BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780710|ref|YP_003065123.1| diaminopimelate epimerase
[Candidatus Liberibacter asiaticus str. psy62]
         (296 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780710|ref|YP_003065123.1| diaminopimelate epimerase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040387|gb|ACT57183.1| diaminopimelate epimerase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 296

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV
Sbjct: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM
Sbjct: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL
Sbjct: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH
Sbjct: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY 296
           KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
Sbjct: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY 296


>gi|315121875|ref|YP_004062364.1| diaminopimelate epimerase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495277|gb|ADR51876.1| diaminopimelate epimerase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 289

 Score =  404 bits (1038), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 213/288 (73%), Positives = 238/288 (82%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           MQ SMV FAKMEGIGNKILV+DMR   DNIT +AIN LST+DN  FDQIM IH+ Q+   
Sbjct: 1   MQESMVGFAKMEGIGNKILVVDMRDRSDNITLEAINFLSTNDNFPFDQIMAIHNSQNKLA 60

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DAFIRIIN DGSE QSCGNGMRCVVRFL+S+ K+K+F FETIRGIL AKEN DGSISVDM
Sbjct: 61  DAFIRIINRDGSEAQSCGNGMRCVVRFLSSKTKKKTFIFETIRGILQAKENDDGSISVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEPILDW+ IPLA+ FD  D  +F+IGP+N+ FLR+P +VSMGNPHAIFFVEDD+Y YDL
Sbjct: 121 GEPILDWQHIPLAKPFDDTDSAQFYIGPINNSFLRSPSIVSMGNPHAIFFVEDDIYRYDL 180

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           + FG LL  + MF EGVNLSIARVTS+ SLDLRTWERG GLTAACGSAACASVVAS    
Sbjct: 181 SGFGKLLENNFMFPEGVNLSIARVTSISSLDLRTWERGAGLTAACGSAACASVVASARSG 240

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            T+R VSV MLGG LLIEWH NNHVFM+G A K+W+G LDIKTGKW K
Sbjct: 241 NTDRIVSVNMLGGELLIEWHHNNHVFMSGGADKQWDGNLDIKTGKWTK 288


>gi|260464163|ref|ZP_05812356.1| diaminopimelate epimerase [Mesorhizobium opportunistum WSM2075]
 gi|259029966|gb|EEW31249.1| diaminopimelate epimerase [Mesorhizobium opportunistum WSM2075]
          Length = 294

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/290 (51%), Positives = 194/290 (66%), Gaps = 1/290 (0%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +S   FAKM GIGN+I+V DMRG  D +T+ A   L+ D  T FDQIM IHD +      
Sbjct: 2   ASTTPFAKMNGIGNEIIVADMRGRADRVTAAAAITLNADAATGFDQIMAIHDARTPGTAF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DG+  Q+CGNGMRCVV+ L +   +KSFTFET+ GIL A E+ DGSISVDMG 
Sbjct: 62  FIDILNSDGTGAQACGNGMRCVVQALAAETGQKSFTFETVAGILNASEHADGSISVDMGM 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P   W+ IPLA  F         IGP++   L +P  VSMGNPHAIF+V+ D++ Y+L  
Sbjct: 122 PRFGWQDIPLAEEFRDTRMIELQIGPIDAPVLHSPSAVSMGNPHAIFWVDRDVWSYELDR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HP+F E  N++IA+VTS ES+ +RTWERG GLT ACG+A+CA+VVA+    +T
Sbjct: 182 FGPLLENHPIFPERANITIAQVTSPESMIIRTWERGAGLTKACGTASCAAVVAAARTRRT 241

Query: 243 NRAVSVKMLGGGLL-IEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            R+VS+   GGG L +EW D++HV +TG A+ E+ G  D  TG W +  E
Sbjct: 242 GRSVSLLTPGGGTLHVEWRDDDHVILTGAAEWEFSGSFDPSTGAWARDTE 291


>gi|218682290|ref|ZP_03529891.1| diaminopimelate epimerase [Rhizobium etli CIAT 894]
          Length = 301

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 197/291 (67%), Gaps = 5/291 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   SATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPQTEFDQIMAIHDPKADGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG 
Sbjct: 62  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGR 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPLA  F    R    IGP+++  L +P  +SMGNPHAIF+V+ D+  YDLA 
Sbjct: 122 PVFDWDRIPLAEEFHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDRDVMSYDLAR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 182 FGPLLENHPMFPERANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTGRT 241

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            R V++ +        L IEW + ++HV MTG A+ EW G+LD  TG W +
Sbjct: 242 GRKVTINVASATPPAALSIEWRERDDHVIMTGPAEWEWSGRLDPSTGLWSR 292


>gi|327190189|gb|EGE57294.1| diaminopimelate epimerase protein [Rhizobium etli CNPAF512]
          Length = 351

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/291 (51%), Positives = 199/291 (68%), Gaps = 5/291 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 52  SATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPETEFDQIMAIHDPKADGTDA 111

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG+
Sbjct: 112 FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGK 171

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPL+  F    R    IGP+++  L +P  +SMGNPHAIF+V++D+  YDLA 
Sbjct: 172 PVFDWNRIPLSEEFHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDEDVMSYDLAR 231

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 232 FGPLLENHPMFPERANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTGRT 291

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            R V++ +        L IEW + ++HV MTG A+ EW G+LD  TG W +
Sbjct: 292 GRTVTINVASAKPPATLSIEWRERDDHVIMTGPAEWEWSGRLDPATGLWSR 342


>gi|190893802|ref|YP_001980344.1| diaminopimelate epimerase [Rhizobium etli CIAT 652]
 gi|190699081|gb|ACE93166.1| diaminopimelate epimerase protein [Rhizobium etli CIAT 652]
          Length = 301

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 150/291 (51%), Positives = 198/291 (68%), Gaps = 5/291 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   SATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPETEFDQIMAIHDPKADGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG+
Sbjct: 62  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGQ 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPL+  F    R    IGP+++  L +P  +SMGNPHAIF+V+ D+  YDLA 
Sbjct: 122 PVFDWNRIPLSEEFHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDRDVMSYDLAR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 182 FGPLLENHPMFPERANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTGRT 241

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            R V++ +        L IEW + ++HV MTG A+ EW G+LD  TG W +
Sbjct: 242 GRKVTINVASAKPPATLSIEWRERDDHVIMTGPAEWEWSGRLDPATGLWSR 292


>gi|110635719|ref|YP_675927.1| diaminopimelate epimerase [Mesorhizobium sp. BNC1]
 gi|122965555|sp|Q11CW3|DAPF_MESSB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|110286703|gb|ABG64762.1| diaminopimelate epimerase [Chelativorans sp. BNC1]
          Length = 293

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/289 (51%), Positives = 192/289 (66%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           + +  FAKM G+GN I+V DMRG  D +  +A   L++D  THFDQIM IHD +    + 
Sbjct: 2   AELAQFAKMNGLGNAIIVADMRGRADRVRPEAAQRLASDPATHFDQIMAIHDPRLEGTEN 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           +I IIN DGS  Q+CGNGMRCVV+ L +   R SFTFETI G+L A+E+ +G ISVDMG+
Sbjct: 62  YIEIINSDGSVAQACGNGMRCVVQRLAAETGRPSFTFETIAGVLSAEEHANGLISVDMGK 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P   W+ IPLA  F    +    +GP++   L +P V SMGNPHAIF+VEDD Y YDL  
Sbjct: 122 PRFGWQDIPLAEEFHDTRKIELQVGPIDKPVLHSPSVASMGNPHAIFWVEDDPYSYDLER 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG +L  HP+F E  N++IARV S E L +RTWERG GLT ACGSAACA+ V++    +T
Sbjct: 182 FGPMLENHPIFPERANITIARVDSPEELTMRTWERGAGLTLACGSAACAAAVSAARTGRT 241

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            R V V + GG L I W D++HV MTG A+ E+ G+ D  TG W ++ E
Sbjct: 242 GRGVKVNLPGGSLEILWRDDDHVIMTGPAEWEFSGRFDPATGAWERETE 290


>gi|209551319|ref|YP_002283236.1| diaminopimelate epimerase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|229813253|sp|B5ZTH4|DAPF_RHILW RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|209537075|gb|ACI57010.1| Diaminopimelate epimerase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 301

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 196/291 (67%), Gaps = 5/291 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   SATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPQTEFDQIMAIHDPKADGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG 
Sbjct: 62  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGR 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPLA  F    R    IGP+++  L +P  +SMGNPHAIF+V+ D+  YDLA 
Sbjct: 122 PVFDWNRIPLAEEFHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDRDVMSYDLAR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 182 FGPLLENHPMFPERANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTGRT 241

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            R V++ +        L IEW + ++HV MTG A+ EW G LD  TG W +
Sbjct: 242 GRKVTINVASAKPPATLSIEWRERDDHVIMTGPAEWEWSGSLDPSTGLWSR 292


>gi|163757348|ref|ZP_02164437.1| diaminopimelate epimerase [Hoeflea phototrophica DFL-43]
 gi|162284850|gb|EDQ35132.1| diaminopimelate epimerase [Hoeflea phototrophica DFL-43]
          Length = 292

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/283 (54%), Positives = 193/283 (68%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           S V FAKM G+GN I+VIDMRG  D +TS+A  AL++ D T FDQIM IHD     VD  
Sbjct: 3   STVPFAKMNGLGNDIVVIDMRGRSDAVTSEAAIALASGDRTGFDQIMAIHDIDLDGVDYR 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I I+N DGS  Q+CGNG RCVV+ L S   RKSFTF+T+ GIL A+E+ DG ISVDMG P
Sbjct: 63  IDILNRDGSRSQACGNGTRCVVQALASETGRKSFTFKTLAGILTAEEHEDGLISVDMGRP 122

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              W  IPLA  F    R    IGP++   L +P  V++GNPHA+F+V+DD++ YDL  F
Sbjct: 123 EFAWDKIPLAEEFHDTTRIELQIGPIDAPVLHSPSAVAIGNPHAVFWVKDDVWSYDLERF 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  HP+F E  N+SIARV    +LD+RTWERG GLT ACGSAACA+ V++    +T 
Sbjct: 183 GPLLENHPIFPERANISIARVIDDHTLDIRTWERGTGLTRACGSAACAAGVSAARTGRTG 242

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
           R V+V + GG L IEW +NNHV MTG A+ E+ G++D  TG W
Sbjct: 243 RTVTVNVPGGPLEIEWRENNHVIMTGPAEWEFSGRVDPLTGAW 285


>gi|306843382|ref|ZP_07475983.1| diaminopimelate epimerase [Brucella sp. BO1]
 gi|306276073|gb|EFM57773.1| diaminopimelate epimerase [Brucella sp. BO1]
          Length = 300

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 147/284 (51%), Positives = 195/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+IT  A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITPAAAICLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GPV+   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 RDIPLAQAVADTRKIELQVGPVDAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTMDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|241206755|ref|YP_002977851.1| diaminopimelate epimerase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860645|gb|ACS58312.1| diaminopimelate epimerase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 301

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 197/292 (67%), Gaps = 5/292 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   SATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPQTEFDQIMAIHDPKAEGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG 
Sbjct: 62  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGR 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPLA  F    R    IGP++   L +P  +SMGNPHAIF+V+ D+  YDLA 
Sbjct: 122 PVFDWDRIPLAEEFHDTSRIELQIGPIDKPVLHSPSAMSMGNPHAIFWVDRDVMSYDLAR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 182 FGPLLENHPMFPERANITLAQVTSPTSVTTRTWERGAGLTLACGSAACSAAVSAARTGRT 241

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
            R V++ +        L IEW + ++HV MTG A+ EW G++D  TG W ++
Sbjct: 242 GRKVTINVASAKPPATLSIEWRERDDHVIMTGPAEWEWSGRVDPSTGLWSRE 293


>gi|23502782|ref|NP_698909.1| diaminopimelate epimerase [Brucella suis 1330]
 gi|62290786|ref|YP_222579.1| diaminopimelate epimerase [Brucella abortus bv. 1 str. 9-941]
 gi|82700697|ref|YP_415271.1| diaminopimelate epimerase [Brucella melitensis biovar Abortus 2308]
 gi|148560145|ref|YP_001259754.1| diaminopimelate epimerase [Brucella ovis ATCC 25840]
 gi|163843955|ref|YP_001628359.1| diaminopimelate epimerase [Brucella suis ATCC 23445]
 gi|189025000|ref|YP_001935768.1| diaminopimelate epimerase [Brucella abortus S19]
 gi|225853370|ref|YP_002733603.1| diaminopimelate epimerase [Brucella melitensis ATCC 23457]
 gi|237816293|ref|ZP_04595286.1| diaminopimelate epimerase [Brucella abortus str. 2308 A]
 gi|254696186|ref|ZP_05158014.1| diaminopimelate epimerase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704943|ref|ZP_05166771.1| diaminopimelate epimerase [Brucella suis bv. 3 str. 686]
 gi|254731104|ref|ZP_05189682.1| diaminopimelate epimerase [Brucella abortus bv. 4 str. 292]
 gi|256112264|ref|ZP_05453185.1| diaminopimelate epimerase [Brucella melitensis bv. 3 str. Ether]
 gi|256263148|ref|ZP_05465680.1| diaminopimelate epimerase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370334|ref|YP_003107845.1| diaminopimelate epimerase [Brucella microti CCM 4915]
 gi|260546050|ref|ZP_05821790.1| diaminopimelate epimerase [Brucella abortus NCTC 8038]
 gi|260758836|ref|ZP_05871184.1| diaminopimelate epimerase [Brucella abortus bv. 4 str. 292]
 gi|260760560|ref|ZP_05872903.1| diaminopimelate epimerase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261755643|ref|ZP_05999352.1| diaminopimelate epimerase [Brucella suis bv. 3 str. 686]
 gi|265993695|ref|ZP_06106252.1| diaminopimelate epimerase [Brucella melitensis bv. 3 str. Ether]
 gi|29839333|sp|Q8FYF0|DAPF_BRUSU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|75496183|sp|Q57AW6|DAPF_BRUAB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123546212|sp|Q2YLR4|DAPF_BRUA2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166224246|sp|A5VSQ7|DAPF_BRUO2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082828|sp|B0CIT6|DAPF_BRUSI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807487|sp|B2S885|DAPF_BRUA1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767092|sp|C0RFH7|DAPF_BRUMB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|23348803|gb|AAN30824.1| diaminopimelate epimerase [Brucella suis 1330]
 gi|62196918|gb|AAX75218.1| DapF, diaminopimelate epimerase [Brucella abortus bv. 1 str. 9-941]
 gi|82616798|emb|CAJ11888.1| Diaminopimelate epimerase [Brucella melitensis biovar Abortus 2308]
 gi|148371402|gb|ABQ61381.1| diaminopimelate epimerase [Brucella ovis ATCC 25840]
 gi|163674678|gb|ABY38789.1| diaminopimelate epimerase [Brucella suis ATCC 23445]
 gi|189020572|gb|ACD73294.1| Diaminopimelate epimerase [Brucella abortus S19]
 gi|225641735|gb|ACO01649.1| diaminopimelate epimerase [Brucella melitensis ATCC 23457]
 gi|237788360|gb|EEP62575.1| diaminopimelate epimerase [Brucella abortus str. 2308 A]
 gi|256000497|gb|ACU48896.1| diaminopimelate epimerase [Brucella microti CCM 4915]
 gi|260096157|gb|EEW80033.1| diaminopimelate epimerase [Brucella abortus NCTC 8038]
 gi|260669154|gb|EEX56094.1| diaminopimelate epimerase [Brucella abortus bv. 4 str. 292]
 gi|260670992|gb|EEX57813.1| diaminopimelate epimerase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261745396|gb|EEY33322.1| diaminopimelate epimerase [Brucella suis bv. 3 str. 686]
 gi|262764676|gb|EEZ10597.1| diaminopimelate epimerase [Brucella melitensis bv. 3 str. Ether]
 gi|263093051|gb|EEZ17201.1| diaminopimelate epimerase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409933|gb|ADZ66998.1| Diaminopimelate epimerase [Brucella melitensis M28]
 gi|326539646|gb|ADZ87861.1| diaminopimelate epimerase [Brucella melitensis M5-90]
          Length = 303

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 147/284 (51%), Positives = 195/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|161619850|ref|YP_001593737.1| diaminopimelate epimerase [Brucella canis ATCC 23365]
 gi|260567581|ref|ZP_05838051.1| diaminopimelate epimerase [Brucella suis bv. 4 str. 40]
 gi|189082827|sp|A9M8R8|DAPF_BRUC2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|161336661|gb|ABX62966.1| diaminopimelate epimerase [Brucella canis ATCC 23365]
 gi|260157099|gb|EEW92179.1| diaminopimelate epimerase [Brucella suis bv. 4 str. 40]
          Length = 303

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 147/284 (51%), Positives = 195/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|218513924|ref|ZP_03510764.1| diaminopimelate epimerase [Rhizobium etli 8C-3]
          Length = 297

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 198/293 (67%), Gaps = 5/293 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           M S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    
Sbjct: 1   MMSATVEFARMNGLGNKILVVDMRGRPDKVTPAAAVALNADPETEFDQIMAIHDPKADGT 60

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DAFI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDM
Sbjct: 61  DAFIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P+ DW  IPL+  F    R    IGP+++  L +P  +SMGNPHAIF+V+ D+  YDL
Sbjct: 121 GKPVFDWDRIPLSEEFHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDRDVMSYDL 180

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    
Sbjct: 181 ARFGPLLENHPMFPERANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTG 240

Query: 241 KTNRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           +T R V++ +        L IEW + ++HV MTG  + EW G+LD  TG W +
Sbjct: 241 RTGRKVTINVASAKPPATLSIEWRERDDHVIMTGPTEWEWSGRLDPATGLWSR 293


>gi|254694561|ref|ZP_05156389.1| diaminopimelate epimerase [Brucella abortus bv. 3 str. Tulya]
 gi|261214885|ref|ZP_05929166.1| diaminopimelate epimerase [Brucella abortus bv. 3 str. Tulya]
 gi|260916492|gb|EEX83353.1| diaminopimelate epimerase [Brucella abortus bv. 3 str. Tulya]
          Length = 303

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/284 (51%), Positives = 195/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLLSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|116254272|ref|YP_770110.1| diaminopimelate epimerase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258920|emb|CAK10029.1| putative diaminopimelate epimerase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 304

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 196/292 (67%), Gaps = 5/292 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 5   SATVEFARMNGLGNKILVVDMRGRSDKVTPAAAVALNADPQTEFDQIMAIHDPKAEGTDA 64

