHHHCCCCHHHHHHCCCCEEEEEECC--CCCEEEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             899669987999989-87--778765879899975686059998222--7751589970212345275303568999999


Q ss_pred             HHHHCCCC--CCEEEEC-----CCCEEEEEEECCC----EEEEEECEEEEEEEEEEE
Q ss_conf             99817889--8079990-----7957999995898----199994628999889984
Q gi|254780710|r  236 SGCLHKTN--RAVSVKM-----LGGGLLIEWHDNN----HVFMTGEAKKEWEGKLDI  281 (296)
Q Consensus       236 ~~~~~~~~--~~v~V~~-----pGG~L~v~~~~~~----~i~l~Gpa~~vf~G~~~i  281 (296)
                      ....+..+  ..+.+.+     .+|.|.+++..++    .|++.|+|..+++|++.|
T Consensus        94 l~~~~~~~~~~~~~~~QG~~~gR~s~l~v~~~~~~~~~~~V~vgG~av~v~~G~i~l  150 (150)
T d1xuba2          94 LARHGQIEFGQPVEILQGVEIGRPSLMFAKAEGRAEQLTRVEVSGNGVTFGRGTIVL  150 (150)
T ss_dssp             HHHTTSSCTTCCEEEEECGGGTCCEEEEEEEEEETTEEEEEEEEEEEEEEEEEEECC
T ss_pred             HHHHCCCCCCCEEEEEEEEECCCCCEEEEEEECCCCCEEEEEEEEEEEEEEEEEEEC
T ss_conf             998189888817999940044999759999973799577899982799999999989


No 6  
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]}
Probab=99.22  E-value=1.5e-09  Score=79.81  Aligned_cols=243  Identities=16%  Similarity=0.186  Sum_probs=146.9

Q ss_pred             EEEECCCCCCEEEEECCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHH
Q ss_conf             37851767738999477888788888998720356714355899825888886689999717876212332033223111
Q gi|254780710|r    8 FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRF   87 (296)
Q Consensus         8 F~Kmhg~GNDFiiiD~~~~~~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~a~y   87 (296)
                      |+.=...||-=-|+-.   ...++.++.+++++..+.  -=-.||.++   ..++++|||++++ |-.+||-++-..|++
T Consensus        11 Ft~~~~~GNp~aVv~~---~~~l~~~~mq~IA~e~n~--sET~Fv~~~---~~~~~vR~FTp~~-EvpfcGH~Tlaaa~~   81 (260)
T d1s7ja_          11 FAEEVFKGNPAAVYVL---EKWLPEAVMQNIAIENNL--SETAFTVKE---GQSYALRWFTPER-EIDLCGHATLATAFV   81 (260)
T ss_dssp             TCSSTTSSEEEEEEEC---SSCCCHHHHHHHHHHHCC--SCEEEEEEE---TTEEEEEEECSSS-EESCCHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEEC---CCCCCHHHHHHHHHHHCC--CCEEEECCC---CCCCEEEEEECCC-CCCCCCCHHHHHHHH
T ss_conf             6699999732699989---989799999999998699--932998456---6640478973255-542125516789999


Q ss_pred             HHCCC--CCCEEEEEECCCCEEEEECCCCEEEECCCCCCCCHHHCCCCCCCCCCCCCEEECCCCCCCEECCEEEEECCCC
Q ss_conf             00135--7640379835883799985774277403687777776856565654344301105777740213099955874
Q gi|254780710|r   88 LTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNP  165 (296)
Q Consensus        88 l~~~~--~~~~~~i~T~~g~~~~~~~~~~~v~V~mG~p~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~iGNP  165 (296)
                      |.+..  ........+..+........+ .....+..+.  ++.++.......        .     .......+..+.+
T Consensus        82 L~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~--~~~~~~~~~~~~--------~-----~~~~~~~~~~~~~  145 (260)
T d1s7ja_          82 LFNYYSVAEETLHFTSQSGPLAVTKKEE-YYYLDFPYIL--PERIPILPEYEA--------A-----LGTKIYEAYLGRD  145 (260)
T ss_dssp             HHHHSCCCSSEEEEEETTEEEEEEEETT-EEEEEEECCC--CEECCCCHHHHH--------H-----HTSCCSEEEESSS
T ss_pred             HHHHCCCCCCEEEEEEECCCEEEEECCC-CCCCCCCCCC--CCCCCCCHHHHH--------H-----CCCCEEEEECCCC
T ss_conf             9971766652045886123112222146-4100145557--523465044554--------2-----1564168852776


Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCC--CCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             2797425576868887631000233237555514679972887289998046787--66563235899999999817889
Q gi|254780710|r  166 HAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVG--LTAACGSAACASVVASGCLHKTN  243 (296)
Q Consensus       166 H~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvG--eTlACGTGA~Asa~~~~~~~~~~  243 (296)
                      ++++..    ....+..+-+-++....+..+..+-+....++..+..|.|--+.|  |=-||||+++|.+.+...... .
T Consensus       146 ~~~~~~----~~~~l~~l~pd~~~l~~l~~~~~~~~~~~~~~~~~~~R~F~P~~Gi~EDpaTGSA~~~La~yl~~~~~-~  220 (260)
T d1s7ja_         146 LFFVLK----DEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLN-Q  220 (260)
T ss_dssp             EEEECS----CHHHHHHCCCCHHHHHHCSSCSSEEEEEECSSSSEEEEEEEGGGTEEEESCCSTTHHHHHHHHHHHHT-C
T ss_pred             CEEEEC----CHHHHHHCCCCHHHHHHCCCEEEEEEEECCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCC-C
T ss_conf             216505----54555404878789863484489999614996417999751556867000333667779999974069-7


Q ss_pred             CCEEEE---CCCCEEEEEEECCCEEEEEECEEEEEEEEEEE
Q ss_conf             807999---07957999995898199994628999889984
Q gi|254780710|r  244 RAVSVK---MLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI  281 (296)
Q Consensus       244 ~~v~V~---~pGG~L~v~~~~~~~i~l~Gpa~~vf~G~~~i  281 (296)
                      ..+...   -.+|.+.+++.+ ++|++.|.|..+++|++.|
T Consensus       221 ~~i~qgq~~~R~g~i~v~~~~-~~V~vgG~av~v~~G~l~i  260 (260)
T d1s7ja_         221 TTLSAYQVSPRGGFLTCEVKE-NRVIIGGTAKLFAKGEAYL  260 (260)
T ss_dssp             SEEEEEECSSSCCEEEEEEET-TEEEEEECEEEEEEEEEEC
T ss_pred             CEEEEEEEECCCCEEEEEEEC-CEEEEEEEEEEEEEEEEEC
T ss_conf             269999995799289999989-9899985999999989989


No 7  
>d1xuba1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
Probab=98.31  E-value=1.3e-06  Score=60.38  Aligned_cols=109  Identities=20%  Similarity=0.272  Sum_probs=81.8

Q ss_pred             EEEECCCCCCEEEEECCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHH
Q ss_conf             37851767738999477888788888998720356714355899825888886689999717876212332033223111
Q gi|254780710|r    8 FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRF   87 (296)
Q Consensus         8 F~Kmhg~GNDFiiiD~~~~~~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~a~y   87 (296)
                      |+.-...||---|+-   ....++.++.+.++++.+.  ---.|+.++.+ ..++++|||.+++ |-.+||.++-..++.
T Consensus        10 Ft~~~~~GNpaaVv~---~~~~L~~~~mq~IA~e~~~--sETaFv~~~~~-~~~~~vR~FtP~~-Ev~~cGH~tlaaa~~   82 (128)
T d1xuba1          10 FASVPLEGNPVAVFF---DADDLPPAQMQRIAREMNL--SESTFVLKPRN-GGDALIRIFTPVN-ELPFAGAPLLGTAIA   82 (128)
T ss_dssp             TCSSTTSSEEEEEEC---SGGGSCHHHHHHHHHHHCS--SCEEEEECCSS-SSSEEEEEECSSC-EESCCHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEE---CCCCCCHHHHHHHHHHHCC--CCEEEEECCCC-CCCEEEEEEECCC-CCCCCCCHHHHHHHH
T ss_conf             659999965249998---8978999999999998499--83799836877-7855899980565-333355178999999


Q ss_pred             HHCCCCCCEEEEEECCCCEEEEECC--CCEEEECCCCC
Q ss_conf             0013576403798358837999857--74277403687
Q gi|254780710|r   88 LTSRMKRKSFTFETIRGILVAKENR--DGSISVDMGEP  123 (296)
Q Consensus        88 l~~~~~~~~~~i~T~~g~~~~~~~~--~~~v~V~mG~p  123 (296)
                      |.++....++.++|.+|.+.++...  ...+.+.|..|
T Consensus        83 l~~~~~~~~~~~~t~aG~v~v~~~~~~~~~~~~~~~~p  120 (128)
T d1xuba1          83 LGAHTDNHRLYLETQMGTIAFELERQNGSVIAASMDQP  120 (128)
T ss_dssp             HHTTCCCSEEEEEETTEEEEEEEEEETTEEEEEEEECC
T ss_pred             HHHCCCCCEEEEEECCEEEEEEEEECCCCEEEEEECCC
T ss_conf             98415996099993870699999924996999997299


No 8  
>d1tm0a_ d.21.1.3 (A:) Proline racemase {Brucella melitensis [TaxId: 29459]}
Probab=98.20  E-value=0.00025  Score=45.38  Aligned_cols=263  Identities=14%  Similarity=0.099  Sum_probs=135.1

