BLAST/PSIBLAST alignment of GI: 254780710 and GI: 327190189 at iteration 1
>gi|327190189|gb|EGE57294.1| diaminopimelate epimerase protein [Rhizobium etli CNPAF512] Length = 351
 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/291 (51%), Positives = 199/291 (68%), Gaps = 5/291 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 52  SATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPETEFDQIMAIHDPKADGTDA 111

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG+
Sbjct: 112 FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGK 171

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPL+  F    R    IGP+++  L +P  +SMGNPHAIF+V++D+  YDLA 
Sbjct: 172 PVFDWNRIPLSEEFHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDEDVMSYDLAR 231

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 232 FGPLLENHPMFPERANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTGRT 291

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            R V++ +        L IEW + ++HV MTG A+ EW G+LD  TG W +
Sbjct: 292 GRTVTINVASAKPPATLSIEWRERDDHVIMTGPAEWEWSGRLDPATGLWSR 342