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK FTF+T+ GIL A E+ DG+ISVDMG 
Sbjct: 65  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKVFTFQTVAGILNAVEHEDGTISVDMGR 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPLA  F    R    IGP++   L +P  +SMGNPHAIF+V+ D+  YDLA 
Sbjct: 125 PVFDWDRIPLAEEFHDTSRIELQIGPIDKPVLHSPSAMSMGNPHAIFWVDRDVMSYDLAR 184

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 185 FGPLLENHPMFPERANITLAQVTSPTSVTTRTWERGAGLTLACGSAACSAAVSAARTGRT 244

Query: 243 NRAVSVKMLG----GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
            R V++ +        L IEW + ++HV MTG A+ EW G++D  TG W ++
Sbjct: 245 GRKVTINVASAKPPATLSIEWRERDDHVIMTGPAEWEWSGRVDPSTGLWSRE 296


>gi|254713653|ref|ZP_05175464.1| diaminopimelate epimerase [Brucella ceti M644/93/1]
 gi|254715993|ref|ZP_05177804.1| diaminopimelate epimerase [Brucella ceti M13/05/1]
 gi|261217761|ref|ZP_05932042.1| diaminopimelate epimerase [Brucella ceti M13/05/1]
 gi|261321391|ref|ZP_05960588.1| diaminopimelate epimerase [Brucella ceti M644/93/1]
 gi|260922850|gb|EEX89418.1| diaminopimelate epimerase [Brucella ceti M13/05/1]
 gi|261294081|gb|EEX97577.1| diaminopimelate epimerase [Brucella ceti M644/93/1]
          Length = 303

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 195/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG+P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGKPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|13473650|ref|NP_105218.1| diaminopimelate epimerase [Mesorhizobium loti MAFF303099]
 gi|21362484|sp|Q98EB6|DAPF_RHILO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|14024400|dbj|BAB51004.1| diaminopimelate epimerase [Mesorhizobium loti MAFF303099]
          Length = 294

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 150/290 (51%), Positives = 195/290 (67%), Gaps = 1/290 (0%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +S   FAKM GIGN+I+V DMRG  D +T+ A  AL+ D  T FDQIM IHD +      
Sbjct: 2   ASTAPFAKMNGIGNEIIVADMRGRADQVTAAAALALNGDAATRFDQIMAIHDARTPGTAY 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           ++ I+N DG+  Q+CGNGMRCVV+ L +   +K+FTFET  GIL A+E+ DG+ISVDMG 
Sbjct: 62  YVDILNSDGTSAQACGNGMRCVVQALAAETGQKTFTFETRAGILNAREHADGTISVDMGM 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P   W+ IPLA  F         IGP++   L +P  VSMGNPHAIF+V+ D++ Y+L  
Sbjct: 122 PHFGWQEIPLAEEFRDTRMIELQIGPIDAPVLHSPSAVSMGNPHAIFWVDRDVWSYELER 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HP+F E  N++IA+VTS ES+ +RTWERG GLT ACGSAACASVVA+    +T
Sbjct: 182 FGPLLENHPIFPERANITIAQVTSPESMIIRTWERGAGLTKACGSAACASVVAAARTRRT 241

Query: 243 NRAVSVKMLGGGLL-IEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            R+V++   GGG L +EW DN+HV +TG A+ E+ G  D  TG W +  E
Sbjct: 242 GRSVNLLTPGGGTLHVEWLDNDHVILTGAAEWEFSGSFDPSTGTWARDTE 291


>gi|254700573|ref|ZP_05162401.1| diaminopimelate epimerase [Brucella suis bv. 5 str. 513]
 gi|261751081|ref|ZP_05994790.1| diaminopimelate epimerase [Brucella suis bv. 5 str. 513]
 gi|261740834|gb|EEY28760.1| diaminopimelate epimerase [Brucella suis bv. 5 str. 513]
          Length = 303

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 195/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVD+G P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDIGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|15966992|ref|NP_387345.1| diaminopimelate epimerase [Sinorhizobium meliloti 1021]
 gi|15076265|emb|CAC47818.1| Probable diaminopimelate epimerase [Sinorhizobium meliloti 1021]
          Length = 306

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 190/281 (67%), Gaps = 1/281 (0%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
            V FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD + A  DA+I
Sbjct: 9   QVQFARMNGLGNKILVVDMRGRKDRVTPQAAIALNADPATEFDQIMAIHDPKSAGTDAWI 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            I+N DGS  Q+CGNG RCVV+ L +   RK+F F T+ G+L AKE+ +G+ISVDMG+P 
Sbjct: 69  DIVNSDGSMAQACGNGTRCVVQALAAETGRKAFLFHTVAGLLEAKEHDNGTISVDMGKPR 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             W  IPLA  F    R    IGP++   L +P V SMGNPHAIF+VE+D++ Y+L  FG
Sbjct: 129 FGWDQIPLAEEFHDTRRIELQIGPIDAPVLHSPSVASMGNPHAIFWVENDVWSYELDRFG 188

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            LL  HP+F E  N+SIAR+ S + +DLRTWERG GLT ACGSAACA+ V      +T R
Sbjct: 189 PLLENHPIFPERANISIARIRSRQEMDLRTWERGAGLTLACGSAACAAAVNGARTGRTER 248

Query: 245 AVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
            V+V + GG L IEW + ++HV MTG A+ EW G +D  TG
Sbjct: 249 MVTVNVPGGPLKIEWRERDDHVIMTGPAEWEWSGTVDPVTG 289


>gi|254708920|ref|ZP_05170731.1| diaminopimelate epimerase [Brucella pinnipedialis B2/94]
 gi|256030446|ref|ZP_05444060.1| diaminopimelate epimerase [Brucella pinnipedialis M292/94/1]
 gi|256158430|ref|ZP_05456328.1| diaminopimelate epimerase [Brucella ceti M490/95/1]
 gi|256253850|ref|ZP_05459386.1| diaminopimelate epimerase [Brucella ceti B1/94]
 gi|261220988|ref|ZP_05935269.1| diaminopimelate epimerase [Brucella ceti B1/94]
 gi|261316419|ref|ZP_05955616.1| diaminopimelate epimerase [Brucella pinnipedialis B2/94]
 gi|265987490|ref|ZP_06100047.1| diaminopimelate epimerase [Brucella pinnipedialis M292/94/1]
 gi|265996947|ref|ZP_06109504.1| diaminopimelate epimerase [Brucella ceti M490/95/1]
 gi|260919572|gb|EEX86225.1| diaminopimelate epimerase [Brucella ceti B1/94]
 gi|261295642|gb|EEX99138.1| diaminopimelate epimerase [Brucella pinnipedialis B2/94]
 gi|262551415|gb|EEZ07405.1| diaminopimelate epimerase [Brucella ceti M490/95/1]
 gi|264659687|gb|EEZ29948.1| diaminopimelate epimerase [Brucella pinnipedialis M292/94/1]
          Length = 303

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 194/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|307302460|ref|ZP_07582217.1| diaminopimelate epimerase [Sinorhizobium meliloti BL225C]
 gi|307316210|ref|ZP_07595654.1| diaminopimelate epimerase [Sinorhizobium meliloti AK83]
 gi|21362480|sp|Q92L46|DAPF_RHIME RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|306898050|gb|EFN28792.1| diaminopimelate epimerase [Sinorhizobium meliloti AK83]
 gi|306903130|gb|EFN33720.1| diaminopimelate epimerase [Sinorhizobium meliloti BL225C]
          Length = 301

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 190/281 (67%), Gaps = 1/281 (0%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
            V FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD + A  DA+I
Sbjct: 4   QVQFARMNGLGNKILVVDMRGRKDRVTPQAAIALNADPATEFDQIMAIHDPKSAGTDAWI 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            I+N DGS  Q+CGNG RCVV+ L +   RK+F F T+ G+L AKE+ +G+ISVDMG+P 
Sbjct: 64  DIVNSDGSMAQACGNGTRCVVQALAAETGRKAFLFHTVAGLLEAKEHDNGTISVDMGKPR 123

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             W  IPLA  F    R    IGP++   L +P V SMGNPHAIF+VE+D++ Y+L  FG
Sbjct: 124 FGWDQIPLAEEFHDTRRIELQIGPIDAPVLHSPSVASMGNPHAIFWVENDVWSYELDRFG 183

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            LL  HP+F E  N+SIAR+ S + +DLRTWERG GLT ACGSAACA+ V      +T R
Sbjct: 184 PLLENHPIFPERANISIARIRSRQEMDLRTWERGAGLTLACGSAACAAAVNGARTGRTER 243

Query: 245 AVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
            V+V + GG L IEW + ++HV MTG A+ EW G +D  TG
Sbjct: 244 MVTVNVPGGPLKIEWRERDDHVIMTGPAEWEWSGTVDPVTG 284


>gi|306842919|ref|ZP_07475555.1| diaminopimelate epimerase [Brucella sp. BO2]
 gi|306286942|gb|EFM58462.1| diaminopimelate epimerase [Brucella sp. BO2]
          Length = 303

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 147/284 (51%), Positives = 194/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+IT  A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITPAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P   W
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFGW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GPV+   L +P + SMGNPHAIF+V+ D++ Y+L  FG LL
Sbjct: 127 RDIPLAQAVADTRKIELQVGPVDAPVLHSPSIASMGNPHAIFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTMDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|254717991|ref|ZP_05179802.1| diaminopimelate epimerase [Brucella sp. 83/13]
 gi|265982937|ref|ZP_06095672.1| diaminopimelate epimerase [Brucella sp. 83/13]
 gi|306839770|ref|ZP_07472571.1| diaminopimelate epimerase [Brucella sp. NF 2653]
 gi|264661529|gb|EEZ31790.1| diaminopimelate epimerase [Brucella sp. 83/13]
 gi|306405125|gb|EFM61403.1| diaminopimelate epimerase [Brucella sp. NF 2653]
          Length = 303

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 193/281 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+IT  A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITPAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GPV+   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPVDAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++     T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGHTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSR 287


>gi|254690073|ref|ZP_05153327.1| diaminopimelate epimerase [Brucella abortus bv. 6 str. 870]
 gi|256258326|ref|ZP_05463862.1| diaminopimelate epimerase [Brucella abortus bv. 9 str. C68]
 gi|260755611|ref|ZP_05867959.1| diaminopimelate epimerase [Brucella abortus bv. 6 str. 870]
 gi|260884637|ref|ZP_05896251.1| diaminopimelate epimerase [Brucella abortus bv. 9 str. C68]
 gi|297247173|ref|ZP_06930891.1| diaminopimelate epimerase [Brucella abortus bv. 5 str. B3196]
 gi|260675719|gb|EEX62540.1| diaminopimelate epimerase [Brucella abortus bv. 6 str. 870]
 gi|260874165|gb|EEX81234.1| diaminopimelate epimerase [Brucella abortus bv. 9 str. C68]
 gi|297174342|gb|EFH33689.1| diaminopimelate epimerase [Brucella abortus bv. 5 str. B3196]
          Length = 303

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 194/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV  TG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMKTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|256059906|ref|ZP_05450092.1| diaminopimelate epimerase [Brucella neotomae 5K33]
 gi|261323878|ref|ZP_05963075.1| diaminopimelate epimerase [Brucella neotomae 5K33]
 gi|261299858|gb|EEY03355.1| diaminopimelate epimerase [Brucella neotomae 5K33]
          Length = 303

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 194/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISV MG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVGMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|17986417|ref|NP_539051.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|256045536|ref|ZP_05448419.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260562846|ref|ZP_05833332.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|265991962|ref|ZP_06104519.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. Rev.1]
 gi|21362470|sp|Q8YJF0|DAPF_BRUME RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|17982011|gb|AAL51315.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|260152862|gb|EEW87954.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|263003028|gb|EEZ15321.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 303

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 194/284 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    + P +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVDPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|153008262|ref|YP_001369477.1| diaminopimelate epimerase [Ochrobactrum anthropi ATCC 49188]
 gi|166225740|sp|A6WXE4|DAPF_OCHA4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|151560150|gb|ABS13648.1| Diaminopimelate epimerase [Ochrobactrum anthropi ATCC 49188]
          Length = 300

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 197/287 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM G+GN+I+V DMRG  D IT +A   L+ D  T FDQIM IHD + A  D +I II
Sbjct: 7   FAKMNGLGNQIIVADMRGRADRITPEAAIRLAGDSETAFDQIMAIHDPRTAGTDNYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG+E Q+CGNG RCVV+ L +   R++FTFET  GIL A E+ DG ISVDMG+P  DW
Sbjct: 67  NCDGTEAQACGNGTRCVVQALAAETGRQAFTFETRAGILTATEHEDGLISVDMGKPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA  F         +GP++   L +P V SMGNPHAIF+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAEEFRDTRMIELQVGPIDAPVLHSPSVASMGNPHAIFWVDRDVWSYELEKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS E++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 EHHPIFPERANISIAHVTSPETIDLRTWERGAGLTRACGSAACAAAVSAVRTRRTGRTVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDE 294
           V + GG L IEW D++HV MTG A+ E+ G  D  TG+W +  ++D+
Sbjct: 247 VNVPGGPLRIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDAQNDK 293


>gi|225628131|ref|ZP_03786166.1| diaminopimelate epimerase [Brucella ceti str. Cudo]
 gi|260169356|ref|ZP_05756167.1| diaminopimelate epimerase [Brucella sp. F5/99]
 gi|261758874|ref|ZP_06002583.1| diaminopimelate epimerase [Brucella sp. F5/99]
 gi|225616956|gb|EEH14003.1| diaminopimelate epimerase [Brucella ceti str. Cudo]
 gi|261738858|gb|EEY26854.1| diaminopimelate epimerase [Brucella sp. F5/99]
          Length = 303

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 193/284 (67%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG  + E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPTEWEFSGTFDPATGEWSRDTQ 290


>gi|254707543|ref|ZP_05169371.1| diaminopimelate epimerase [Brucella pinnipedialis M163/99/10]
 gi|261315024|ref|ZP_05954221.1| diaminopimelate epimerase [Brucella pinnipedialis M163/99/10]
 gi|261304050|gb|EEY07547.1| diaminopimelate epimerase [Brucella pinnipedialis M163/99/10]
          Length = 303

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 193/284 (67%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DL TWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLHTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 290


>gi|239833058|ref|ZP_04681387.1| diaminopimelate epimerase [Ochrobactrum intermedium LMG 3301]
 gi|239825325|gb|EEQ96893.1| diaminopimelate epimerase [Ochrobactrum intermedium LMG 3301]
          Length = 318

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 151/281 (53%), Positives = 195/281 (69%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM G+GN+I+V DMRG  D IT +A   L++D  T FDQIM IHD + A  D +I II
Sbjct: 25  FAKMNGLGNQIIVADMRGRADRITPEAAIRLASDSETAFDQIMAIHDPRTAGTDNYIAII 84

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R++FTFET  GIL A E+ DG ISVDMG+P  DW
Sbjct: 85  NCDGTQAQACGNGTRCVVQALAAETGRQAFTFETRAGILTATEHEDGLISVDMGKPRFDW 144

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA  F         +GP++   L +P V SMGNPHAIF+V+ D++ Y+L  FG LL
Sbjct: 145 QDIPLAEEFRDTRMIELQVGPIDAPVLHSPSVASMGNPHAIFWVDRDVWSYELEKFGPLL 204

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS E+++LRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 205 EHHPIFPERANISIAEVTSPETMNLRTWERGAGLTRACGSAACAAAVSAARTRRTGRTVT 264

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +
Sbjct: 265 VNVPGGPLLIEWRDDDHVIMTGPAEWEFSGIFDPATGEWSR 305


>gi|294851174|ref|ZP_06791847.1| diaminopimelate epimerase [Brucella sp. NVSL 07-0026]
 gi|294819763|gb|EFG36762.1| diaminopimelate epimerase [Brucella sp. NVSL 07-0026]
          Length = 294

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 145/281 (51%), Positives = 192/281 (68%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I IINCD
Sbjct: 1   MNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAIINCD 60

Query: 71  GSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLI 130
           G++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW+ I
Sbjct: 61  GTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDI 120

Query: 131 PLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKH 190
           PLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL  H
Sbjct: 121 PLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLLENH 180

Query: 191 PMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKM 250
           P+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+V +
Sbjct: 181 PIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVTVNV 240

Query: 251 LGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  +
Sbjct: 241 PGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQ 281


>gi|150398287|ref|YP_001328754.1| diaminopimelate epimerase [Sinorhizobium medicae WSM419]
 gi|150029802|gb|ABR61919.1| Diaminopimelate epimerase [Sinorhizobium medicae WSM419]
          Length = 292

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 150/275 (54%), Positives = 186/275 (67%), Gaps = 1/275 (0%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G+GNKILV+DMRG  D +T  A   L+ D  T FDQIM IHD + A  DA+I I+N D
Sbjct: 1   MNGLGNKILVVDMRGRKDRVTRQAAIVLNADPATEFDQIMAIHDPKSAGTDAWIDIVNSD 60

Query: 71  GSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLI 130
           GS  Q+CGNG RCVV+ L +   +K+F F T+ G+L AKE+ DGSISVDMG+P   W  I
Sbjct: 61  GSMAQACGNGTRCVVQALAAETGKKAFLFHTVAGLLEAKEHDDGSISVDMGKPRFRWDQI 120

Query: 131 PLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKH 190
           PLA  F    R    IGP+    L +P VVSMGNPHAIF+VE+D+  YDL  FG LL  H
Sbjct: 121 PLAEEFHDTRRIELQIGPIEAPVLHSPSVVSMGNPHAIFWVENDVSGYDLDRFGPLLENH 180

Query: 191 PMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKM 250
           P+F E  N+S+AR+ S + +DLRTWERG GLT ACGSAACA+ V+     +T RAV+V +
Sbjct: 181 PIFPERANISVARIRSRQEMDLRTWERGAGLTLACGSAACAAAVSGARTGRTERAVTVNV 240

Query: 251 LGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
            GG L IEW + ++HV MTG A+ EW G LD  TG
Sbjct: 241 PGGPLRIEWRESDDHVIMTGPAEWEWSGTLDPVTG 275


>gi|227823741|ref|YP_002827714.1| diaminopimelate epimerase [Sinorhizobium fredii NGR234]
 gi|227342743|gb|ACP26961.1| diaminopimelate epimerase [Sinorhizobium fredii NGR234]
          Length = 306

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 148/280 (52%), Positives = 188/280 (67%), Gaps = 1/280 (0%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA+I 
Sbjct: 10  VQFARMNGLGNKILVVDMRGRKDRVTPGAAIALNADPATEFDQIMAIHDPRAPGTDAWID 69

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I+N DGS  Q+CGNG RCVV+ L +   +K+F F T+ G+L A+E+ DG ISVDMG P  
Sbjct: 70  IVNSDGSMAQACGNGTRCVVQALAAETGKKAFLFHTVAGLLEAREHDDGLISVDMGSPRF 129