Q ss_pred             CCCCEEEEECCCCCCEEEE-ECCCCCCCCCHH----------HHH-HHCC-CCCC-CCCEEEEEECCCCCCCCEEEEEEE
Q ss_conf             7541137851767738999-477888788888----------998-7203-5671-435589982588888668999971
Q gi|254780710|r    3 SSMVDFAKMEGIGNKILVI-DMRGCHDNITSD----------AIN-ALST-DDNT-HFDQIMLIHDFQDASVDAFIRIIN   68 (296)
Q Consensus         3 ~~mi~F~Kmhg~GNDFiii-D~~~~~~~~~~~----------~i~-~~~~-~~gi-G~Dgli~i~~~~~~~~d~~m~~fN   68 (296)
                      +.||+-.-||..|+=+=|| ........-+-.          .+| .|.. -+|- .-=|-|+ .||.++.+|+-+.|++
T Consensus         4 ~~~i~~id~Ht~GEp~RvI~~G~p~l~G~t~~ek~~~~~~~D~lR~~Lm~EPRGh~~M~gall-~pp~~~~ad~Gvif~~   82 (332)
T d1tm0a_           4 TKVIHIVGCHAEGEVGDVIVGGVAPPPGETVWEQSRFIANDETLRNFVLNKPRGGVFRHVNLL-VPPKDPRAQMGFIIME   82 (332)
T ss_dssp             SCCEEEEEEEETTEECEEEEESCCCCSSSSHHHHHHHHHHHCHHHHHHHSTTTSCSSCCEEEE-ECCCSSSCSEEEECCC
T ss_pred             CCEEEEEECCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEE-ECCCCCCCCEEEEEEC
T ss_conf             536999967779887479974888999999999999987544899997528998875589998-4899988878999980


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCC--C----CCCEEEEEECCCCEEEEEC-CCCE-EEECC-CCCCCCHH-HCCCCCCCCC
Q ss_conf             78762123320332231110013--5----7640379835883799985-7742-77403-68777777-6856565654
Q gi|254780710|r   69 CDGSEVQSCGNGMRCVVRFLTSR--M----KRKSFTFETIRGILVAKEN-RDGS-ISVDM-GEPILDWK-LIPLARSFDK  138 (296)
Q Consensus        69 ~DGS~A~mCGNG~Rc~a~yl~~~--~----~~~~~~i~T~~g~~~~~~~-~~~~-v~V~m-G~p~~~~~-~ip~~~~~~~  138 (296)
                      ++|-. .|||-|+=|++.+|.+.  .    +..++.|+|.+|++.++.. .++. .+|.. -.|+|... ++++..    
T Consensus        83 ~~gy~-~MCGh~tI~~~t~lve~G~v~~~~p~t~~~ietPaG~V~v~~~~~~g~v~~V~~~nVpsf~~~~d~~v~v----  157 (332)
T d1tm0a_          83 PADTP-PMSGSNSICVSTVLLDSGIIAMQEPVTHMVLEAPGGIIEVEAECRNGKAERISVRNVPSFADRLDAPLDV----  157 (332)
T ss_dssp             SSCCC-SCCHHHHHHHHHHHHHHTSSCCCSSEEEEEEECSSCEEEEEEEECSSSEEEEEEECCCBEECCCSEEEEC----
T ss_pred             CCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEEEEEEEECCCCEEEEEEECCCCHHHHCCCEEEC----
T ss_conf             67457-7756538888589875313267899249997279747999999949948799987435558657967976----


Q ss_pred             CCCCEEECCCCCCCEECCEEEEECCCCEEEEECCC---CC---CHHHHHHHHHCCCCC-----CCC-CC--CCCEEEEEE
Q ss_conf             34430110577774021309995587427974255---76---868887631000233-----237-55--551467997
Q gi|254780710|r  139 MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED---DL---YHYDLASFGNLLAKH-----PMF-SE--GVNLSIARV  204 (296)
Q Consensus       139 ~~~~~~~~~~~~~~~~~~~~~v~iGNPH~Vi~v~d---~i---~~~~l~~~g~~i~~~-----~~F-p~--gvNV~fv~v  204 (296)
                                .... ....-.+.=||-=+++-.++   ++   +.-+|..+|..|+..     +.. |+  .-.+.+.++
T Consensus       158 ----------~~~G-~v~~DiayGG~fyaivda~~lgl~l~~~~~~~L~~~g~~i~~a~~~~~~~~hp~~~~~~i~~~~~  226 (332)
T d1tm0a_         158 ----------TGLG-TIMVDTAYGGDSFVIVDAAQIGMKIEPGQARELAEIGVKITKAANEQLGFRHPERDWRHISFCQI  226 (332)
T ss_dssp             ----------SSSS-EEEEEEEESSSEEEEEEGGGTC---CHHHHHHHHHHHHHHHCC------CCBTTBSCCSCCEEEE
T ss_pred             ----------CCCC-CEEEEEEECCEEEEEEECHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEE
T ss_conf             ----------7987-17988750853899983123376446404999999999999877741773468998665999985


Q ss_pred             CCC-----CEEEEE---ECCCCC-CCCCCCHHHHHHHHHHHHHHCCCC--CCEEEECCCCE-EEEEEEC----CC----E
Q ss_conf             288-----728999---804678-766563235899999999817889--80799907957-9999958----98----1
Q gi|254780710|r  205 TSL-----ESLDLR---TWERGV-GLTAACGSAACASVVASGCLHKTN--RAVSVKMLGGG-LLIEWHD----NN----H  264 (296)
Q Consensus       205 ~~~-----~~I~iR---t~ERGv-GeTlACGTGA~Asa~~~~~~~~~~--~~v~V~~pGG~-L~v~~~~----~~----~  264 (296)
                      .++     +...-|   +|--|. +. --||||.+|-.+..+..|++.  .+...++.=|. -+.++.+    .+    .
T Consensus       227 ~~~~~~~~~~~~~rn~v~~~~g~iDR-SPcGTGTSARlA~l~a~G~l~~Ge~~~~eSIiGs~F~g~i~~~~~~g~~~aVi  305 (332)
T d1tm0a_         227 TEPVTREGDVLTGVNTVAIRPAKFDR-SPTGTGCSARMAVLHAKGQMKAGERFIGKSVLGTEFHCRLDKVLELGGKPAIS  305 (332)
T ss_dssp             ECCCEESSSEEEECEEC-----------CCHHHHHHHHHHHHHTTSCCTTCEEEECCC--CCEEEEEEEEEEETTEEEEE
T ss_pred             CCCCCCCCCCCCEEEEEEECCCCEEC-CCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCCCCEEEEEEEEEEECCCCEEE
T ss_conf             48887887652003578768986751-77743289999999976998899849998513883899999998988957799


Q ss_pred             EEEEECEEEEEEEEEEECC
Q ss_conf             9999462899988998413
Q gi|254780710|r  265 VFMTGEAKKEWEGKLDIKT  283 (296)
Q Consensus       265 i~l~Gpa~~vf~G~~~i~~  283 (296)
                      ...+|.|-..-+-++-+..
T Consensus       306 P~I~G~A~itG~~~f~~d~  324 (332)
T d1tm0a_         306 PIISGRAWVTGTSQLMLDP  324 (332)
T ss_dssp             EEEEECEEEEEEEEECCCT
T ss_pred             EEEEEEEEEEEEEEEEECC
T ss_conf             9999999999988999779


No 9  
>d1qy9a1 d.21.1.2 (A:3-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
Probab=97.98  E-value=1.4e-05  Score=53.62  Aligned_cols=111  Identities=16%  Similarity=0.227  Sum_probs=73.4

Q ss_pred             EEEECCCCCCE-EEEECCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             37851767738-99947788878888899872035671435589982588888668999971787621233203322311
Q gi|254780710|r    8 FAKMEGIGNKI-LVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVR   86 (296)
Q Consensus         8 F~Kmhg~GNDF-iiiD~~~~~~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~a~   86 (296)
                      |+.=.-.||-= |++|.    ..++.+..+.+++..+.  ---.|+.++.  ..++++|+|.+++ |-.+||.++-.+++
T Consensus         9 Ft~~~~~GNpa~Vv~~~----~~l~~~~mq~IA~e~n~--sETaFv~~~~--~~~~~iR~FTP~~-Ev~~cGHaTLAaa~   79 (127)
T d1qy9a1           9 FTSQPFRGNSAGVVFPA----DNLSEAQMQLIARELGH--SETAFLLHSD--DSDVRIRYFTPTV-EVPICGHATVAAHY   79 (127)
T ss_dssp             SCSSTTCSEEEEEEECC----TTCCHHHHHHHHHHHCC--SCEEEEECCS--SSSEEEEEECSSC-EESCCHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEECC----CCCCHHHHHHHHHHHCC--CEEEEEECCC--CCCEEEEEEECCC-CCCCCCCHHHHHHH
T ss_conf             87999995258999888----78999999999998599--6289984277--8858999980464-41246557889999