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPLA  F    R    IGP++   L +P V SMGNPHAIF+VE+D++ Y+L  FG 
Sbjct: 130 GWNEIPLAEEFHDTRRIELQIGPIDDPVLHSPSVASMGNPHAIFWVENDVWSYELDRFGP 189

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           LL  HP+F E  N+SIA V S + +DLRTWERG GLT ACGSAACA+ V+     +T+R 
Sbjct: 190 LLENHPIFPERANISIAHVRSRQEMDLRTWERGAGLTLACGSAACAAAVSGARTGRTDRI 249

Query: 246 VSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
           V+V + GG L IEW + ++HV MTG A+ EW G +D  TG
Sbjct: 250 VTVNVPGGPLKIEWRESDDHVIMTGPAEWEWTGTVDPATG 289


>gi|86359535|ref|YP_471427.1| diaminopimelate epimerase [Rhizobium etli CFN 42]
 gi|123510509|sp|Q2K386|DAPF_RHIEC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|86283637|gb|ABC92700.1| diaminopimelate epimerase protein [Rhizobium etli CFN 42]
          Length = 301

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 198/293 (67%), Gaps = 5/293 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   SATVEFARMNGLGNKILVVDMRGRSDKVTPAAAVALNADPQTEFDQIMAIHDPKADGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG+
Sbjct: 62  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAIEHEDGTISVDMGK 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPLA  F    R    IGP+++  L +P  +SMGNPHAIF+V+ D+  YDLA 
Sbjct: 122 PVFDWDRIPLAEEFHDTSRIELQIGPIDNPLLHSPSAMSMGNPHAIFWVDKDVMSYDLAR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+VTS  ++  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 182 FGPLLENHPMFPERANITLAQVTSPTTMTTRTWERGAGLTLACGSAACSAAVSAARTGRT 241

Query: 243 NRAVSVKMLGGG----LLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKN 290
            R V + +        L IEW + ++HV MTG A+ EW G+LD  TG W + +
Sbjct: 242 GRKVKINVASAKPPAMLSIEWRERDDHVIMTGPAEWEWSGRLDPATGCWSRDD 294


>gi|319780720|ref|YP_004140196.1| diaminopimelate epimerase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166608|gb|ADV10146.1| diaminopimelate epimerase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 294

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 198/290 (68%), Gaps = 1/290 (0%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +S   FAKM GIGN+I+V DMRG  D +T+ A  AL+ D  T FDQIM IHD + +    
Sbjct: 2   ASTAPFAKMNGIGNEIIVADMRGRADRVTAAAAVALNADAATSFDQIMAIHDARTSGTAF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DG+  Q+CGNGMRCVV+ L +   +K FTFET+ GIL A+E+ DGSISVDMG 
Sbjct: 62  FIDILNSDGTGAQACGNGMRCVVQALAAETGQKIFTFETVAGILNAREHADGSISVDMGT 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P   W+ IPLA  F         IGP++   L +P VVSMGNPHAIF+V++D++ Y+L  
Sbjct: 122 PRFGWQDIPLAEEFRDTRMIELQIGPIDAPVLHSPSVVSMGNPHAIFWVDNDVWSYELDR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N++IA+VTS E++ +RTWERG GLT ACGSA+CA+VVA+   ++T
Sbjct: 182 FGPLLENHPMFPERANITIAQVTSPETMIIRTWERGAGLTKACGSASCAAVVAAARTNRT 241

Query: 243 NRAVSVKMLGGGLL-IEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            R+VS+   GGG L +EW D++HV +TG A+ E+ G  D   G W +  E
Sbjct: 242 GRSVSLLTPGGGTLHVEWRDDDHVVLTGAAEWEFSGNFDPSIGTWARDTE 291


>gi|114705322|ref|ZP_01438230.1| diaminopimelate epimerase [Fulvimarina pelagi HTCC2506]
 gi|114540107|gb|EAU43227.1| diaminopimelate epimerase [Fulvimarina pelagi HTCC2506]
          Length = 312

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 146/288 (50%), Positives = 195/288 (67%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V FA+M G+GN+I+V D+RG    I+  A  AL+  + T FDQIM IHD +    DA IR
Sbjct: 21  VPFARMNGLGNEIVVADLRGSKTRISPQAARALAGHEATRFDQIMAIHDPRLDGTDALIR 80

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           IIN DGSE ++CGNG RCVV+ L S   ++ FTFET  GI++A E  DG I+VDMG P  
Sbjct: 81  IINRDGSEAEACGNGTRCVVQALGSENGQRDFTFETRAGIIIAHEADDGMITVDMGRPRF 140

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W+ IPLA  F         IGP++   L +P V SMGNPHAIF+V++D++ YDL  FG 
Sbjct: 141 GWEDIPLAEEFRDTRAIELQIGPIDAPVLHSPSVASMGNPHAIFWVKNDVWSYDLERFGP 200

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  HP+F E  N+SIA+VT+ +SL LRTWERGVGLT ACGSAACA+ V++    +T+RA
Sbjct: 201 VLEHHPIFPERANISIAQVTASDSLTLRTWERGVGLTLACGSAACAAAVSAARTGRTDRA 260

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDD 293
           V+V + GG LLI W +++ V MTG A   W G+LD  TG +++  +++
Sbjct: 261 VTVTVPGGDLLIHWREDDKVMMTGPATWMWSGRLDPATGDFVRDAQEE 308


>gi|222087520|ref|YP_002546057.1| diaminopimelate epimerase protein [Agrobacterium radiobacter K84]
 gi|254767086|sp|B9JCL3|DAPF_AGRRK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|221724968|gb|ACM28124.1| diaminopimelate epimerase protein [Agrobacterium radiobacter K84]
          Length = 301

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 149/294 (50%), Positives = 196/294 (66%), Gaps = 5/294 (1%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T+ A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   SNTVEFARMNGLGNKILVVDMRGRKDVVTAAAAIALNADPATEFDQIMAIHDPKAEGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           +I I+N DG++ Q+CGNG RCVV+ L +   +K FTF+T+ GIL A E+ DG+ISVDMG 
Sbjct: 62  WIDILNSDGTKAQACGNGTRCVVQALAAETGKKVFTFQTVAGILNAVEHEDGTISVDMGR 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ DW  IPLA  F    R    IGP+++  L +P V+SMGNPHAIF+V+ D   YDLA 
Sbjct: 122 PVFDWDKIPLAEEFADTRRIELQIGPIDNPVLHSPSVMSMGNPHAIFWVDKDPMSYDLAR 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG LL  HPMF E  N+++A+V S   L  RTWERG GLT ACGSAAC++ V++    +T
Sbjct: 182 FGPLLENHPMFPERANITLAQVLSPTLLRTRTWERGAGLTLACGSAACSAAVSAARTGRT 241

Query: 243 NRAVSVKM----LGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            R V++ +      G L IEW +N +HV MTG A+ EW G +D  TG + +  E
Sbjct: 242 GRKVTIDVASAPASGQLTIEWRENDDHVVMTGPAEWEWSGVVDPVTGSFTRAQE 295


>gi|15889949|ref|NP_355630.1| diaminopimelate epimerase [Agrobacterium tumefaciens str. C58]
 gi|22256736|sp|Q8UC03|DAPF_AGRT5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|15157908|gb|AAK88415.1| diaminopimelate epimerase [Agrobacterium tumefaciens str. C58]
          Length = 299

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 146/287 (50%), Positives = 189/287 (65%), Gaps = 4/287 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V+FAKM G+ NKILV+DMRG  D +T  A  AL+++  T FDQIM IHD +    DAFI 
Sbjct: 5   VEFAKMNGLANKILVVDMRGRKDMVTPAAAIALNSNPATQFDQIMAIHDPRVGGTDAFID 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I+NCDG++ Q+CGNG RCVV+ L+S   + SFTF+T+ GIL A E+ DG ISVDMG P  
Sbjct: 65  ILNCDGTKAQACGNGTRCVVQALSSETGKTSFTFQTVAGILNAVEHEDGMISVDMGLPRF 124

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+  F    R    IGP++   L +P V+SMGNPHAIF+V+ D   +DL  FG 
Sbjct: 125 RWSDIPLSEEFHDTSRIELQIGPIDAPILHSPAVMSMGNPHAIFWVDRDPMTFDLERFGP 184

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           LL  HPMF E  N+++A+V S  +L  RTWERG GLT ACGSAACAS V++    +T R 
Sbjct: 185 LLENHPMFPEKANITLAQVISDSALRTRTWERGAGLTLACGSAACASAVSAARTGRTGRK 244

Query: 246 VSVKMLGG----GLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V++ +        L I+W ++NHV MTG A+ EW G +D  TG W +
Sbjct: 245 VTIDVASSPVRVPLTIDWREDNHVVMTGPAEWEWSGSVDPVTGVWAR 291


>gi|90421125|ref|ZP_01229027.1| diaminopimelate epimerase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334617|gb|EAS48397.1| diaminopimelate epimerase [Aurantimonas manganoxydans SI85-9A1]
          Length = 304

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 145/283 (51%), Positives = 193/283 (68%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V FA+M G+GN+I+V+D+RG    I++ A  AL+ D  T FDQIM IHD +    DA++R
Sbjct: 13  VAFARMNGLGNEIVVVDLRGSAARISAAAARALAEDPATRFDQIMAIHDPRLDGTDAYVR 72

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           IIN DGSE ++CGNG RCVV+ L +   R+ FTFET  GIL A E  DG I+VDMG P  
Sbjct: 73  IINRDGSEAEACGNGTRCVVQALAAETGRRDFTFETRAGILTAFERDDGLIAVDMGRPRF 132

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+  F         IGP++   L +P V SMGNPHAIF+V+ D++ Y+L  FG 
Sbjct: 133 GWSEIPLSEEFSDTRAIELQIGPIDAPILHSPSVASMGNPHAIFWVDRDVWSYELDRFGP 192

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  HP+F E  N+SIA+VT+ ++L LRTWERGVGLT ACGSAACA+ V++    +T R 
Sbjct: 193 VLENHPLFPERANISIAQVTAPDALTLRTWERGVGLTRACGSAACAAAVSATRTRRTGRI 252

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V+V + GG LLI+W D++HV MTG A+  W G+LD  TG +++
Sbjct: 253 VTVTVPGGDLLIDWRDDDHVIMTGPAEWNWSGRLDPATGAYVR 295


>gi|325294066|ref|YP_004279930.1| Diaminopimelate epimerase [Agrobacterium sp. H13-3]
 gi|325061919|gb|ADY65610.1| Diaminopimelate epimerase [Agrobacterium sp. H13-3]
          Length = 300

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 145/287 (50%), Positives = 189/287 (65%), Gaps = 4/287 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V+FAKM G+GNKILV+DMRG  D +T  A  AL+ D  T FDQIM IHD +    DAFI 
Sbjct: 5   VEFAKMNGLGNKILVVDMRGRRDMVTPAAAIALNADPATQFDQIMAIHDPRVGGTDAFID 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I+NCDG++ Q+CGNG RCVV+ L+S   + +FTF+T+ GIL A E+ DG ISVDMG P  
Sbjct: 65  ILNCDGTKAQACGNGTRCVVQALSSETGKTTFTFQTVAGILNAVEHEDGMISVDMGLPRF 124

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+  F    R    IGP++   L +P V+SMGNPHAIF+V+ D   +DL  FG 
Sbjct: 125 RWSDIPLSEEFHDTSRIELQIGPIDAPILHSPAVMSMGNPHAIFWVDRDPMEFDLERFGP 184

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           LL  HPMF E  N+++A+V S  +L  RTWERG GLT ACGSAACA+ V++    +T R 
Sbjct: 185 LLENHPMFPEKANITLAQVISDSALHTRTWERGAGLTLACGSAACAAAVSAARTGRTGRK 244

Query: 246 VSVKMLGG----GLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V++ +        L IEW ++NHV MTG A+ EW G +D  +G + +
Sbjct: 245 VTIDVASSPVRVPLTIEWREDNHVIMTGPAEWEWSGMVDPISGAFSR 291


>gi|222150097|ref|YP_002551054.1| diaminopimelate epimerase [Agrobacterium vitis S4]
 gi|254767087|sp|B9JUB9|DAPF_AGRVS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|221737079|gb|ACM38042.1| diaminopimelate epimerase [Agrobacterium vitis S4]
          Length = 303

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 193/291 (66%), Gaps = 5/291 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V+FAKM G+GNKILV+DMRG  D +   A  AL+ +  THFDQIM IHD + A   A+I 
Sbjct: 5   VEFAKMNGLGNKILVVDMRGRADRVMPQAAIALAGNAETHFDQIMAIHDPKLAGTFAYID 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           IINCDG+  Q+CGNG RCVV+ L++    K+FTF+T+ GIL A E+ D ++SVDMG P+ 
Sbjct: 65  IINCDGTLAQACGNGTRCVVQALSAETGLKAFTFQTLAGILNAVEHDDRTVSVDMGSPVF 124

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPL+  F    R    IGP++   L +P V+SMGNPHA+F+V+ D   YDL  FG 
Sbjct: 125 DWNRIPLSEEFHDTSRIELQIGPIDAPVLHSPAVMSMGNPHAVFWVDRDPMSYDLERFGP 184

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           LL  HP+F E  N+++A+VTS  ++  RTWERG GLT ACGSAACA+ V++    +  R 
Sbjct: 185 LLENHPLFPEKANITLAQVTSRTTMTTRTWERGAGLTLACGSAACAAGVSAARTGRAERK 244

Query: 246 VSVKMLGG----GLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
           V++ +        L IEW + + HV MTG A+ EW G+LD +TG W ++ +
Sbjct: 245 VTITVASSPNRQALDIEWRERDGHVIMTGAAEWEWAGQLDPQTGDWQREQQ 295


>gi|304392645|ref|ZP_07374585.1| diaminopimelate epimerase [Ahrensia sp. R2A130]
 gi|303295275|gb|EFL89635.1| diaminopimelate epimerase [Ahrensia sp. R2A130]
          Length = 288

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/284 (47%), Positives = 171/284 (60%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           ++ V F+KM GIGN+I+V D+RG  D +T +A  AL  D +T FDQ+M IHD  D + DA
Sbjct: 2   NTPVSFSKMNGIGNRIVVADLRGRADVVTEEAARALGHDPDTGFDQLMAIHDAGDENRDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            IRI N DGS   +CGNG RCVV +L  R     F F      L AK   DG ISV+MG 
Sbjct: 62  TIRIYNTDGSRAGACGNGTRCVVDWLHQRGGGNDFRFAVDGQPLSAKRLEDGRISVNMGV 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  DW  IPL+  F         +GP+    L  P V ++GNPH +FF E+D   Y L  
Sbjct: 122 PRFDWTQIPLSEEFADTSGIELEVGPLGAPLLHTPAVANIGNPHCVFFAENDPDTYALDK 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG +L  H +F +  N+SIA+VTS  ++ LRTWERG GLT ACGSAACA+VV +     T
Sbjct: 182 FGPMLEHHMLFPDRANISIAQVTSPTTMKLRTWERGAGLTLACGSAACAAVVCAVRRELT 241

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
            R V+V + GG L IEW D+N + MTG A  E++G  D  TG W
Sbjct: 242 ERHVTVSLPGGDLDIEWRDDNFIIMTGTATHEFDGTFDPATGGW 285


>gi|192288682|ref|YP_001989287.1| diaminopimelate epimerase [Rhodopseudomonas palustris TIE-1]
 gi|229813241|sp|B3Q862|DAPF_RHOPT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|192282431|gb|ACE98811.1| Diaminopimelate epimerase [Rhodopseudomonas palustris TIE-1]
          Length = 293

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 173/275 (62%), Gaps = 5/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R     +T     A++   +  +DQ+ML+   +    +AF+RI 
Sbjct: 9   FAKMNGIGNEIVVVDLRDQPAPVTPADARAVAA--HVPYDQLMLLQPARLPGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGIL-VAKENRDGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R + +   +   TFET  G+L   +   DG  +VDMGEP   
Sbjct: 67  NNDGSESGACGNGMRCVARQMFAGSDKNGLTFETRAGLLNCWRGPADGLYTVDMGEPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L  P VVSMGNPHAIF+V DD+  YDL  FG L
Sbjct: 127 WQDIPLAEEFRDTRMIELQIGPIDAPVLHTPSVVSMGNPHAIFWV-DDVNAYDLGRFGPL 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +T+R V
Sbjct: 186 LENHPIFPERANITLAHIVDRQHITMRTWERGAGLTKACGSAACATAVAAARLKRTDRTV 245

Query: 247 SVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLD 280
            + + GG L IEW DN NHV MTG A+ E+EG+ D
Sbjct: 246 EMTLPGGQLTIEWRDNDNHVLMTGGAEFEFEGRFD 280


>gi|75676960|ref|YP_319381.1| diaminopimelate epimerase [Nitrobacter winogradskyi Nb-255]
 gi|74421830|gb|ABA06029.1| diaminopimelate epimerase [Nitrobacter winogradskyi Nb-255]
          Length = 297

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 172/275 (62%), Gaps = 3/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM GIGN+I+V+D+R     +T+    A+++     +DQ+M++   +    +AF+RI 
Sbjct: 16  FSKMNGIGNEIVVVDLRDNPATVTAGEARAVASPGGVPYDQLMVLQPPRTPGTEAFVRIY 75

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGIL-VAKENRDGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R +     + + TFET  G+L   + +  G  SVDMG P   
Sbjct: 76  NNDGSEANACGNGMRCVARQIFEATDKTALTFETRAGLLNCWRGSAPGLYSVDMGSPKFG 135

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           WK IPLA  F         +GP++   L +P VVSMGNPHAIF+V DD++ YDLA FG L
Sbjct: 136 WKDIPLAEEFRDTRYIELQVGPIDAPVLHSPSVVSMGNPHAIFWV-DDIHAYDLARFGPL 194

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +  R V
Sbjct: 195 LENHPVFPERANITLAHIVDRDHITMRTWERGAGLTKACGSAACATAVAAARLKRVERIV 254

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A  E+EG  D
Sbjct: 255 HMTLPGGSLTIEWRERDDHVLMTGPAIFEYEGAFD 289


>gi|218530898|ref|YP_002421714.1| diaminopimelate epimerase [Methylobacterium chloromethanicum CM4]
 gi|254767110|sp|B7KQM2|DAPF_METC4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218523201|gb|ACK83786.1| Diaminopimelate epimerase [Methylobacterium chloromethanicum CM4]
          Length = 296