Q ss_pred             HHHCC--CCCCEEEEEECCCCEEEEECC-CCE--EEECCCCCCCCH
Q ss_conf             10013--576403798358837999857-742--774036877777
Q gi|254780710|r   87 FLTSR--MKRKSFTFETIRGILVAKENR-DGS--ISVDMGEPILDW  127 (296)
Q Consensus        87 yl~~~--~~~~~~~i~T~~g~~~~~~~~-~~~--v~V~mG~p~~~~  127 (296)
                      +|.+.  .....+.++|.+|.+.++... ++.  ++..++.|.|.+
T Consensus        80 ~L~~~~~~~~~~~~~~t~~G~l~v~v~~~~~~~~i~~~q~~P~f~p  125 (127)
T d1qy9a1          80 VRAKVLGLGNCTIWQTSLAGKHRVTIEKHNDDYRISLEQGTPGFEP  125 (127)
T ss_dssp             HHHHHHTCCSEEEEEEETTEEEEEEEEEETTEEEEEEECCCCEECC
T ss_pred             HHHHHCCCCCCEEEEEECCCEEEEEEEECCCEEEEEEECCCCCCCC
T ss_conf             9998448899779999467169999997399799990189985589


No 10 
>d1u0ka1 d.21.1.2 (A:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=97.37  E-value=0.00056  Score=43.13  Aligned_cols=91  Identities=10%  Similarity=0.044  Sum_probs=52.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEE-ECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             587427974255768688876310002332375555146799-7288728999804678766563235899999999817
Q gi|254780710|r  162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIAR-VTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH  240 (296)
Q Consensus       162 iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~-v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~  240 (296)
                      .|||=+|++..+.+.......+++.+...+       .-|+. ..++...++|.|--.. |=.=||-++.|++.+....+
T Consensus        16 ~GNpaaVv~~~~~l~~~~mq~IA~e~n~sE-------T~Fv~~~~~~~~~~vR~FTP~~-Ev~~cGH~Tlaaa~~L~~~~   87 (129)
T d1u0ka1          16 TGNGLAVFDDASALDDAAMQAWTRELRQFE-------SIFLLPGDDPRAFRARIFTLEE-ELPFAGHPLLGAAALLHHLR   87 (129)
T ss_dssp             CSEEEEEESCCTTCCHHHHHHHHHHHCCSE-------EEEEEECSCTTEEEEEEEESSC-BCCSCCTHHHHHHHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCE-------EEEEECCCCCCCEEEEEEECCC-CCCCCCCHHHHHHHHHHHHC
T ss_conf             854589998886799999999999839962-------6998358998725899983565-55445647899999999854


Q ss_pred             CC--CCCEEEECCCCEEEEEEE
Q ss_conf             88--980799907957999995
Q gi|254780710|r  241 KT--NRAVSVKMLGGGLLIEWH  260 (296)
Q Consensus       241 ~~--~~~v~V~~pGG~L~v~~~  260 (296)
                      ..  ...+.+.++.|.+.|...
T Consensus        88 ~~~~~~~~~~~t~~g~~~v~~~  109 (129)
T d1u0ka1          88 GGDNEQHWTLHLASKSVALRSV  109 (129)
T ss_dssp             CCSSCEEEEEECSSCEEEEEEE
T ss_pred             CCCCCCEEEEEECCCEEEEEEE
T ss_conf             7789971999977517999999


No 11 
>d1qy9a1 d.21.1.2 (A:3-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
Probab=97.23  E-value=0.0039  Score=37.57  Aligned_cols=99  Identities=14%  Similarity=0.187  Sum_probs=73.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             58742797425576868887631000233237555514679972887289998046787665632358999999998178
Q gi|254780710|r  162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK  241 (296)
Q Consensus       162 iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~  241 (296)
                      .|||-+|++..+.+..-.+..+++.+...+       .-|+.-.+...+++|.|=-. +|=.=||-++.|++.+....+.
T Consensus        15 ~GNpa~Vv~~~~~l~~~~mq~IA~e~n~sE-------TaFv~~~~~~~~~iR~FTP~-~Ev~~cGHaTLAaa~~L~~~~~   86 (127)
T d1qy9a1          15 RGNSAGVVFPADNLSEAQMQLIARELGHSE-------TAFLLHSDDSDVRIRYFTPT-VEVPICGHATVAAHYVRAKVLG   86 (127)
T ss_dssp             CSEEEEEEECCTTCCHHHHHHHHHHHCCSC-------EEEEECCSSSSEEEEEECSS-CEESCCHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCE-------EEEEECCCCCCEEEEEEECC-CCCCCCCCHHHHHHHHHHHHCC
T ss_conf             952589998887899999999999859962-------89984277885899998046-4412465578899999998448


Q ss_pred             CC-CCEEEECCCCEEEEEEEC-CC--EEEEE
Q ss_conf             89-807999079579999958-98--19999
Q gi|254780710|r  242 TN-RAVSVKMLGGGLLIEWHD-NN--HVFMT  268 (296)
Q Consensus       242 ~~-~~v~V~~pGG~L~v~~~~-~~--~i~l~  268 (296)
                      .+ ..+....+.|.|.|+... ++  .++|.
T Consensus        87 ~~~~~~~~~t~~G~l~v~v~~~~~~~~i~~~  117 (127)
T d1qy9a1          87 LGNCTIWQTSLAGKHRVTIEKHNDDYRISLE  117 (127)
T ss_dssp             CCSEEEEEEETTEEEEEEEEEETTEEEEEEE
T ss_pred             CCCCEEEEEECCCEEEEEEEECCCEEEEEEE
T ss_conf             8997799994671699999973997999901


No 12 
>d1u0ka1 d.21.1.2 (A:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=97.18  E-value=0.0029  Score=38.42  Aligned_cols=110  Identities=16%  Similarity=0.211  Sum_probs=77.8

Q ss_pred             EEEECCCCCCEEEE-ECCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             37851767738999-47788878888899872035671435589982588888668999971787621233203322311
Q gi|254780710|r    8 FAKMEGIGNKILVI-DMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVR   86 (296)
Q Consensus         8 F~Kmhg~GNDFiii-D~~~~~~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~mCGNG~Rc~a~   86 (296)
                      |+.=.-.||-=-|+ |    ...++.++.+.+++..+.  ---.|+.++.+ ..++++++|.+.+ |-.+||-++-..++
T Consensus        10 Ft~~~~~GNpaaVv~~----~~~l~~~~mq~IA~e~n~--sET~Fv~~~~~-~~~~~vR~FTP~~-Ev~~cGH~Tlaaa~   81 (129)
T d1u0ka1          10 FAERPLTGNGLAVFDD----ASALDDAAMQAWTRELRQ--FESIFLLPGDD-PRAFRARIFTLEE-ELPFAGHPLLGAAA   81 (129)
T ss_dssp             SCSSTTCSEEEEEESC----CTTCCHHHHHHHHHHHCC--SEEEEEEECSC-TTEEEEEEEESSC-BCCSCCTHHHHHHH
T ss_pred             CCCCCCCCCEEEEEEC----CCCCCHHHHHHHHHHHCC--CEEEEEECCCC-CCCEEEEEEECCC-CCCCCCCHHHHHHH
T ss_conf             4499998545899988----867999999999998399--62699835899-8725899983565-55445647899999


Q ss_pred             HHHCC---CCCCEEEEEECCCCEEEEECCC-CEEEECC--CCCCC
Q ss_conf             10013---5764037983588379998577-4277403--68777
Q gi|254780710|r   87 FLTSR---MKRKSFTFETIRGILVAKENRD-GSISVDM--GEPIL  125 (296)
Q Consensus        87 yl~~~---~~~~~~~i~T~~g~~~~~~~~~-~~v~V~m--G~p~~  125 (296)
                      .|.+.   .....+.++|.+|.+.+....+ ..+++.|  +.|.|
T Consensus        82 ~L~~~~~~~~~~~~~~~t~~g~~~v~~~~~~~~~~i~m~q~~p~f  126 (129)
T d1u0ka1          82 LLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEMDQGRAEF  126 (129)
T ss_dssp             HHHHHHCCSSCEEEEEECSSCEEEEEEEEETTEEEEEEEEEECEE
T ss_pred             HHHHHCCCCCCCEEEEEECCCEEEEEEEECCCEEEEEEECCCCCC
T ss_conf             999854778997199997751799999975998999962999867


No 13 
>d1xuba1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
Probab=97.06  E-value=0.0034  Score=37.95  Aligned_cols=100  Identities=18%  Similarity=0.205  Sum_probs=71.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEE-ECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             587427974255768688876310002332375555146799-7288728999804678766563235899999999817
Q gi|254780710|r  162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIAR-VTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH  240 (296)
Q Consensus       162 iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~-v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~  240 (296)
                      -|||=+|++..+++.......+++.+...+       .-|+. ..+....++|.|==+ +|-.=||-+++|++.+.....
T Consensus        16 ~GNpaaVv~~~~~L~~~~mq~IA~e~~~sE-------TaFv~~~~~~~~~~vR~FtP~-~Ev~~cGH~tlaaa~~l~~~~   87 (128)
T d1xuba1          16 EGNPVAVFFDADDLPPAQMQRIAREMNLSE-------STFVLKPRNGGDALIRIFTPV-NELPFAGAPLLGTAIALGAHT   87 (128)
T ss_dssp             SSEEEEEECSGGGSCHHHHHHHHHHHCSSC-------EEEEECCSSSSSEEEEEECSS-CEESCCHHHHHHHHHHHHTTC
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCC-------EEEEECCCCCCCEEEEEEECC-CCCCCCCCHHHHHHHHHHHCC
T ss_conf             965249998897899999999999849983-------799836877785589998056-533335517899999998415