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 164/276 (59%), Gaps = 6/276 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G GN I+V+D+RG    +T     A++ D ++ FDQ+M++HD      DAF+RI 
Sbjct: 9   FLKMHGAGNAIVVLDLRGTAVRVTPAEARAIAADVHSRFDQLMVVHDPVTPGTDAFMRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLT--SRMKRKS----FTFETIRGILVAKENRDGSISVDMG 121
           N DGSE  +CGNG RCV   L     M R +     T ET  G++  K   + S +VDMG
Sbjct: 69  NTDGSESGACGNGTRCVGYALLDDPAMARPAENGALTLETKAGLVAVKRITERSFTVDMG 128

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P L W  IPL   F    R    +GP++   L +P  VSMGNPHAIFFVE D   YDL 
Sbjct: 129 QPRLRWDEIPLTEPFLDTRRIELQVGPIDDPILHSPAAVSMGNPHAIFFVERDPDSYDLG 188

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  HP+F E  N+SIA VTS +++ LR WERG GLT ACG+AACA+VVA+  L  
Sbjct: 189 RIGPLLEAHPIFPERANISIAEVTSRDTIKLRVWERGAGLTLACGTAACATVVAASRLRM 248

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             RA  V + GG L IEW  ++HV MTG    E EG
Sbjct: 249 IGRAARVALPGGELSIEWRADDHVLMTGPVYLEGEG 284


>gi|163852139|ref|YP_001640182.1| diaminopimelate epimerase [Methylobacterium extorquens PA1]
 gi|229807499|sp|A9W6A5|DAPF_METEP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|163663744|gb|ABY31111.1| Diaminopimelate epimerase [Methylobacterium extorquens PA1]
          Length = 296

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 164/276 (59%), Gaps = 6/276 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G GN I+V+D+RG    +T     A++ D ++ FDQ+M++HD      DAF+RI 
Sbjct: 9   FLKMHGAGNAIVVLDLRGTAVRVTPAEARAIAADVHSRFDQLMVVHDPVTPGTDAFMRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLT--SRMKRKS----FTFETIRGILVAKENRDGSISVDMG 121
           N DGSE  +CGNG RCV   L     M R +     T ET  G++  K   + S +VDMG
Sbjct: 69  NTDGSESGACGNGTRCVGYALLDDPAMARPAENGALTLETKAGLVAVKRITERSFTVDMG 128

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P L W  IPLA  F    R    +GP++   L +P  VSMGNPHAIFFVE D   YDL 
Sbjct: 129 QPRLRWDEIPLAEPFLDTRRIELQVGPIDDPILHSPAAVSMGNPHAIFFVERDPDSYDLG 188

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  HP+F E  N+SIA VT  +++ LR WERG GLT ACG+AACA+VVA+  L  
Sbjct: 189 RIGPLLEAHPIFPERANISIAEVTGRDTIKLRVWERGAGLTLACGTAACATVVAASRLRM 248

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             RA  V + GG L IEW  ++HV MTG    E EG
Sbjct: 249 IGRAARVALPGGELSIEWRADDHVLMTGPVYLEGEG 284


>gi|39933327|ref|NP_945603.1| diaminopimelate epimerase [Rhodopseudomonas palustris CGA009]
 gi|81564373|sp|Q6ND59|DAPF_RHOPA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|39652952|emb|CAE25694.1| diaminopimelate epimerase [Rhodopseudomonas palustris CGA009]
          Length = 293

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 174/275 (63%), Gaps = 5/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R     +T     A++   +  +DQ+ML+   + +  +AF+RI 
Sbjct: 9   FAKMNGIGNEIVVVDLRDQPAPVTPADARAVAA--HVPYDQLMLLQPARLSGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGIL-VAKENRDGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R + S  ++   TFET  G+L   +   DG  +VDMGEP   
Sbjct: 67  NNDGSESGACGNGMRCVARQMFSGSEKNGLTFETRAGLLNCWRGPADGLYTVDMGEPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L  P VVSMGNPHAIF+V DD+  YDL  FG L
Sbjct: 127 WQDIPLAEEFRDTRMIELQIGPIDAPVLHTPSVVSMGNPHAIFWV-DDVNAYDLGRFGPL 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAAC++ VA+  L +T+R V
Sbjct: 186 LENHPIFPERANITLAHIVDRQHITMRTWERGAGLTKACGSAACSTAVAAARLKRTDRTV 245

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + +NHV MTG A  E+EG+ D
Sbjct: 246 EMTLPGGQLTIEWRESDNHVLMTGGAAFEFEGRFD 280


>gi|220920231|ref|YP_002495532.1| diaminopimelate epimerase [Methylobacterium nodulans ORS 2060]
 gi|254767114|sp|B8I9H6|DAPF_METNO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219944837|gb|ACL55229.1| diaminopimelate epimerase [Methylobacterium nodulans ORS 2060]
          Length = 293

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 166/276 (60%), Gaps = 4/276 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN+I+V+D+RG    +      A++ D  + FDQ+M++HD   A  DA +RI 
Sbjct: 9   FLKMNGLGNEIVVLDLRGTPHIVQPQEARAIAADPRSRFDQLMVLHDPVTAGTDAALRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLT--SRMKRKS--FTFETIRGILVAKENRDGSISVDMGEP 123
           N DGSE  +CGNG RCV   +     M R +   T ++  G+L          +VDMG P
Sbjct: 69  NTDGSESGACGNGTRCVAWAMLEDPVMGRPAERLTLQSRAGLLAVTRVSATDFTVDMGPP 128

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W  IPLA  F    R    IGP++   L +P VVSMGNPHA+FFV+ D   YDLA  
Sbjct: 129 RLRWDEIPLAEPFPDTRRIELQIGPIDDPILHSPGVVSMGNPHAVFFVDRDPASYDLARI 188

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  HP+F E  N+S+A+V   E + LR WERG GLT ACGSAACA++VA+  L  T 
Sbjct: 189 GPLLEAHPIFPERANISVAQVRGPEHIVLRVWERGAGLTRACGSAACAALVAAARLRLTG 248

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           R   V + GG L+I+W +++HV MTG  + EWEG L
Sbjct: 249 RRAVVTLPGGDLVIDWGEDDHVRMTGPTELEWEGTL 284


>gi|86747485|ref|YP_483981.1| diaminopimelate epimerase [Rhodopseudomonas palustris HaA2]
 gi|123409040|sp|Q2J390|DAPF_RHOP2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|86570513|gb|ABD05070.1| diaminopimelate epimerase [Rhodopseudomonas palustris HaA2]
          Length = 293

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 175/275 (63%), Gaps = 5/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R     +T D   A++   +  +DQ+ML+   +    +AF+RI 
Sbjct: 9   FAKMNGIGNEIVVVDLRDQPAPVTPDDARAVAA--HVPYDQLMLLQPARLPGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGIL-VAKENRDGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R L +   ++  TFET  G+L   +   +G  +VDMG P   
Sbjct: 67  NNDGSESGACGNGMRCVARQLFAGSDQQGLTFETRAGLLNCWRGPAEGLFTVDMGAPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L  P VVSMGNPHAIF+V DD++ YDL  FG L
Sbjct: 127 WQDIPLAEEFRDTRGIELQIGPIDAPILHTPSVVSMGNPHAIFWV-DDIHAYDLGQFGPL 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +T+R V
Sbjct: 186 LENHPIFPERANITLAHIVDRQHITMRTWERGAGLTRACGSAACATAVAAARLRRTDRIV 245

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A+ E+EG+ D
Sbjct: 246 EMTLPGGKLTIEWREGDDHVLMTGGAELEFEGRFD 280


>gi|316931776|ref|YP_004106758.1| diaminopimelate epimerase [Rhodopseudomonas palustris DX-1]
 gi|315599490|gb|ADU42025.1| diaminopimelate epimerase [Rhodopseudomonas palustris DX-1]
          Length = 293

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 172/275 (62%), Gaps = 5/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R     +T     A++   +  +DQ+ML+   +    +AF+RI 
Sbjct: 9   FAKMNGIGNEIVVVDLRDQSAPVTPADARAVAA--HVPYDQLMLLQPARLPGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGIL-VAKENRDGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R + +   +   TFET  G+L   +   DG  +VDMGEP   
Sbjct: 67  NNDGSESGACGNGMRCVARQMFAGSDQNGLTFETRAGLLNCWRGPADGFYTVDMGEPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L  P VVSMGNPHAIF+V DD+  YDL  FG L
Sbjct: 127 WQDIPLAEEFRDTRMIELQIGPIDAPVLHTPSVVSMGNPHAIFWV-DDVNAYDLGRFGPL 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +T R V
Sbjct: 186 LENHPIFPERANITLAHIVDRQHITMRTWERGAGLTKACGSAACATAVAAARLKRTERTV 245

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW D +NHV MTG A+ E+EG+ D
Sbjct: 246 DMTLPGGRLTIEWRDSDNHVLMTGGAEFEFEGRFD 280


>gi|91974994|ref|YP_567653.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisB5]
 gi|123749435|sp|Q13DT7|DAPF_RHOPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91681450|gb|ABE37752.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisB5]
          Length = 293

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 172/275 (62%), Gaps = 5/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R     +T D   A++   +  +DQ+ML+   +    +AF+RI 
Sbjct: 9   FAKMNGIGNEIVVVDLRDQPAPVTPDDARAVAA--HLPYDQLMLLQPARLPGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGIL-VAKENRDGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R + +   ++  TFET  G+L   +   DG  +VDMGEP   
Sbjct: 67  NNDGSEAGACGNGMRCVARQMFASTDKQGLTFETRAGLLNCWRGPADGLYTVDMGEPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           WK IPLA  F         IGP++   L  P VVSMGNPHAIF+V DD+  +DL  FG L
Sbjct: 127 WKDIPLAEEFRDTRSIELQIGPIDAPLLHTPSVVSMGNPHAIFWV-DDIEAHDLGRFGPL 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L + +R V
Sbjct: 186 LENHPIFPERANITLAHIVDRDHITMRTWERGAGLTRACGSAACATAVAAARLKRADRVV 245

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L I W + +NHV MTG A  E+EG+ D
Sbjct: 246 EMTLPGGQLSIAWRESDNHVLMTGGATFEFEGRFD 280


>gi|170741816|ref|YP_001770471.1| diaminopimelate epimerase [Methylobacterium sp. 4-46]
 gi|229807516|sp|B0UCI8|DAPF_METS4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|168196090|gb|ACA18037.1| Diaminopimelate epimerase [Methylobacterium sp. 4-46]
          Length = 293

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 167/276 (60%), Gaps = 4/276 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN+I+V+D+R     +  +   A++ D  + FDQ+M++HD      DA +RI 
Sbjct: 9   FLKMNGLGNEIVVLDLRASSHVVRPEEARAIAADPRSRFDQLMVLHDPVTPGTDARLRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKR--KSFTFETIRGILVAKENRDGSISVDMGEP 123
           N DGSE  +CGNG RCV   + +   M R  +  T E+  G+L      D   +VDMG P
Sbjct: 69  NRDGSESGACGNGTRCVAWAMRADPVMGRAGEQLTLESAAGLLAVTRVSDTDFTVDMGPP 128

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W  IPL+  F    R    IGP++   L +P VVSMGNPHA+FFV+ D   YDL   
Sbjct: 129 HLRWDEIPLSEPFPDTRRIELQIGPIDAPILHSPGVVSMGNPHAVFFVDRDPETYDLGRI 188

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  HP+F E  N+S+A+V + + + LR WERG GLT ACGSAACA++VA+  L  T 
Sbjct: 189 GPLLEAHPLFPERANISLAQVVAADRIRLRVWERGAGLTRACGSAACAALVAAARLRLTG 248

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           R  +V + GG L+I W +++HV MTG  + EWEG+ 
Sbjct: 249 RRATVTLPGGDLVIAWGEDDHVRMTGPTELEWEGRF 284


>gi|254561878|ref|YP_003068973.1| diaminopimelate epimerase [Methylobacterium extorquens DM4]
 gi|254269156|emb|CAX25122.1| diaminopimelate epimerase [Methylobacterium extorquens DM4]
          Length = 285

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 162/275 (58%), Gaps = 6/275 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G GN I+V+D+RG    +T     A++ D ++ FDQ+M++HD      DAF+RI N D
Sbjct: 1   MHGAGNAIVVLDLRGTAVRVTPAEARAIAADVHSRFDQLMVVHDPVTPGTDAFMRIYNTD 60

Query: 71  GSEVQSCGNGMRCVVRFLT--SRMKRKS----FTFETIRGILVAKENRDGSISVDMGEPI 124
           GSE  +CGNG RCV   L     M R +     T ET  G++  K   + S +VDMG+P 
Sbjct: 61  GSESGACGNGTRCVGYALLDDPAMARPAENGALTLETKAGLVAVKRITERSFTVDMGQPR 120

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L W  IPLA  F    R    +GP++   L +P  VSMGNPHAIFFVE D   YDL   G
Sbjct: 121 LRWDEIPLAEPFLDTRRIELQVGPIDDPILHSPAAVSMGNPHAIFFVERDPDSYDLGRIG 180

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            LL  HP+F E  N+SIA VT  +++ LR WERG GLT ACG+AACA+VVA+  L    R
Sbjct: 181 PLLEAHPIFPERANISIAEVTGRDTIKLRVWERGAGLTLACGTAACATVVAASRLRLIGR 240

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           A  V + GG L IEW  ++HV MTG    E EG  
Sbjct: 241 AARVALPGGELSIEWRADDHVLMTGPVYLEGEGTF 275


>gi|240139471|ref|YP_002963946.1| Diaminopimelate epimerase (DAP epimerase) [Methylobacterium
           extorquens AM1]
 gi|240009443|gb|ACS40669.1| Diaminopimelate epimerase (DAP epimerase) [Methylobacterium
           extorquens AM1]
          Length = 285

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 162/275 (58%), Gaps = 6/275 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G GN I+V+D+RG    +T     A++ D ++ FDQ+M++HD      DAF+RI N D
Sbjct: 1   MHGAGNAIVVLDLRGTAVRVTPAEARAIAADVHSRFDQLMVVHDPVTPCTDAFMRIYNTD 60

Query: 71  GSEVQSCGNGMRCVVRFLT--SRMKRKS----FTFETIRGILVAKENRDGSISVDMGEPI 124
           GSE  +CGNG RCV   L     M R +     T ET  G++  K   + S +VDMG+P 
Sbjct: 61  GSESGACGNGTRCVGYALLDDPAMARPAENGALTLETKAGLVAVKRITERSFTVDMGQPR 120

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L W  IPLA  F    R    +GP++   L +P  VSMGNPHAIFFVE D   YDL   G
Sbjct: 121 LRWDEIPLAEPFLDTRRIELQVGPIDDPILHSPAAVSMGNPHAIFFVERDPDSYDLGRIG 180

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            LL  HP+F E  N+SIA VTS +++ LR WERG GLT ACG+AACA+VVA+  L    R
Sbjct: 181 PLLEAHPIFPERANISIAEVTSRDTIKLRVWERGAGLTLACGTAACATVVAASRLRMIGR 240

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              V + GG L IEW  ++HV MTG    E EG  
Sbjct: 241 TARVALPGGELSIEWRADDHVLMTGPVYLEGEGTF 275


>gi|27375588|ref|NP_767117.1| diaminopimelate epimerase [Bradyrhizobium japonicum USDA 110]
 gi|32171443|sp|Q89X45|DAPF_BRAJA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|27348725|dbj|BAC45742.1| diaminopimelate epimerase [Bradyrhizobium japonicum USDA 110]
          Length = 291

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 172/276 (62%), Gaps = 4/276 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIRI 66
           FAKM GIGN+I+V+DMR     +T D   A+ S      +DQ+M++   +    +AFI I
Sbjct: 9   FAKMNGIGNEIVVVDMRDSTAKVTPDDARAVASAQGGVPYDQLMVLQKPRLDGTEAFISI 68

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SVDMGEPIL 125
            N DGSE  +CGNGMRCVVR +  +  + + TFET  G+L A +     + +VDMG P  
Sbjct: 69  YNNDGSEAGACGNGMRCVVRRIFEKTGQATATFETAAGLLNAWQGPAPDLYTVDMGVPKF 128

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W+ IPLA  F         IGP+++  L +P VVSMGNPHAIF+V DD+  YDLA FG 
Sbjct: 129 GWQDIPLAEEFRDTRYIELQIGPIDNPILHSPSVVSMGNPHAIFWV-DDVNAYDLARFGP 187

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           LL  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +  R 
Sbjct: 188 LLENHPIFPERANITLAHIVDRDHITIRTWERGAGLTRACGSAACATAVAAARLKRAERN 247

Query: 246 VSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           V + + GG L IEW + ++HV MTG A  E+EG  D
Sbjct: 248 VEITLPGGKLGIEWRERDDHVLMTGTATFEYEGNFD 283


>gi|188582087|ref|YP_001925532.1| diaminopimelate epimerase [Methylobacterium populi BJ001]
 gi|229807500|sp|B1ZDT1|DAPF_METPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|179345585|gb|ACB80997.1| Diaminopimelate epimerase [Methylobacterium populi BJ001]
          Length = 296

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 166/278 (59%), Gaps = 6/278 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G GN I+V+D+RG    +      A++ D ++ FDQ+M++HD      DAF+RI 
Sbjct: 9   FLKMHGAGNAIVVLDLRGTSIRVAPAEARAIAADAHSRFDQLMVVHDPVTPGTDAFMRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLT--SRMKRKS----FTFETIRGILVAKENRDGSISVDMG 121
           N DGSE  +CGNG RCV   L     M R +     T ET  G++  K   D S +VDMG
Sbjct: 69  NTDGSESGACGNGTRCVGYALLDDPAMARPAENGCLTLETKAGLVAVKRVTDRSFTVDMG 128

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P L W  IPLA  F    R    +GP++   L +P  VSMGNPHAIFFVE D   +DL 
Sbjct: 129 QPRLRWDEIPLAEPFPDTRRIELQVGPIDDPILHSPAAVSMGNPHAIFFVERDPDTFDLG 188

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  HP+F E  N+SIA+VTS +++ LR WERG GLT ACG+AACA+VVA+  L  
Sbjct: 189 RIGPLLEAHPIFPERANISIAQVTSRDTIKLRVWERGAGLTLACGTAACATVVAAARLRM 248

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             RA  V + GG L IEW  ++HV MTG    E EG L
Sbjct: 249 IGRAARVALPGGELSIEWRADDHVLMTGPVFLEGEGSL 286


>gi|170751705|ref|YP_001757965.1| diaminopimelate epimerase [Methylobacterium radiotolerans JCM 2831]
 gi|170658227|gb|ACB27282.1| Diaminopimelate epimerase [Methylobacterium radiotolerans JCM 2831]
          Length = 325

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 163/278 (58%), Gaps = 6/278 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G GN I+V+D+RG    +  +   A++ D  + FDQ+M++HD      DAF+RI 
Sbjct: 39  FLKMHGAGNAIVVLDLRGSAAKVRPEEARAIAQDPGSTFDQLMVLHDPVSPGADAFMRIY 98

Query: 68  NCDGSEVQSCGNGMRCVVRFLT--SRMKRKS----FTFETIRGILVAKENRDGSISVDMG 121
           N DGSE  +CGNG RCV   +     M R +       ET  G+L  +   + + +VDMG
Sbjct: 99  NTDGSESGACGNGTRCVAYAMLDDPAMARPAEGGRLVLETRAGLLGVRRVSERAFTVDMG 158

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L W  IPL+  F    R    IGP++   L +P  V+MGNPHA+FFVE D   +DLA
Sbjct: 159 RPRLAWDEIPLSEPFPDTRRIELQIGPIDDPILHSPGAVNMGNPHAVFFVEQDPDSFDLA 218

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  HP+F E  N+S+A+VT  E++ LR WERG GLT ACG+AACA+VVA+  L  
Sbjct: 219 RIGPMLENHPLFPERANISVAQVTGRETIKLRVWERGAGLTLACGTAACATVVAASRLRM 278

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             R  SV + GG L +EW  ++HV MTG      EG L
Sbjct: 279 IGRQASVALPGGELFVEWRADDHVLMTGPVALVAEGTL 316


>gi|90421739|ref|YP_530109.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisB18]
 gi|122477672|sp|Q21CU6|DAPF_RHOPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|90103753|gb|ABD85790.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisB18]
          Length = 288

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 169/274 (61%), Gaps = 4/274 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM GIGN+I+V+D+R     +   A +A +      +DQ+M++   +    +AF+RI 
Sbjct: 9   FSKMNGIGNEIVVLDLR--DHPVAVSAADARAIASEVPYDQLMVLQPPRTPGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGSE  +CGNGMRCV R + +     + TFET  G+L          +VDMG P L W
Sbjct: 67  NNDGSESSACGNGMRCVARQVFATSASDALTFETRAGLLNCWRPAPNLYTVDMGPPKLGW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K IPLA  F         IGP++   L  P VVSMGNPHAIF+V DD+  +DLA FG LL
Sbjct: 127 KDIPLAEEFRDTRSIELQIGPIDAPVLHTPSVVSMGNPHAIFWV-DDVNAHDLARFGPLL 185

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+++A++   + + +RTWERGVGLT ACGSAACA+ VA+  L + NR V 
Sbjct: 186 ENHPIFPERANITLAQIVDRDHIVIRTWERGVGLTKACGSAACATAVAAARLRRVNRVVH 245

Query: 248 VKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
           + + GG L IEW   ++HV MTG A  E+EG+ D
Sbjct: 246 ITLPGGELGIEWRASDDHVLMTGPAAFEFEGRFD 279


>gi|148251980|ref|YP_001236565.1| diaminopimelate epimerase [Bradyrhizobium sp. BTAi1]
 gi|166224244|sp|A5E915|DAPF_BRASB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146404153|gb|ABQ32659.1| diaminopimelate epimerase [Bradyrhizobium sp. BTAi1]
          Length = 289

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 172/277 (62%), Gaps = 4/277 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM GIGN+I+V+D+R     +T D   A++      +DQ+M++   +    +AFIRI 
Sbjct: 9   FVKMNGIGNEIVVLDLRDVKHVVTPDEARAVAA--RVPYDQLMVLQPPRLDGTEAFIRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SVDMGEPILD 126
           N DGSE  +CGNGMRCVVR +  +  + S TFET  G+L   +     + +VDMG P   
Sbjct: 67  NNDGSESGACGNGMRCVVRQVFEKTGQASATFETRAGLLNCWQGPAPDLYTVDMGVPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L +P VV+MGNPHA+F+V+ D+  YDL  FG L
Sbjct: 127 WQEIPLAEEFRDTRYIELQIGPIDAPILHSPSVVNMGNPHAVFWVDGDVNSYDLERFGPL 186

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L + NR V
Sbjct: 187 LENHPIFPERANITLAHIVDRDHITMRTWERGAGLTKACGSAACATAVAAARLKRANRIV 246

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
            + + GG L IEW + ++HV MTG A  E+EG+ + +
Sbjct: 247 QMTLPGGELTIEWRERDDHVLMTGTATFEFEGRFEPQ 283


>gi|300024818|ref|YP_003757429.1| diaminopimelate epimerase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526639|gb|ADJ25108.1| diaminopimelate epimerase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 289

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 128/279 (45%), Positives = 175/279 (62%), Gaps = 1/279 (0%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +S + F KM G+GN+I+V+D+R      T+D   A++ D  +HFDQ+M++H  +    ++
Sbjct: 4   ASSLPFVKMNGLGNEIVVVDLRESAKVFTADEAAAIAADGKSHFDQMMVLHPAKTPGTES 63

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +RI N DGSE  +CGNGMRCV   L + + RK F  ET  G+L        SI+VDMGE
Sbjct: 64  LVRIYNTDGSEAGACGNGMRCVGWILANDIGRKQFKVETRAGVLDTVVRDQTSITVDMGE 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P   W+ IPLA  F         IGP++   L +P VV++GNPHAIF+V DD+  YDL  
Sbjct: 124 PRFGWQDIPLAEEFRDTRAIELQIGPIDRPVLHSPSVVNVGNPHAIFWV-DDVEAYDLGR 182

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  HP+F E  N+S+A+VTS  SL L+TWERG GLT ACGSAACA+ V++     T
Sbjct: 183 LGPMLECHPVFPERANISLAQVTSPRSLRLKTWERGAGLTRACGSAACAAAVSAARKRLT 242

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            R V V + GG L + W DNN + MTG  + E+EG +D+
Sbjct: 243 ERTVDVTLPGGVLNVAWADNNRILMTGPVEFEYEGVIDL 281


>gi|299133085|ref|ZP_07026280.1| diaminopimelate epimerase [Afipia sp. 1NLS2]
 gi|298593222|gb|EFI53422.1| diaminopimelate epimerase [Afipia sp. 1NLS2]
          Length = 290

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 171/275 (62%), Gaps = 3/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R     +++    A++  +   +DQ+M++   + A   AFIRI 
Sbjct: 9   FAKMNGIGNEIVVVDLRKSDSQVSAAEARAVAAPNGVPYDQLMVLQKPKLAGTSAFIRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SVDMGEPILD 126
           N DGSE  +CGNGMRCV + +      ++ TFET  G+L   +     + +VDMG P   
Sbjct: 69  NNDGSEAGACGNGMRCVAKRVFGENGERAATFETRAGLLNCWQGPSPDLYTVDMGAPKFG 128

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         +GP++   L +P VVSMGNPHAIF+V DD+  YDL  FG L
Sbjct: 129 WQDIPLAEEFRDTRYIELQVGPIDSPVLHSPSVVSMGNPHAIFWV-DDIDAYDLERFGPL 187

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +TNR V
Sbjct: 188 LENHPIFPERANITLAHIVDRDHIRMRTWERGAGLTKACGSAACATAVAAARLKRTNRIV 247

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A  E+EG  D
Sbjct: 248 QMSLPGGDLTIEWRERDDHVLMTGAAVLEYEGVFD 282


>gi|146337529|ref|YP_001202577.1| diaminopimelate epimerase [Bradyrhizobium sp. ORS278]
 gi|166224245|sp|A4YKA5|DAPF_BRASO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146190335|emb|CAL74331.1| diaminopimelate epimerase [Bradyrhizobium sp. ORS278]
          Length = 289

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 173/275 (62%), Gaps = 4/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM GIGN+I+V+D+R     +T D   A+++     +DQ+M++   +    +AFIRI 
Sbjct: 9   FVKMNGIGNEIVVLDLRDVKHVVTPDEARAVAS--RVPYDQMMVLQRPRFDGTEAFIRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SVDMGEPILD 126
           N DGSE  +CGNGMRCVV  +  +  + S TFET  G+L   +     + +VDMG P   
Sbjct: 67  NNDGSESGACGNGMRCVVSQVFGKTGQTSATFETRAGLLNCWQGPAPDLYTVDMGVPRFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L +P VVSMGNPHA+F+V++D+  YDL  FG L
Sbjct: 127 WQDIPLAEEFRDTRYIELQIGPIDAPILHSPSVVSMGNPHAVFWVDNDVNSYDLERFGPL 186

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A++   + + +RTWERG GLT ACGSAACA+ VA+  L + NR V
Sbjct: 187 LENHPIFPERANITLAQIVDRDHITMRTWERGAGLTRACGSAACATAVAAARLKRANRLV 246

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A  E+EG+ +
Sbjct: 247 HMTLPGGELTIEWRERDDHVLMTGTATFEFEGRFE 281


>gi|92119035|ref|YP_578764.1| diaminopimelate epimerase [Nitrobacter hamburgensis X14]
 gi|122416839|sp|Q1QHJ3|DAPF_NITHX RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91801929|gb|ABE64304.1| diaminopimelate epimerase [Nitrobacter hamburgensis X14]
          Length = 290

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/275 (42%), Positives = 170/275 (61%), Gaps = 3/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM GIGN+I+V+D+R     +T++   A+++     +DQ+M++   +    +AF+ I 
Sbjct: 9   FSKMNGIGNEIVVVDLRDRPAAVTAEEARAVASPGGVPYDQLMVLQPPRLPGTEAFVSIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR-DGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R +     + + TFET  G+L   +    G  +VDMG P   
Sbjct: 69  NNDGSEANACGNGMRCVARQVFEATGKAALTFETRAGLLSCWQGPAPGLYTVDMGPPKFG 128

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         +GP++   L +P VVSMGNPHAIF+V DD+  +DL  FG L
Sbjct: 129 WRDIPLAEEFRDTRYIELQVGPIDAPVLHSPSVVSMGNPHAIFWV-DDVNAHDLERFGPL 187

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG G+T ACGSAACA+ VA+  L + +R V
Sbjct: 188 LENHPIFPERANITLAHIAGRDRIVMRTWERGAGMTKACGSAACATAVAAARLKRADRVV 247

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GGGL IEW + ++HV MTG A  E+ G  D
Sbjct: 248 DMVLPGGGLTIEWRERDDHVLMTGPAVFEYAGTFD 282


>gi|319899509|ref|YP_004159606.1| Diaminopimelate epimerase [Bartonella clarridgeiae 73]
 gi|319403477|emb|CBI77057.1| Diaminopimelate epimerase [Bartonella clarridgeiae 73]
          Length = 284

 Score =  221 bits (564), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 129/281 (45%), Positives = 169/281 (60%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM G+GNKI+V DMR    NIT  A+ AL+ +  THFDQIM IH       D  I I 
Sbjct: 5   FSKMNGLGNKIIVADMRENTHNITLQAVLALAKNPQTHFDQIMTIHPSTKNETDFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS+ ++CGNG RCV+ +LT+    +SF  ET  GI+  K   +G ISV+MG P  D 
Sbjct: 65  NADGSKAKACGNGTRCVIEWLTNHNLGESFQLETPAGIVEGKRQANGLISVNMGRPNFDI 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P+A      +      GP     L++  +VS GN HAIFFVE ++ H  L  +G  L
Sbjct: 125 KNMPIAYEIADTNHVEITAGP-----LKDASLVSFGNLHAIFFVESNIQHIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA VTS  SL LRTWERG GLT ACG+AACAS VA+     T R ++
Sbjct: 180 EHDPLFPERCNISIAFVTSRNSLILRTWERGAGLTKACGTAACASAVAAYRRGLTERRIN 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V +LGG L I + +++H+ MTG  + E+ G L   TG + K
Sbjct: 240 VNLLGGNLSILYQEDDHIIMTGPVEYEFSGLLSPLTGDYKK 280


>gi|85714449|ref|ZP_01045437.1| diaminopimelate epimerase [Nitrobacter sp. Nb-311A]
 gi|85698896|gb|EAQ36765.1| diaminopimelate epimerase [Nitrobacter sp. Nb-311A]
          Length = 301

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 170/275 (61%), Gaps = 3/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM GIGN+I+V+D+R    ++T++   A+++     +DQ+M++   +    +A +RI 
Sbjct: 20  FSKMNGIGNEIVVVDLRDSPASVTAEEARAVASPAGVPYDQLMVLQPPRTPGTEALVRIY 79

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR-DGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R +     + + TFET  G+L    N   G  +VDMG P   
Sbjct: 80  NKDGSEANACGNGMRCVARQIFEASGKDALTFETRAGLLNCWRNSAPGLYTVDMGPPKFG 139

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         +GP++   L +P VVSMGNPHAIF+V DD+  +DL  FG L
Sbjct: 140 WRDIPLAEEFRDTRYIELQVGPIDAPVLHSPSVVSMGNPHAIFWV-DDVNAHDLERFGPL 198

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERGVGLT ACGSAAC + VA+  L +  R V
Sbjct: 199 LENHPIFPERANITLAHIVDRDHIAMRTWERGVGLTKACGSAACGTAVAAARLKRAARIV 258

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A  E+EG  D
Sbjct: 259 HMMLPGGDLTIEWRERDDHVLMTGPAVFEYEGTFD 293


>gi|209883420|ref|YP_002287277.1| diaminopimelate epimerase [Oligotropha carboxidovorans OM5]
 gi|229813237|sp|B6JAP3|DAPF_OLICO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|209871616|gb|ACI91412.1| diaminopimelate epimerase [Oligotropha carboxidovorans OM5]
          Length = 290

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 167/275 (60%), Gaps = 3/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+++D+R     +++    A++      +DQ+M++   +     AF+RI 
Sbjct: 9   FAKMNGIGNEIVIVDLRNTDSQLSAAEARAIAAPGGVPYDQLMVLQKPRMPGTTAFVRIY 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SVDMGEPILD 126
           N DGSE  +CGNGMRCV + +      ++ TFET  G+L   +     + +VDMG P   
Sbjct: 69  NNDGSEAGACGNGMRCVAKRVFGESGAQAATFETRAGLLNCWQGPSPDLYTVDMGTPKFG 128

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L +P VVSMGNPHAIF+V DD+  YDL   G L
Sbjct: 129 WQDIPLAEEFRDTRYIELQIGPIDAPVLHSPSVVSMGNPHAIFWV-DDIEAYDLERLGPL 187

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A V     + +RTWERG GLT ACGSAACA+ VA+  L +T+R V
Sbjct: 188 LENHPIFPERANITLAHVVDRNHIRMRTWERGAGLTLACGSAACATAVAAARLKRTDRTV 247

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A  E+EG  D
Sbjct: 248 EMSLPGGDLTIEWRESDDHVLMTGAAVLEYEGLFD 282


>gi|319404903|emb|CBI78504.1| Diaminopimelate epimerase [Bartonella rochalimae ATCC BAA-1498]
          Length = 283

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 169/281 (60%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM G+GNKI+V DMR    NIT  AI AL+ +  T+FDQ+M IH      ++  I I 
Sbjct: 5   FSKMNGLGNKIIVADMRESTHNITQQAILALAKNPQTYFDQLMTIHPSIKNEINFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS+ Q+CGNG RCV+ +LT     +SF  ET  GI+  K   +G ISV+MG P  D 
Sbjct: 65  NSDGSKAQACGNGTRCVIEWLTKHNLGESFQLETPAGIVEGKRQANGLISVNMGRPNFDA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P+AR     +      GP     L++  +VS+GN HA FF E+++ H  L  +G  L
Sbjct: 125 KNMPIAREVADTNHVEIRAGP-----LKDASLVSIGNLHAYFFCENNIEHIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA VTS  SL LRTWERG GLT ACGSAACAS V +     T R + 
Sbjct: 180 ENDPLFPERCNISIASVTSRNSLILRTWERGAGLTKACGSAACASAVTAYRRGLTERCID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V +LGG L I + +++HV MTG  + E+ G L+  TG + K
Sbjct: 240 VNLLGGNLSILYQEDDHVIMTGPVEYEFSGLLNPLTGDYKK 280


>gi|328541782|ref|YP_004301891.1| diaminopimelate epimerase [polymorphum gilvum SL003B-26A1]
 gi|326411534|gb|ADZ68597.1| Diaminopimelate epimerase [Polymorphum gilvum SL003B-26A1]
          Length = 304

 Score =  215 bits (547), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 168/289 (58%), Gaps = 5/289 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDAS 59
           M S+   F KM G+GN  +V D R    +++ + I AL        FDQ++ + +   A 
Sbjct: 1   MASARRPFLKMNGLGNDFVVWDARAEALSLSPETIAALGNRSTGIGFDQMITV-ECSPAG 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SV 118
            DAF+RI NCDGS+V +CGN  RCV R L     R     ET  G+LVA+   D  + +V
Sbjct: 60  ADAFMRIHNCDGSQVSACGNATRCVGRLLMEESGRPDANIETRAGLLVARATGDPRVVTV 119

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L W  IPLA  F         IGP++   L  P VV+MGNPHAIF+V  D+  Y
Sbjct: 120 DMGVPRLRWDEIPLAEEFADTRAIELQIGPIDAPILHTPAVVNMGNPHAIFWV-GDVEAY 178

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL   G LL +HP+F EG N+S+A V + + + ++ WERG GLT ACG+AACA  VA+  
Sbjct: 179 DLGRIGPLLERHPIFPEGANISLAHVFAPDQIRVKVWERGAGLTRACGTAACAVAVAAAR 238

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKW 286
             +  R  +V + GG L IEW + + HV MTG  + E+EG++D+ T  W
Sbjct: 239 DGRAGRRSTVHLPGGPLTIEWREGDGHVLMTGATEVEFEGEIDLDTLAW 287


>gi|319406388|emb|CBI80029.1| Diaminopimelate epimerase [Bartonella sp. AR 15-3]
          Length = 284

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 131/281 (46%), Positives = 171/281 (60%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM G+GNKI+V DMR    NIT  AI  L+ +  THFDQIM IH    + +D  I I 
Sbjct: 5   FSKMNGLGNKIIVADMRESTHNITLQAILTLAKNPQTHFDQIMTIHPSTKSEIDFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS+ ++CGNG RCVV +LT+    +SF  ET  GI+  K   +G ISV+MG P  D 
Sbjct: 65  NADGSKAKACGNGTRCVVEWLTNHNLGESFQLETPVGIVKGKRQTNGLISVNMGCPNFDA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P+A      +      GP     L++  ++S+GN HAIFFVE+++ H  L  +G  L
Sbjct: 125 KNMPIAHEIADTNHVEITAGP-----LKDASLISIGNLHAIFFVENNIQHIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA VTS  SL LRTWERGVGLT ACGSAACAS VA+     T R + 
Sbjct: 180 EHDPLFPERCNISIAFVTSRNSLILRTWERGVGLTKACGSAACASAVAAYRRGLTERRID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           +   GG L I + +NNH+ MTG  + E+ G L+  TG + K
Sbjct: 240 INSPGGNLSIFYQENNHIIMTGPVEHEFSGLLNPLTGDYKK 280