Q ss_pred             CCCCCEEEECCCCEEEEEEE-CCCE---EEEEEC
Q ss_conf             88980799907957999995-8981---999946
Q gi|254780710|r  241 KTNRAVSVKMLGGGLLIEWH-DNNH---VFMTGE  270 (296)
Q Consensus       241 ~~~~~v~V~~pGG~L~v~~~-~~~~---i~l~Gp  270 (296)
                       -..++.++.+.|.+.|+.. +++.   +.|.-|
T Consensus        88 -~~~~~~~~t~aG~v~v~~~~~~~~~~~~~~~~p  120 (128)
T d1xuba1          88 -DNHRLYLETQMGTIAFELERQNGSVIAASMDQP  120 (128)
T ss_dssp             -CCSEEEEEETTEEEEEEEEEETTEEEEEEEECC
T ss_pred             -CCCEEEEEECCEEEEEEEEECCCCEEEEEECCC
T ss_conf             -996099993870699999924996999997299


No 14 
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]}
Probab=94.96  E-value=0.11  Score=27.92  Aligned_cols=97  Identities=15%  Similarity=0.149  Sum_probs=68.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             58742797425576868887631000233237555514679972887289998046787665632358999999998178
Q gi|254780710|r  162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK  241 (296)
Q Consensus       162 iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~~  241 (296)
                      .|||-+|++..+.+.......+++.+...+       .-|+.. +.+..++|.|=-. +|-.=||-+..|++.+....+.
T Consensus        17 ~GNp~aVv~~~~~l~~~~mq~IA~e~n~sE-------T~Fv~~-~~~~~~vR~FTp~-~EvpfcGH~Tlaaa~~L~~~~~   87 (260)
T d1s7ja_          17 KGNPAAVYVLEKWLPEAVMQNIAIENNLSE-------TAFTVK-EGQSYALRWFTPE-REIDLCGHATLATAFVLFNYYS   87 (260)
T ss_dssp             SSEEEEEEECSSCCCHHHHHHHHHHHCCSC-------EEEEEE-ETTEEEEEEECSS-SEESCCHHHHHHHHHHHHHHSC
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCC-------EEEECC-CCCCCEEEEEECC-CCCCCCCCHHHHHHHHHHHHCC
T ss_conf             973269998998979999999999869993-------299845-6664047897325-5542125516789999997176


Q ss_pred             CCCC-EEEECCCCEEEEEEECCCEEEEE
Q ss_conf             8980-79990795799999589819999
Q gi|254780710|r  242 TNRA-VSVKMLGGGLLIEWHDNNHVFMT  268 (296)
Q Consensus       242 ~~~~-v~V~~pGG~L~v~~~~~~~i~l~  268 (296)
                      .... ......++.+.+.... +...+.
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~-~~~~~~  114 (260)
T d1s7ja_          88 VAEETLHFTSQSGPLAVTKKE-EYYYLD  114 (260)
T ss_dssp             CCSSEEEEEETTEEEEEEEET-TEEEEE
T ss_pred             CCCCEEEEEEECCCEEEEECC-CCCCCC
T ss_conf             665204588612311222214-641001


No 15 
>d1qy9a2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
Probab=94.25  E-value=0.16  Score=26.84  Aligned_cols=78  Identities=13%  Similarity=0.053  Sum_probs=52.3

Q ss_pred             CCCCCCEEEEECCCCC----CCCCHHHHHHHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCC--CCCCCCCHHHHHH
Q ss_conf             1767738999477888----788888998720356714355899825888886689999717876--2123320332231
Q gi|254780710|r   12 EGIGNKILVIDMRGCH----DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGS--EVQSCGNGMRCVV   85 (296)
Q Consensus        12 hg~GNDFiiiD~~~~~----~~~~~~~i~~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS--~A~mCGNG~Rc~a   85 (296)
                      -..||.|+++...+.+    ..+..+.++.++++.++  .++.+..... ...++++|+|.+-..  |.--||.+.-|++
T Consensus        28 vs~G~~~~~v~v~~~~~l~~~~pd~~~~~~~~~~~~~--~~~~v~~~~~-~~~~~~~R~F~p~~Gi~EDpaTGsaa~ala  104 (168)
T d1qy9a2          28 ATTGHSKVMIPLKPEVDIDALSPDLNALTAISKKIGC--NGFFPFQIRP-GKNETDGRMFSPAIGIVEDPVTGNANGPMG  104 (168)
T ss_dssp             EESSSCEEEEEBCTTSCGGGCCCCHHHHHHHHHHHTC--CCEEEEEECT-TSSEEEECEEEGGGTEEEESCCHHHHHHHH
T ss_pred             EECCCCEEEEEECCHHHHHHCCCCHHHHHHHHHCCCC--CEEEEEEECC-CCCEEEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             9569986999978989963259998999965400584--4899999669-888699996157675455323104578899


Q ss_pred             HHHHCCC
Q ss_conf             1100135
Q gi|254780710|r   86 RFLTSRM   92 (296)
Q Consensus        86 ~yl~~~~   92 (296)
                      .||.++.
T Consensus       105 ~yL~~~~  111 (168)
T d1qy9a2         105 AWLVHHN  111 (168)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHCC
T ss_conf             9999717