>gi|115522349|ref|YP_779260.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisA53]
 gi|122297964|sp|Q07UV4|DAPF_RHOP5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|115516296|gb|ABJ04280.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisA53]
          Length = 288

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 165/275 (60%), Gaps = 5/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FAKM GIGN+I+V+D+R   D +   A  A +      +DQ+M++   + A   AFIRI 
Sbjct: 9   FAKMNGIGNEIVVLDLR--DDPVAVTAAAARAIASQVPYDQLMVLQPPRAAGTAAFIRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI-SVDMGEPILD 126
           N DGSE  +CGNGMRCV + + S     +  FE+  G+L         I +VDMG P   
Sbjct: 67  NNDGSESNACGNGMRCVAKQVFSGTDASALAFESRAGLLQCWRGAAPDIYTVDMGVPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L  P  VSMGNPHAIF+V DD++ +DL  FG L
Sbjct: 127 WQDIPLAEEFRDTRMIELQIGPIDAPLLHTPSAVSMGNPHAIFWV-DDVHAHDLGRFGPL 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +     + +RTWERGVGLT ACGSAACA+ VA+  L +  R V
Sbjct: 186 LENHPIFPERANITLAHIVDRTHIVIRTWERGVGLTKACGSAACATAVAAVRLKRAERQV 245

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L I+W + ++HV MTG A  E+EG LD
Sbjct: 246 QISLPGGDLTIDWREADDHVLMTGGASFEFEGTLD 280


>gi|319407863|emb|CBI81516.1| Diaminopimelate epimerase [Bartonella sp. 1-1C]
          Length = 283

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 170/281 (60%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM G+GNKI+V DMR    NIT  AI AL+ +  T+FDQ+M IH      ++  I I 
Sbjct: 5   FSKMNGLGNKIIVADMRESTHNITLQAILALAKNPQTYFDQLMTIHPSIKNEINFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS+ Q+CGNG RCV+ +LT     +SF  ET  GI+  K   +G ISV+MG P  + 
Sbjct: 65  NSDGSKAQACGNGTRCVIEWLTKHNLGESFQLETPAGIVEGKRQANGLISVNMGRPNFNA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P+AR     +      GP     L++  +VS+GN HAIFFVE+++    L  +G  L
Sbjct: 125 KNMPIAREVADTNHVEITAGP-----LKDASLVSIGNLHAIFFVENNIEDIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA VTS  SL LRTWERG GLT ACGSAACAS V +     T R + 
Sbjct: 180 ENDPLFPERCNISIASVTSRNSLILRTWERGAGLTKACGSAACASAVTAYRRGLTERCID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V +LGG L I + +++H+ MTG  + E+ G L+  TG + K
Sbjct: 240 VNLLGGNLSILYQEDDHIIMTGPVEYEFSGLLNPLTGDYKK 280


>gi|49474820|ref|YP_032862.1| diaminopimelate epimerase [Bartonella quintana str. Toulouse]
 gi|81646717|sp|Q6FYC7|DAPF_BARQU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|49240324|emb|CAF26806.1| Diaminopimelate epimerase [Bartonella quintana str. Toulouse]
          Length = 283

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 169/281 (60%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM+G+GN+I+V DMR     +T  AI AL+ D  THFDQIM IH       D  I I 
Sbjct: 5   FRKMDGLGNQIIVADMRESTHALTPQAILALAADPQTHFDQIMTIHSSTQKEADFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS  ++CGNG RCV+ +LT     +SF  ET  GI+  K   D  ISVDMG P  + 
Sbjct: 65  NADGSMAKACGNGTRCVIAWLTDHNLGESFRLETPAGIIEGKRQTDNLISVDMGCPNFNA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P++R     +  +   GP     L++  +VS+GN HAIFFVED++    L  +G  L
Sbjct: 125 KEMPVSREIADTNYVKITAGP-----LKDACLVSIGNLHAIFFVEDNIQQIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA VTS +SL+LRTWERG GLT ACGSAACAS VA+     T R + 
Sbjct: 180 EHDPLFPERCNISIASVTSHKSLNLRTWERGAGLTKACGSAACASAVAAYRRGLTQRHID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V + GG L I + ++NH+ MTG  K E+ G L+  TG + K
Sbjct: 240 VNLPGGTLNIVYREDNHIVMTGPTKYEFGGFLNPLTGTYKK 280


>gi|319409456|emb|CBI83105.1| Diaminopimelate epimerase [Bartonella schoenbuchensis R1]
          Length = 283

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 126/283 (44%), Positives = 171/283 (60%), Gaps = 5/283 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           + F+KM G+GN+I+V DMR    NIT  AI  L+ D  THFDQIM IH       D  I 
Sbjct: 3   IPFSKMNGLGNQIIVADMRESAHNITPQAIFTLAVDPQTHFDQIMAIHPPIQNDTDFRIE 62

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I N DGS  ++CGNG RCV+ +L++    KSF  ET  G++  +   +G I VDMG P L
Sbjct: 63  IWNADGSIAKACGNGTRCVIEWLSNHTLNKSFRLETPAGVVEGERQSNGLICVDMGCPHL 122

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           + K +P++R     +  +   GP     L++  +VS+GN HAIFFV+ ++    L  +G 
Sbjct: 123 NAKDMPVSREISDTNHVKITAGP-----LQDACLVSVGNLHAIFFVDHNIQSIPLEKYGP 177

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            L   P+F E  N+SIA +TS +SL LRTWERG GLT ACGSAACAS VA+     T R 
Sbjct: 178 KLEHDPLFPERCNISIAFITSQKSLTLRTWERGAGLTKACGSAACASAVAAYRRGLTERH 237

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           + V + GG L I + ++NH+ MTG+A+ E+ G  D  TG + K
Sbjct: 238 IDVNLPGGTLAIHYREDNHIVMTGQAEYEFNGLFDPLTGAYEK 280


>gi|218659714|ref|ZP_03515644.1| diaminopimelate epimerase [Rhizobium etli IE4771]
          Length = 227

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 146/216 (67%), Gaps = 5/216 (2%)

Query: 76  SCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARS 135
           +CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG+P+ DW  IPLA  
Sbjct: 1   ACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGKPVFDWDRIPLAEE 60

Query: 136 FDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSE 195
           F    R    IGP+++  L +P  +SMGNPHAIF+V+ D+  YDLA FG LL  HPMF E
Sbjct: 61  FHDTSRIELQIGPIDNPVLHSPSAMSMGNPHAIFWVDKDVMSYDLARFGPLLENHPMFPE 120

Query: 196 GVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLG--- 252
             N+++A+VTS  S+  RTWERG GLT ACGSAAC++ V++    +T R V + +     
Sbjct: 121 RANITLAQVTSPTSMTTRTWERGAGLTLACGSAACSAAVSAARTGRTGRRVMINVASAKP 180

Query: 253 -GGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKW 286
            G L IEW + ++HV MTG A+ EW G+LD  TG W
Sbjct: 181 PGTLSIEWRERDDHVIMTGPAEWEWSGRLDPATGLW 216


>gi|307943539|ref|ZP_07658883.1| diaminopimelate epimerase [Roseibium sp. TrichSKD4]
 gi|307773169|gb|EFO32386.1| diaminopimelate epimerase [Roseibium sp. TrichSKD4]
          Length = 321

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 176/298 (59%), Gaps = 5/298 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDAS 59
           M S+ V F KM G+GN  +V D R    N+  + I AL   D    FDQ++ + +     
Sbjct: 15  MASARVPFLKMNGLGNDFVVWDARSSAFNLPKEKIAALGNRDTGIGFDQMITV-ERSPLG 73

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR-DGSISV 118
           VDAF+RI NCDGS+V +CGN  RCV R L         T ET  G+L A       +++V
Sbjct: 74  VDAFMRIHNCDGSQVDACGNATRCVGRLLMEEKSTDRATIETKAGLLNAFATAVPRTVTV 133

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG+P L+W  IPLA  F         IGP++  +L  P  +SMGNPHAIF+V+D +  +
Sbjct: 134 DMGKPRLNWDEIPLAEEFYDTRAIELQIGPIDAPYLHTPAAISMGNPHAIFWVKD-VEAH 192

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL + G LL  HP+F EG N+S+A V +   + L+ WERG GLT ACG+AACA+ VA+  
Sbjct: 193 DLGTIGPLLEHHPVFPEGANISLAHVFAENQIRLKVWERGAGLTQACGTAACAAAVAAAR 252

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEA 295
             K  R  ++ + GG + IEW + ++HV MTG  + E+EG++D+ T +W +    D+A
Sbjct: 253 DDKAGRKSTIHLPGGPIEIEWREGDDHVLMTGLTEVEFEGEVDLDTLEWQRTGPGDDA 310


>gi|329847627|ref|ZP_08262655.1| diaminopimelate epimerase [Asticcacaulis biprosthecum C19]
 gi|328842690|gb|EGF92259.1| diaminopimelate epimerase [Asticcacaulis biprosthecum C19]
          Length = 270

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/274 (39%), Positives = 158/274 (57%), Gaps = 9/274 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D R        D I A S       FDQ++ I D +D   DAF+R+ N 
Sbjct: 1   MNGLGNDFIVVDARETAFQPAPDQIRAWSNRVSGIGFDQLIAIEDSRDG--DAFMRVWNA 58

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR----DGSISVDMGEPIL 125
           DG  V++CGN +RCV  +L      K+   +T+ G   A+  R     G+ S+DMG+P L
Sbjct: 59  DGGGVETCGNALRCVAWYLNRDASDKTLKIDTLGGATKARVLRADATTGTASIDMGKPGL 118

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW+ IPL+   +   +    +GP +      P  VSMGNPH +FFV DD+   D+ + G+
Sbjct: 119 DWRDIPLSEEMNTA-KLELKVGPYDAPLYHTPVAVSMGNPHCVFFV-DDIATVDVKATGS 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  HP+F E VN+  A++   +++ +R WERG G+T ACG+ ACA++VA+     T RA
Sbjct: 177 LIEHHPLFPESVNVEFAQILDKDTIRMRVWERGAGITQACGTGACATLVAAARRGLTGRA 236

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +V M GG L I W +N+HV MTG  + E+EG L
Sbjct: 237 ATVHMDGGPLHIVWAENDHVIMTGPVEVEFEGTL 270


>gi|217978010|ref|YP_002362157.1| Diaminopimelate epimerase [Methylocella silvestris BL2]
 gi|254767115|sp|B8EM14|DAPF_METSB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|217503386|gb|ACK50795.1| Diaminopimelate epimerase [Methylocella silvestris BL2]
          Length = 290

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 158/272 (58%), Gaps = 2/272 (0%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           KM GIGN+IL++D+RG    +T     A++      FDQ+M++ D +     AF+ I N 
Sbjct: 11  KMNGIGNEILIVDLRGAGAGVTGPQARAIARTKGLAFDQLMVLEDPRSKGCAAFVTIFNA 70

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKL 129
           DGS+  +CGNG RCV   L     R     ET  G L  +   +   SV+MG P L    
Sbjct: 71  DGSQSAACGNGTRCVAWTLLKDGARDEVLLETAAGRLACRRVSELVFSVEMGRPRLKAAE 130

Query: 130 IPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAK 189
           IPL+R            GP +   L+NP VV+MGNPHAIFFVE D+  YDLA+ G +L  
Sbjct: 131 IPLSRDAPDTSAVDLSFGPADSPILKNPAVVNMGNPHAIFFVE-DIGAYDLAAIGPVLEH 189

Query: 190 HPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVK 249
            P+F E  N+S+AR+ S E ++L+ WERGVGLT ACGSAACA++VA+     T R  +V 
Sbjct: 190 DPLFPERANISLARIVSPERIELKVWERGVGLTLACGSAACAALVAAARRGLTGRRATVA 249

Query: 250 MLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           + GG L I W + ++ V MTG    E+E +LD
Sbjct: 250 LPGGELDIFWRESDDMVVMTGPVAFEFETRLD 281


>gi|118591329|ref|ZP_01548727.1| diaminopimelate epimerase [Stappia aggregata IAM 12614]
 gi|118436001|gb|EAV42644.1| diaminopimelate epimerase [Stappia aggregata IAM 12614]
          Length = 303

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 172/297 (57%), Gaps = 7/297 (2%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M S    F KM G+GN  +V D R     +  +AI AL   +    FDQ++ + +     
Sbjct: 1   MASETRPFLKMNGLGNDFVVWDARENPLRLAPEAIAALGDRETGIGFDQMITV-ERSSLG 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDG--SIS 117
           VDAF+RI N DGSEV +CGN  RC+ R L     +   T ET  G+L A  + DG  S++
Sbjct: 60  VDAFMRIHNRDGSEVSACGNATRCIGRLLMEEAGKDLVTIETGAGLLHAF-DADGPRSVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P L W  IPLA  F         IGP++   L  P VV+MGNPHAIF+V DD+  
Sbjct: 119 VDMGVPRLAWNEIPLAEEFADTRAIELQIGPIDDPILHTPAVVNMGNPHAIFWV-DDVEA 177

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           Y+L   G LL  HP+F E  N+S+A V   + + ++ WERGVGLT ACG+AACA  VA+ 
Sbjct: 178 YELERVGPLLEHHPIFPEYANISLAHVFDTDQIRVKVWERGVGLTLACGTAACAVGVAAA 237

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDD 293
              +T+R  ++ + GG + IEW + +NHV M+G  + E+EG++D+ T  W K    D
Sbjct: 238 RDGRTSRKTTIHLPGGPIGIEWRESDNHVLMSGLTEVEFEGEVDLDTLAWRKTAAGD 294


>gi|121602373|ref|YP_988358.1| diaminopimelate epimerase [Bartonella bacilliformis KC583]
 gi|166224243|sp|A1UQV5|DAPF_BARBK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|120614550|gb|ABM45151.1| diaminopimelate epimerase [Bartonella bacilliformis KC583]
          Length = 282

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 171/282 (60%), Gaps = 8/282 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHD-FQDASVDAFIRI 66
           F+KM G+GNKI+V D+R    NIT  AI AL+++  THFDQIM IH   QDA  D  I I
Sbjct: 5   FSKMNGLGNKIIVADLRKAIHNITPQAIQALASNPQTHFDQIMAIHPPTQDA--DFRIEI 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS  ++CGNG RCV+ +L +     +F  ET  GI+  K   DG ISVDMG P L+
Sbjct: 63  WNADGSMAKACGNGTRCVIEWLANHNLGNNFRLETSTGIVEGKRQTDGLISVDMGRPYLN 122

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
            K +P++R     +      GP     L++  +VS+GN HAIFF+E ++ +  L  +G  
Sbjct: 123 AKDMPVSREIIDTNHVDITAGP-----LQDACLVSVGNLHAIFFIESNIQNIPLEKYGPK 177

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L   P+F E  N+SIA++TS +SL LRTWERG GLT ACGSAACAS VA+     T R +
Sbjct: 178 LEHDPLFPERCNISIAQITSKKSLTLRTWERGAGLTQACGSAACASAVAAYRRGLTERHI 237

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            V +  G L I + D+ H+ MTG  + E+ G  +  TG + K
Sbjct: 238 DVNLPKGILSILYRDDEHIIMTGPTEHEFSGLFNPLTGTYKK 279


>gi|163869368|ref|YP_001610624.1| diaminopimelate epimerase [Bartonella tribocorum CIP 105476]
 gi|189082826|sp|A9IZW1|DAPF_BART1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|161019071|emb|CAK02629.1| Diaminopimelate epimerase [Bartonella tribocorum CIP 105476]
          Length = 283

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 124/283 (43%), Positives = 169/283 (59%), Gaps = 5/283 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM+G+GN+I+V DMR     +T  AI ALS D   HFDQIM I +      D  I I 
Sbjct: 5   FSKMDGLGNQIIVADMRESTQALTPQAILALSADPEMHFDQIMAIRNPTKNEADFHIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS+ ++CGNG RCV+ +LT     ++F  E   GI+  K   D  ISVDMG P  + 
Sbjct: 65  NADGSKAKACGNGTRCVIAWLTDHNFGENFRLEAPTGIIEGKRQADNLISVDMGCPNFNA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P++R     +      GP     L++  ++S+GN HAIFFVE+D+ H  L  +G  L
Sbjct: 125 KEMPVSREIVDTNHIDITAGP-----LKDACLISIGNLHAIFFVENDVQHIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA +TS +SL+LRTWERG GLT ACGSAACA  VA+     T R + 
Sbjct: 180 EHDPLFPERCNISIACITSKKSLNLRTWERGAGLTQACGSAACAGAVAAYRRSLTQRHID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKN 290
           V + GG L I + +++H+ MTG  K ++ G L+  TG + K N
Sbjct: 240 VNLPGGKLNIFYREDDHIIMTGPIKYQFSGFLNPLTGCYKKDN 282


>gi|209965482|ref|YP_002298397.1| diaminopimelate epimerase [Rhodospirillum centenum SW]
 gi|254767118|sp|B6IP82|DAPF_RHOCS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|209958948|gb|ACI99584.1| diaminopimelate epimerase [Rhodospirillum centenum SW]
          Length = 291

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 112/274 (40%), Positives = 159/274 (58%), Gaps = 10/274 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +V+D R     +T+ A  A++ D +T    DQI+L+   +  + D F+R
Sbjct: 5   FLKMHGLGNDFVVLDARRDPLPLTTAAARAIA-DRHTGVGCDQIVLLEPPRHPAADLFMR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I+N DGSE  +CGN  RCV   +     R   T ET  G+L  +   DGS++VDMG   L
Sbjct: 64  ILNPDGSESGACGNATRCVASLVADGSGRAEVTVETATGLLRCRLRADGSVTVDMGPARL 123

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPLA + D + R     GP     L++   V MGNPHA+FFV DD    DLA+ G 
Sbjct: 124 DWTQIPLAAAHDTL-RVPAGAGP-----LQDACCVGMGNPHAVFFV-DDAEAVDLATLGP 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  H +F +  N+ +A+V + + + +R WERG G+T ACGS +CA++VA+     T RA
Sbjct: 177 VLEHHSLFPQRCNIEVAQVLAPDHIRMRVWERGAGITRACGSGSCATLVAAARRGLTGRA 236

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +++ GG L IEWH + HV MTG     + G+L
Sbjct: 237 AWIELDGGRLWIEWHGDGHVLMTGPVATAFTGEL 270


>gi|158425334|ref|YP_001526626.1| diaminopimelate epimerase [Azorhizobium caulinodans ORS 571]
 gi|158332223|dbj|BAF89708.1| diaminopimelate epimerase [Azorhizobium caulinodans ORS 571]
          Length = 317

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 157/277 (56%), Gaps = 14/277 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN+ILV+D+R   +++ + A  AL+      FDQ M+++  + A   AF+RI+
Sbjct: 41  FVKMNGLGNEILVLDLRHEPEDVPAAAARALARPGVLPFDQAMVLYPPRRADTAAFVRIL 100

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGSE  +CGNG RC+  +   R+  +   FE+  G+L      DG ++VDMG P L W
Sbjct: 101 NSDGSESGACGNGTRCIAAYEAGRIGERHVLFESAAGLLDCVMQPDGQVTVDMGAPRLGW 160

Query: 128 KLIPLARSFDKMDRDRFH----IGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             IPLAR        +      +GP +        +VSMGNPHA+FFV  D    D+ + 
Sbjct: 161 DAIPLARPVADTSAVQIEGFASLGPAS--------MVSMGNPHAVFFVP-DANAVDVEAL 211

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  HP+F E  N+S A+V S + + L  WERG G T ACG+AACA+ V++    +T 
Sbjct: 212 GATLEHHPLFPERANISFAQVLSPDHILLHVWERGAGRTRACGTAACATGVSTARTGRTG 271

Query: 244 RAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           R V V + GG L+I+W   + HV MTG    E+ G L
Sbjct: 272 RKVRVTLPGGDLVIDWRASDGHVLMTGPVALEFTGTL 308


>gi|240851392|ref|YP_002972795.1| diaminopimelate epimerase [Bartonella grahamii as4aup]
 gi|240268515|gb|ACS52103.1| diaminopimelate epimerase [Bartonella grahamii as4aup]
          Length = 283

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 166/281 (59%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM+G+GN+I+VIDMR     +T  AI ALS D   HFDQIM IH       D  I I 
Sbjct: 5   FSKMDGLGNQIIVIDMRESTHALTPQAILALSADPEIHFDQIMAIHTPTQKKADFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS  ++CGNG RCVV +L      + F  ET  GI+      D  ISVDMG P  + 
Sbjct: 65  NADGSMAKACGNGTRCVVAWLKDHNFGEKFRLETPAGIIEGTYQTDNLISVDMGCPNFNA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P++R     +      GP     L++  ++S+GN HAIFFVE+D+ H  L  +G  L
Sbjct: 125 KEMPVSREIVDTNHVEITAGP-----LKDACLISIGNLHAIFFVENDIQHIPLEKYGPKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E  N+SIA +TS +SL+LRTWERGVGLT ACGSAACAS VA+     T R + 
Sbjct: 180 EHDPLFPEQCNISIACITSKKSLNLRTWERGVGLTQACGSAACASAVAAYRRGLTQRHID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V +  G L I + +++HV MTG  K ++ G L   TG + K
Sbjct: 240 VNLPKGTLNIFYREDDHVIMTGPIKYQFSGFLSPLTGCYKK 280


>gi|49476309|ref|YP_034350.1| diaminopimelate epimerase [Bartonella henselae str. Houston-1]
 gi|81647473|sp|Q6G1L7|DAPF_BARHE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|49239117|emb|CAF28421.1| Diaminopimelate epimerase [Bartonella henselae str. Houston-1]
          Length = 283

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/281 (44%), Positives = 168/281 (59%), Gaps = 5/281 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM+G+GN+I+V DMR     +T  AI +L+ D  T+FDQIM IH       D  I I 
Sbjct: 5   FSKMDGLGNQIIVADMRESTHALTPQAILSLAADSQTYFDQIMAIHLPTKKEADFRIEIW 64

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS   +CGNG RCV+ +LT     + F  ET  GI+  K   D  ISVDMG P  + 
Sbjct: 65  NADGSMANACGNGTRCVIAWLTDHNYGEIFRLETPAGIVEGKRQIDNLISVDMGCPNFNA 124

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K +P++R     +      GP     LR+  +VS+GN HAIFFVE+D+ +  L  +G+ L
Sbjct: 125 KEMPVSREIIDTNHVELTAGP-----LRDACLVSIGNLHAIFFVENDIQYIPLEKYGSKL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F +  N+SIA VTS ESL+LRTWERG GLT ACGSAACAS VA+     T R + 
Sbjct: 180 EHDPLFPQRCNISIACVTSQESLNLRTWERGAGLTQACGSAACASAVAAYRRGLTKRNID 239

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           V + GG L I + +++H+ MTG  K  + G L+  TG + K
Sbjct: 240 VNLPGGTLNIFYREDDHIIMTGPVKYGFSGFLNPLTGSYKK 280


>gi|254504487|ref|ZP_05116638.1| diaminopimelate epimerase [Labrenzia alexandrii DFL-11]
 gi|222440558|gb|EEE47237.1| diaminopimelate epimerase [Labrenzia alexandrii DFL-11]
          Length = 293

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 166/283 (58%), Gaps = 9/283 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH---FDQIMLIHDFQDASVDAFIRII 67
           M G+GN  +V D R     +T D I  L   D  H   FDQ++ + +     VDAF+RI 
Sbjct: 1   MNGLGNDFVVWDAREKPLRLTKDQIAKLG--DREHGIGFDQMITV-ERSTCGVDAFMRIH 57

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD-GSISVDMGEPILD 126
           N DG +V +CGN  RC+ R L     +   T ET  G+L A +     +++VDMG+P L+
Sbjct: 58  NSDGGQVDACGNATRCIGRLLMEENAKDLVTIETNAGLLHAFDAAGLRNVTVDMGKPRLN 117

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W  IPLA  F         IGP++   L  P VV+MGNPHAIF+V+D +  YDLA  G L
Sbjct: 118 WDQIPLAEEFADTRAIELQIGPIDEPILHTPAVVNMGNPHAIFWVKD-VEAYDLARVGPL 176

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L +HP+F EG N+S+A +     + ++ WERG GLT ACG+AACA  VA+    KT R  
Sbjct: 177 LERHPVFPEGANISLAHIFDDNQIRVKVWERGAGLTLACGTAACAVGVAAARDDKTGRKT 236

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           ++ + GG + IEW + + HV MTG  + E+EG++DI+T  W K
Sbjct: 237 TIHLPGGPIGIEWREGDGHVLMTGLTEVEFEGEVDIETLTWRK 279


>gi|254470941|ref|ZP_05084344.1| diaminopimelate epimerase [Pseudovibrio sp. JE062]
 gi|211960083|gb|EEA95280.1| diaminopimelate epimerase [Pseudovibrio sp. JE062]
          Length = 291

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 169/290 (58%), Gaps = 9/290 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA--FIRII 67
           M G+GN  +V D R     +T   I  +   +    FDQ++ +   + AS DA  F+RI 
Sbjct: 1   MNGLGNDFVVFDSREKKIVLTPAQIATIGDREKGIGFDQMITV---EPASSDAYAFMRIH 57

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVA-KENRDGSISVDMGEPILD 126
           N DGSEV +CGN  RC+ R L       S T +T  G+L+A   + +  +SVDMG P L+
Sbjct: 58  NRDGSEVDACGNATRCIGRLLMGEAGTPSVTIQTNAGLLIAHASDSETLVSVDMGRPRLE 117

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W  IPLA  F         IGP++   L +P VV++GNPHAIF+V DD+  +DL  FG L
Sbjct: 118 WDQIPLAEEFADTRAIELQIGPIDAPVLHSPSVVNVGNPHAIFWV-DDIEAHDLERFGPL 176

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HPMF E  N+S+A++     + L+ WERGVGLT ACG+AACA+ VA+    +  R  
Sbjct: 177 LECHPMFPEKANISLAQIIGENEIRLKVWERGVGLTRACGTAACATGVAAARTGRAARKC 236

Query: 247 SVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEA 295
           +V + GG L IEW  DN+H+ MTGE   E+EG+L++ T  + K    D A
Sbjct: 237 TVHLPGGPLGIEWREDNDHIMMTGETAIEFEGELNLDTLAYTKTASGDAA 286


>gi|114797495|ref|YP_762200.1| diaminopimelate epimerase [Hyphomonas neptunium ATCC 15444]
 gi|114737669|gb|ABI75794.1| diaminopimelate epimerase [Hyphomonas neptunium ATCC 15444]
          Length = 269

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 156/271 (57%), Gaps = 7/271 (2%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           KM G GN   + D R      T++ I  ++ D     DQ++ +   +DA+ D F+RI N 
Sbjct: 5   KMNGAGNAFAIFDARSTAFTPTTEQIRKIAAD--LKADQVIAME--RDATKDVFMRIWNS 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKL 129
           DGSEV +CGN  RCV   +     +   T +T   +L A    +G I+VDMG P + W+ 
Sbjct: 61  DGSEVSACGNATRCVGLLMLDETGKDRVTIQTEADMLRATRAGEGLITVDMGSPQMGWED 120

Query: 130 IPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAK 189
           IPL+   D    D   IGP++   L  P VVSMGNPHA+FFV+D +  YD+ + G L+  
Sbjct: 121 IPLSEKMDVRGVD-VKIGPIDAPILSRPAVVSMGNPHAVFFVKD-VAAYDIPAIGPLVEW 178

Query: 190 HPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVK 249
           HP+F +G N+  A+V   E++ LR WER  GLT ACG+ ACA++V +     T R   + 
Sbjct: 179 HPLFPKGTNVGFAQVIDRETIRLRVWERAAGLTRACGTGACAALVCAARAGLTGRKARMI 238

Query: 250 MLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           + GG L I+W + ++HV+MTG  + E+E ++
Sbjct: 239 LDGGDLTIDWRESDDHVYMTGPVELEFEAEI 269


>gi|296446185|ref|ZP_06888133.1| diaminopimelate epimerase [Methylosinus trichosporium OB3b]
 gi|296256379|gb|EFH03458.1| diaminopimelate epimerase [Methylosinus trichosporium OB3b]
          Length = 288

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 155/273 (56%), Gaps = 3/273 (1%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           +M G GN+ILV+D+RG    +T+    A++      FDQ+M +H+ + A  +AF+RI N 
Sbjct: 12  RMNGAGNEILVLDLRGASHEVTAAEARAIARASGLRFDQLMTLHEPRAAGANAFMRIYNN 71

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKL 129
           DGS   +CGNG RCV   L  + +  +   ET  G + +    +   SVDMG P LDW+ 
Sbjct: 72  DGSRSGACGNGTRCVAFVLGEKGEGDALLLETDAGPIRSWRRGETLFSVDMGAPRLDWRA 131

Query: 130 IPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAK 189
           IPLA   +  D  R  + P           V+MGNPHA+FFVED      L + G  +  
Sbjct: 132 IPLAG--EGADTARVALAPAVIGAPEFFSAVNMGNPHAVFFVEDP-AAIALEALGPPIET 188

Query: 190 HPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVK 249
           HP+F E VN+S A V +   + LR WERG G+T ACGSAACA++VA+     + R   V+
Sbjct: 189 HPLFPERVNVSFASVLAPGEIALRVWERGTGVTKACGSAACATLVAASRAGLSGREARVR 248

Query: 250 MLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           + GG L I+W  ++HV MTG  + E+  +LD +
Sbjct: 249 LPGGDLDIDWGADDHVMMTGPVELEFVTRLDPR 281


>gi|315497312|ref|YP_004086116.1| diaminopimelate epimerase [Asticcacaulis excentricus CB 48]
 gi|315415324|gb|ADU11965.1| diaminopimelate epimerase [Asticcacaulis excentricus CB 48]
          Length = 280

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 156/279 (55%), Gaps = 10/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V+D R      ++  + A         FDQ++ I     AS DAF+R+
Sbjct: 5   FLKMNGLGNDFVVVDARQTPFRPSAAQVKAWGDRASGIGFDQLIAIEGA--ASGDAFMRV 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAK----ENRDGSISVDMGE 122
            N DG  V++CGN +RCV  +L           +T+ G   AK    + + G +SVDMG 
Sbjct: 63  WNSDGGPVETCGNALRCVGWYLDRDAPGNDLHIDTLGGATAAKVLERDAKTGMVSVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L W  IPL+   +  +R    +GP++      P  VSMGNPH +FFVED +   D+  
Sbjct: 123 PRLAWTQIPLSEEMNT-ERLELQVGPIDAPLYHTPCAVSMGNPHVVFFVED-VAAVDVER 180

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+L+  HP+F EGVN+  A+V    ++ +R WERG G+T ACG+ ACA++VA      +
Sbjct: 181 TGSLIENHPLFPEGVNVEFAQVIDRNTIRMRVWERGAGITKACGTGACATLVACARRGLS 240

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           +R  +V M GG L I W   ++HV MTG  + E+EG+L+
Sbjct: 241 DRHATVIMDGGPLHILWRQADDHVIMTGPVEVEFEGQLN 279


>gi|298293309|ref|YP_003695248.1| diaminopimelate epimerase [Starkeya novella DSM 506]
 gi|296929820|gb|ADH90629.1| diaminopimelate epimerase [Starkeya novella DSM 506]
          Length = 293

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 159/273 (58%), Gaps = 3/273 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN+I+V+D+R     +      AL+ +D   FDQIM ++  +     AF+RII
Sbjct: 9   FVKMNGLGNEIVVLDLRDAPLPVPPAEARALAREDVLPFDQIMALYPPKSEGTRAFVRII 68

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGSE  +CGNG RC+  +   R       FE++ G+L      +G I+ DMG P   W
Sbjct: 69  NADGSEAGACGNGTRCIALYEAGRTGDNHVVFESVAGLLDCTVAPEG-ITADMGVPHFGW 127

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             IPLA             GP     LR P VV++GNPHAIF+V D +   DL  +G  L
Sbjct: 128 HDIPLAGPVADTRAIELQAGPAEAPVLRAPSVVNVGNPHAIFWVHD-IEAVDLGRYGPEL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+S A+V S + + L+ WERG GLT ACGSAACA+ V++  +  T R V+
Sbjct: 187 EHHPVFPERANISAAQVVSPDHIVLKVWERGAGLTKACGSAACAAAVSAARIGLTGRRVT 246

Query: 248 VKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           V + GG L+I+W + ++H+ MTG A  E++G+L
Sbjct: 247 VTLPGGDLVIDWRESDDHILMTGPAVFEFDGRL 279


>gi|154244368|ref|YP_001415326.1| diaminopimelate epimerase [Xanthobacter autotrophicus Py2]
 gi|154158453|gb|ABS65669.1| Diaminopimelate epimerase [Xanthobacter autotrophicus Py2]
          Length = 290

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 153/277 (55%), Gaps = 14/277 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN+ILV+D+R     + + A  AL+      FDQ M+++  +     AF+RI+
Sbjct: 14  FVKMNGLGNEILVLDLRADPVEVPAAAARALARPSVLPFDQAMVLYPPRREGTAAFVRIL 73

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGS   +CGNG RC+      R       FE+  G+L      DG + VDMG P  DW
Sbjct: 74  NSDGSFSAACGNGTRCIAALEAERTGAPHALFESEAGLLDCLVRPDGQVEVDMGAPRFDW 133

Query: 128 KLIPLARSFDKMDR---DRFH-IGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
           + IPLAR   +  +     F  +GP +        +VSMGNPHA+FFV  D    D+   
Sbjct: 134 RDIPLARDVAETAQVIVPGFEALGPTS--------LVSMGNPHAVFFVP-DANAVDVEKL 184

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  HP+F E  N+S A +T+ + + L  WERG G T ACG+AACA+ V++    +T 
Sbjct: 185 GAALEHHPLFPERANISFASLTAPDRILLHVWERGAGRTRACGTAACATGVSAARTGRTG 244

Query: 244 RAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           R+V+V + GG L I W + + HV MTG  + E+ G L
Sbjct: 245 RSVTVTLPGGDLEISWREADGHVLMTGPVEHEFSGTL 281


>gi|182680304|ref|YP_001834450.1| diaminopimelate epimerase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|229807511|sp|B2IEM1|DAPF_BEII9 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|182636187|gb|ACB96961.1| Diaminopimelate epimerase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 149/279 (53%), Gaps = 9/279 (3%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           KM G+GN I+V+D+RG    I++    A+      HFDQ+M++HD       AF+RI N 
Sbjct: 11  KMNGLGNAIVVLDLRGTGIVISAAEARAIGQGKGLHFDQLMVLHDPLSPGSAAFMRIYNI 70

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKR--KSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DGS   +CGNG RCV   L     R       ET  G L   +  +   SVDMG+P   W
Sbjct: 71  DGSLAGACGNGTRCVAWTLLREDHRIGAELMLETAAGQLACLKLAEDRFSVDMGKPAFAW 130

Query: 128 KLIPLARSFDK-----MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
             IPLA          + RD   + PV+   LR   +V+MGNPHA+ FV D     DLA 
Sbjct: 131 DAIPLAHPVPDTNAVDLARDLAVLPPVDPDALRKASMVNMGNPHAVLFVADQ-DACDLAL 189

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  HP+F +  N+SIA V S + + L+ WERG G T ACGSAACA++VA+      
Sbjct: 190 VGPVLEHHPLFPDRANISIATVVSPDHIVLKVWERGAGATLACGSAACATLVAAVRHGLA 249

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
            R   + + GG L I W   ++HV MTG    E+  +LD
Sbjct: 250 AREARISLPGGDLTIAWRAADDHVIMTGPVTFEFTTRLD 288


>gi|302381573|ref|YP_003817396.1| diaminopimelate epimerase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192201|gb|ADK99772.1| diaminopimelate epimerase [Brevundimonas subvibrioides ATCC 15264]
          Length = 277

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 161/284 (56%), Gaps = 13/284 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDA 58
           MQ+S   F KM G GN  +V++         +D + AL+ D  T   FDQ++ I     A
Sbjct: 1   MQAS-TPFVKMNGAGNDFVVVNALETPFTPDADRVRALA-DRRTGEGFDQLIAIEPSDRA 58

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISV 118
             DAF+R+ N DG  V++CGN +RCV   L       S T +T+ G  +A+      ++V
Sbjct: 59  --DAFMRVWNADGGVVETCGNALRCVGWMLMQANGTDSATIDTLGGPAIARRAGPERVTV 116

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE--DDLY 176
           DMG P LDW+ IPLA + D    +   IGP++   +  P  VSMGNPH +FF +  DD++
Sbjct: 117 DMGAPRLDWREIPLAEAMDTRGIE-LQIGPIDDPVMHTPGAVSMGNPHVVFFTDRLDDVF 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G+++  HP+F +GVN+  A V + + + LR WERG GLT ACG+ ACA++VA+
Sbjct: 176 ---VTGAGSMIEHHPLFPQGVNVGFAHVLAPDRIRLRVWERGAGLTRACGTGACAALVAA 232

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
                T R+ +V + GG L I+W +   HV MTG  + E  G+L
Sbjct: 233 SRRGLTGRSATVVVDGGELDIDWDETTGHVLMTGPVEIERTGRL 276