No 16 
>d2h9fa2 d.21.1.4 (A:187-395) Hypothetical protein PA0793 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=86.38  E-value=0.93  Score=21.90  Aligned_cols=78  Identities=23%  Similarity=0.191  Sum_probs=54.1

Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC---------CCCCCEEEECCCCEEEEEEE--C-CCE-----EEEEECE
Q ss_conf             28999804678766563235899999999817---------88980799907957999995--8-981-----9999462
Q gi|254780710|r  209 SLDLRTWERGVGLTAACGSAACASVVASGCLH---------KTNRAVSVKMLGGGLLIEWH--D-NNH-----VFMTGEA  271 (296)
Q Consensus       209 ~I~iRt~ERGvGeTlACGTGA~Asa~~~~~~~---------~~~~~v~V~~pGG~L~v~~~--~-~~~-----i~l~Gpa  271 (296)
                      .|..|.|=-|.=..--=.|||+|.++++..-|         .....++|..|.|.+.|...  + ++.     ..+.-.|
T Consensus       115 Di~~R~~s~~~~H~a~~vTgav~la~Aa~ipGTv~~~~~~~~~~~~v~I~HPsG~~~v~~~~~~~~~~~~v~~a~v~RTA  194 (209)
T d2h9fa2         115 DLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIMSRSA  194 (209)
T ss_dssp             SEEEEEEETTEECSSCCHHHHHHHHHHHHSTTSHHHHHTTSSCCSEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEECE
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCCCEEEEECCCCEEEEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             68999803886316565777898777651689668860378888759997699369999999736996479999999834


Q ss_pred             EEEEEEEEEECCCCC
Q ss_conf             899988998413200
Q gi|254780710|r  272 KKEWEGKLDIKTGKW  286 (296)
Q Consensus       272 ~~vf~G~~~i~~~~~  286 (296)
                      ..+|+|++.+-...|
T Consensus       195 RrLm~G~V~vP~~~~  209 (209)
T d2h9fa2         195 RILMEGWVRVPGDAF  209 (209)
T ss_dssp             EEEEEEEEEEETTCC
T ss_pred             CHHEEEEEECCCCCC
T ss_conf             020478897765569


No 17 
>d1sr8a_ e.54.1.1 (A:) Cobalamin biosynthesis protein CbiD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
Probab=77.93  E-value=0.99  Score=21.69  Aligned_cols=12  Identities=17%  Similarity=0.246  Sum_probs=6.6

Q ss_pred             CCEEEEEECCCC
Q ss_conf             640379835883
Q gi|254780710|r   94 RKSFTFETIRGI  105 (296)
Q Consensus        94 ~~~~~i~T~~g~  105 (296)
                      .++..|.|..|.
T Consensus        63 ~~~V~I~lP~G~   74 (282)
T d1sr8a_          63 VEKVKVSTPAGV   74 (282)
T ss_dssp             EEEEEECCTTSC
T ss_pred             CCEEEEECCCCC
T ss_conf             988999888998


No 18 
>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]}
Probab=21.18  E-value=19  Score=13.32  Aligned_cols=19  Identities=16%  Similarity=0.141  Sum_probs=16.4

Q ss_pred             EEEEEECCCCCCCCCCCHH
Q ss_conf             9999717876212332033
Q gi|254780710|r   63 FIRIINCDGSEVQSCGNGM   81 (296)
Q Consensus        63 ~m~~fN~DGS~A~mCGNG~   81 (296)
                      +|.|.++||..-+..|.|+
T Consensus        49 ~W~I~d~~g~~~eV~G~GV   67 (123)
T d1xq4a_          49 HWIITDGEERVQEVRGLGV   67 (123)
T ss_dssp             EEEEECTTSCEEEEEEESS
T ss_pred             EEEEEECCCCEEECCCCCE
T ss_conf             6799939987797157878


No 19 
>d1bdfa1 d.74.3.1 (A:2-52,A:179-232) RNA polymerase alpha {Escherichia coli [TaxId: 562]}
Probab=20.80  E-value=5.1  Score=17.04  Aligned_cols=12  Identities=17%  Similarity=0.252  Sum_probs=5.2

Q ss_pred             CEEEEEECCCCC
Q ss_conf             728999804678
Q gi|254780710|r  208 ESLDLRTWERGV  219 (296)
Q Consensus       208 ~~I~iRt~ERGv  219 (296)
                      ++|.+.+|=-|.
T Consensus        72 d~L~lei~TnGs   83 (105)
T d1bdfa1          72 DKLVIEMETNGT   83 (105)
T ss_dssp             EEEEEEEEECSS
T ss_pred             EEEEEEEEECCC
T ss_conf             579999994897


Done!