>gi|312114979|ref|YP_004012575.1| diaminopimelate epimerase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220108|gb|ADP71476.1| diaminopimelate epimerase [Rhodomicrobium vannielii ATCC 17100]
          Length = 291

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 169/293 (57%), Gaps = 5/293 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDAS 59
           M  S + F KM G+GN   V+D R     +T+D  +A++  +     DQ++++     A 
Sbjct: 1   MAFSHISFKKMNGLGNDFAVLDARANDFQLTADEASAIANRETGVGCDQVIVLEPSSRA- 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
            D F+RI+N DGSEV +CGN  RCV   + + + R+  T ET  G+L A+ + DG ++VD
Sbjct: 60  -DVFMRILNADGSEVGACGNASRCVGALVAAELGRERVTIETAAGVLDARISGDGLVTVD 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P   W+ IPLA+           I   +   L  P V ++GNPHAIF+V D +  YD
Sbjct: 119 MGVPRFGWRDIPLAKEEPDTRAISLAITLPDGRVLEGPSVANVGNPHAIFWVAD-VDAYD 177

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           LA+FG  L   P+F E  N+S+A V   +++ LR WERG G+T ACG+AACA+ V++   
Sbjct: 178 LATFGGALEYDPIFPERANISLAEVIDDQTVKLRVWERGAGITQACGTAACATAVSAART 237

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            +T R+V +++ GG + IEW  D++H+ MTG    E+EG L +  G      E
Sbjct: 238 GRTGRSVEIRLPGGVIGIEWRADDDHILMTGPVAHEFEGTLTLSGGSLTVARE 290


>gi|288957726|ref|YP_003448067.1| diaminopimelate epimerase [Azospirillum sp. B510]
 gi|288910034|dbj|BAI71523.1| diaminopimelate epimerase [Azospirillum sp. B510]
          Length = 283

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 151/286 (52%), Gaps = 9/286 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
           +F KM G+GN  +VID R      ++  + A++        DQ +++        DAF+R
Sbjct: 4   EFLKMHGLGNDFVVIDARSEPYRPSAAEVRAIADRRIGVGCDQFIVLERTDAPGADAFMR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I N DG E  +CGN  RCV   L     R   +F+T  G+L A    +G I+VDMG P L
Sbjct: 64  IRNADGGEAAACGNASRCVGWLLMEESGRDRASFQTAAGLLHASRADNGRITVDMGPPRL 123

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPLA   D +      +  V H     P  V+MGNPHA+FFV DD     L   G 
Sbjct: 124 DWAAIPLAAPADTL-----RVETVAHGGFAAPVAVNMGNPHAVFFV-DDAEAVPLDEVGP 177

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +   HP F E  N+  A+V S  ++ +R WERG G+T ACGS +CA++VA+     T+R 
Sbjct: 178 VFENHPAFPERANIEFAQVLSPTAIRMRVWERGAGITQACGSGSCATLVAAVRRGLTDRK 237

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL--DIKTGKWIKK 289
             + + GG L IEW + + V MTG     + G+L  ++ +G+ + +
Sbjct: 238 ADIILDGGTLTIEWTEEDRVLMTGPVALAFSGRLSAELVSGELVSR 283


>gi|16127916|ref|NP_422480.1| diaminopimelate epimerase [Caulobacter crescentus CB15]
 gi|221236736|ref|YP_002519173.1| diaminopimelate epimerase [Caulobacter crescentus NA1000]
 gi|21362486|sp|Q9A280|DAPF_CAUCR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767096|sp|B8GVW2|DAPF_CAUCN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|13425448|gb|AAK25648.1| diaminopimelate epimerase [Caulobacter crescentus CB15]
 gi|220965909|gb|ACL97265.1| diaminopimelate epimerase [Caulobacter crescentus NA1000]
          Length = 288

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 146/279 (52%), Gaps = 8/279 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH------FDQIMLIHDFQDASVD 61
           F KM G+GN  +VI       + T + I A++             DQ++ I   +     
Sbjct: 5   FLKMNGLGNDFVVIQTLTEAFDPTPEQIRAIAKRPGVDGKGGIGCDQVIAIDPPRAEGAS 64

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A++R  N DG    +CGNG RCV   L     + +  F+T+ G L      D  ++VDMG
Sbjct: 65  AYVRFWNSDGEVAGACGNGTRCVAWLLMQSAGKDAVAFDTVAGRLSGVAAGDKLVTVDMG 124

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P LDW  IPLA   +  +R    +GP++   +  P  VSMGNPH +FFV+  +      
Sbjct: 125 PPGLDWTQIPLAEEMNT-ERVELQVGPIDAPLVHTPVCVSMGNPHVVFFVDAPVTDDFAR 183

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G+L+  HP+F EGVN+  A + S + + L+ WERG GLT ACG+ ACA+ VA+     
Sbjct: 184 GTGSLVEHHPLFPEGVNVGFAHIASRDHIRLKVWERGAGLTQACGTGACAAQVAAVRRGL 243

Query: 242 TNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
           T+R   V+   G L IEW +++ HV MTG    E+ GKL
Sbjct: 244 TDRKARVEFDTGSLTIEWRESDGHVIMTGPITMEYAGKL 282


>gi|144897540|emb|CAM74404.1| Diaminopimelate epimerase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 280

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 155/274 (56%), Gaps = 10/274 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +V+D+R     +T     A++ D  T    DQ+++I   +    DA++ 
Sbjct: 9   FLKMHGLGNDFVVVDVRRSGFVLTPAMARAIA-DRRTGLGCDQVVVIETARSGLSDAWMS 67

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           + N DGS   +CGN  RCV   L  +        ET  G+L A+   D  ++VDMG   L
Sbjct: 68  LWNADGSVTSACGNATRCVAWLLMQQAGSDHAVIETKAGLLDAEMRGDKLVAVDMGPARL 127

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW+ IPLA+  D +     H+G +    L +P  VSMGNPHA+FFV DD+   DLA+ G 
Sbjct: 128 DWREIPLAKPVDTL-----HMG-IGIGSLTDPVGVSMGNPHAVFFV-DDVAAIDLAALGP 180

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  H +F E  N+ +A+V + + + +R WERG G+T+ACG+ ACA++VA+     T R 
Sbjct: 181 VLEHHDLFPERANIEVAQVLAPDRIRMRVWERGTGITSACGTGACATLVAAARRGLTARK 240

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             V + GG L IEW  ++HV MTG      EG+L
Sbjct: 241 ADVVLDGGVLTIEWLPDDHVMMTGPVALVAEGRL 274


>gi|83309314|ref|YP_419578.1| diaminopimelate epimerase [Magnetospirillum magneticum AMB-1]
 gi|82944155|dbj|BAE49019.1| Diaminopimelate epimerase [Magnetospirillum magneticum AMB-1]
          Length = 301

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 153/279 (54%), Gaps = 13/279 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V+D R    ++T + + A+++       DQ++++    D   DA + I
Sbjct: 25  FLKMHGLGNDFVVLDARARALDLTPERVRAIASRGTGVGCDQLVVMTQATDPCADATMLI 84

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGSEV +CGN  RCV   L   +      F+T  G+L A+      ++VDMG   LD
Sbjct: 85  YNADGSEVAACGNASRCVAWLLMKEIAADKVVFQTKAGLLDAESRGPHQVAVDMGPARLD 144

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA + D +     H+G ++   L +P  VSMGNPHA+FFV DD    +LA  G  
Sbjct: 145 WREIPLAEAVDTL-----HLG-ISAGPLADPVGVSMGNPHAVFFV-DDAEAVNLAQLGRG 197

Query: 187 LAKHPMFSEGVNLSIARVTS-----LESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           L  H +F E  N+ +A+V +     +  + +R WERG G+T ACG+ ACA++VA+     
Sbjct: 198 LEHHALFPERANIEVAQVLTPPDAEMGRIRMRVWERGAGITMACGTGACATLVAAARRGL 257

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           + R   + + GG L IEW  + HV MTG     + G LD
Sbjct: 258 SPRKAEIILDGGTLTIEWLKDGHVLMTGPVAVAFTGTLD 296


>gi|329113599|ref|ZP_08242379.1| Diaminopimelate epimerase [Acetobacter pomorum DM001]
 gi|326697121|gb|EGE48782.1| Diaminopimelate epimerase [Acetobacter pomorum DM001]
          Length = 288

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 145/282 (51%), Gaps = 17/282 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASV 60
            S +  F KM G+GN  +++D RG H  +T   I AL+        DQ++ +        
Sbjct: 17  HSMLTSFRKMHGLGNDFVILDERGGHLPLTPARIAALAHRRRGIGCDQLVTLRPACAEGA 76

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D F+R  N DGSE  +CGN  RCV   +      ++   +T  G L A+   +G I+VDM
Sbjct: 77  DVFVRFFNPDGSEAGACGNASRCVADLIWRETGNRTPVLQTRAGRLPARIEENGLITVDM 136

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYD 179
           GEP L+W+ +PL    D +           HL L  +P   SMGNPHA FFVED    + 
Sbjct: 137 GEPRLNWQDVPLVAEMDTL-----------HLPLEGDPAAASMGNPHATFFVED----FA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
             S G  L   P+F E  N+  AR+     + L+  ERG G+T ACGS ACA+VV +   
Sbjct: 182 RLSQGQALEHDPLFPERANIGFARIDGSARMRLKVHERGAGVTEACGSGACAAVVNAARR 241

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               R   V++ GG L IEW  NNHV MTG A   +EG +D+
Sbjct: 242 GLVERVCEVELDGGILQIEWAPNNHVLMTGSATTAFEGTVDL 283


>gi|23015511|ref|ZP_00055285.1| COG0253: Diaminopimelate epimerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 284

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 150/279 (53%), Gaps = 13/279 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V+D R    ++T + + A+++       DQ++++    D+  DA + I
Sbjct: 8   FLKMHGLGNDFVVLDARAHAIDLTPERVRAIASRGTGVGCDQLVVMTQATDSCADAQMLI 67

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGSEV +CGN  RCV   L   +      F+T  G+L A+      ++VDMG   LD
Sbjct: 68  YNADGSEVAACGNASRCVAWLLMKEIAADKVVFQTKAGLLDAESRGPHQVAVDMGPARLD 127

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA + D +     H+G +    L +P  VSMGNPHA+FFV DD     LA  G  
Sbjct: 128 WREIPLAEAMDTL-----HLG-ITAGPLSDPVGVSMGNPHAVFFV-DDAEAVPLAQLGRG 180

Query: 187 LAKHPMFSEGVNLSIARVTSLESLD-----LRTWERGVGLTAACGSAACASVVASGCLHK 241
           L  H +F E  N+ +A+V S    D     +R WER  G+T ACG+ ACA++VA+     
Sbjct: 181 LEHHALFPERANIEVAQVLSPPDADMGRIRMRVWERSAGITMACGTGACATLVAAARRGL 240

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           + R   + + GG L IEW  + HV MTG     + G LD
Sbjct: 241 SPRKAEIILDGGSLTIEWLKDGHVLMTGPVAVAFTGVLD 279


>gi|310814821|ref|YP_003962785.1| diaminopimelate epimerase [Ketogulonicigenium vulgare Y25]
 gi|308753556|gb|ADO41485.1| diaminopimelate epimerase [Ketogulonicigenium vulgare Y25]
          Length = 277

 Score =  185 bits (469), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 153/283 (54%), Gaps = 18/283 (6%)

Query: 1   MQS---SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQ 56
           MQS   + + F KM G+GN  +V+D RG    +T   + AL+  +    FDQ+ +I D  
Sbjct: 1   MQSNSDTGLPFMKMHGLGNDFVVMDERGLPPRVTPALVAALADRNRGVGFDQMAIITDGG 60

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI 116
           +A  D  +   N DGS   +CGN  RC+ R+   R  + S T  T RG+L+A+E  +G  
Sbjct: 61  NA--DLHLTFFNADGSPSAACGNATRCIARYEMDRTGKTSLTITTDRGVLLAREEGNGLT 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           SV+MG P+ DW  IPLA   D +        P+    L  P   SMGNPH  FFV DD+ 
Sbjct: 119 SVNMGHPMTDWDEIPLAEDVDTLAL------PI----LGAPTATSMGNPHCTFFV-DDVM 167

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             DLA+ G  +  HP+F E  N+  A+V   + + +R WERG G+T A GS++CA+ VA+
Sbjct: 168 AIDLAAIGPTIEHHPLFPERTNVQFAQVIGEDRIRMRVWERGTGITLASGSSSCATAVAA 227

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                T   V + + GG L +EW D+  V+MTG     + G L
Sbjct: 228 YRRGLTRAKVEIVLDGGSLQVEWRDDG-VWMTGPTMHAFNGVL 269


>gi|258543519|ref|YP_003188952.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634597|dbj|BAI00573.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637653|dbj|BAI03622.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640707|dbj|BAI06669.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643762|dbj|BAI09717.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646817|dbj|BAI12765.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649870|dbj|BAI15811.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652860|dbj|BAI18794.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655914|dbj|BAI21841.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-12]
          Length = 270

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 146/279 (52%), Gaps = 17/279 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +  F KM G+GN  +++D R  H ++T   I AL+        DQ++ +        D F
Sbjct: 2   LTSFRKMHGLGNDFVILDERNGHLSLTPARIAALAHRRRGIGCDQLVTLRPACAEGADVF 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +R  N DGSE  +CGN  RCV   +      ++   +T  G L A+   +G I+VDMGEP
Sbjct: 62  VRFFNPDGSEAGACGNASRCVADLIWRETGNRTPVLQTRAGRLPARIEENGLITVDMGEP 121

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDLAS 182
            L+W+ +PLA   D +           HL L  +P   SMGNPHA FFVED    +   S
Sbjct: 122 RLNWQDVPLAAEMDTL-----------HLPLEGDPAAASMGNPHATFFVED----FVRLS 166

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+ L   P+F E  N+  AR+     + L+  ERG G+T ACGS ACA+VV +      
Sbjct: 167 QGHALEHDPLFPERANIGFARIDGPARMRLKVHERGAGVTEACGSGACAAVVNAARRGLI 226

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            R   V++ GG L IEW  NNHV MTG A   +EG +D+
Sbjct: 227 GRVCEVELDGGVLRIEWAANNHVLMTGSATTAFEGTVDL 265


>gi|114328164|ref|YP_745321.1| diaminopimelate epimerase [Granulibacter bethesdensis CGDNIH1]
 gi|122326877|sp|Q0BS04|DAPF_GRABC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|114316338|gb|ABI62398.1| diaminopimelate epimerase [Granulibacter bethesdensis CGDNIH1]
          Length = 275

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 156/282 (55%), Gaps = 14/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDA 62
           ++DF KM G+GN  +V D R       S +  A   D  T    DQ++++     A  DA
Sbjct: 2   LIDFIKMHGLGNDFVVFDARKGPSLALSGSQAAAIADRRTGVGCDQLIVLEPSTVA--DA 59

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           F+RI N DGSE  +CGN  RCV   L  R    +   ET+ G+L+A+ N +G I +DMG+
Sbjct: 60  FMRIYNPDGSESGACGNATRCVADLL-HRDGIAAPCMETVAGLLLAEINGNG-ICIDMGQ 117

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L W+ +PLAR  D +        P+    L+ P   SMGNPHA FFV D L   D+  
Sbjct: 118 PGLGWRDVPLAREMDTL------FLPLEAPGLKMPAACSMGNPHATFFVAD-LAELDIPV 170

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL +HP+F E  N+  A++ S   + LR WERG GLT ACG+ ACA++V +      
Sbjct: 171 TGPLLERHPLFPERANIGHAQMLSRSHIRLRVWERGAGLTLACGTGACATLVNAVRRGLA 230

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKT 283
            R   V++ GG LLI W + + HV MTG A   + G++ +++
Sbjct: 231 EREAVVELDGGQLLIHWREQDGHVLMTGPAATVFHGRIALES 272


>gi|148261481|ref|YP_001235608.1| diaminopimelate epimerase [Acidiphilium cryptum JF-5]
 gi|166224235|sp|A5G1F7|DAPF_ACICJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146403162|gb|ABQ31689.1| diaminopimelate epimerase [Acidiphilium cryptum JF-5]
          Length = 277

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 109/274 (39%), Positives = 142/274 (51%), Gaps = 10/274 (3%)

Query: 8   FAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G GN  +V+D R    D   + A            DQI+LI   +D    AF+RI
Sbjct: 7   FLKMHGAGNDFVVLDARAHPLDLAPAAAARIADRHRGVGCDQIILIE--RDDGAAAFMRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
           +N DGSE  +CGN  RCV   L      +  T  T  G+L A+      + VDMG P L 
Sbjct: 65  LNADGSESGACGNATRCVAALLAGETGARRLTIRTNAGLLPAEIKGPTLVEVDMGAPKLG 124

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA   D +   R  +GPV     +NP   SMGNPHA FFV DDL H  + + G  
Sbjct: 125 WEDIPLAEPADTLSL-RLALGPV-----QNPAACSMGNPHATFFV-DDLTHLQIETIGPK 177

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L    +F E  N+  AR+ + + + LR WERG GLT ACGS ACA++V +       R  
Sbjct: 178 LEHARLFPERANIGFARIDAPDRIRLRVWERGAGLTLACGSGACAALVNAHRRGLAARRA 237

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            ++M GG L + W D+ HV M G     +EG+LD
Sbjct: 238 EIEMDGGTLTLTWRDDGHVLMEGPVALVFEGELD 271


>gi|162148089|ref|YP_001602550.1| diaminopimelate epimerase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786666|emb|CAP56249.1| putative diaminopimelate epimerase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 278

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 142/284 (50%), Gaps = 20/284 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F KM G+GN  +V+D R     +T   I AL+        DQ +++        D  
Sbjct: 1   MTPFHKMHGLGNDFVVVDERAERYGLTPARIAALADRHRGIGCDQFVVLQPATRDGADVL 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +R  N DG+E  +CGN  RCV   L  +  R+    +T  G+L A+ +  G ++VDMG P
Sbjct: 61  VRFFNADGTEAGACGNASRCVAALLWRQEGRRETVLQTRAGLLPARVDDAGVVTVDMGRP 120

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDLAS 182
            LDW+ +PLAR+ D +           HL L  +P   SMGNPHA FF+ DD+   D   
Sbjct: 121 ALDWRDVPLARAADTL-----------HLPLAGDPAAASMGNPHATFFL-DDMLDLDPVV 168

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL   P+F E  N+  A V S   L LR WERG GLT ACGS ACA+VV +      
Sbjct: 169 AGPLLEHDPLFPERANIGFAHVRSRTELRLRVWERGSGLTLACGSGACAAVVNAVRRGLV 228

Query: 243 NRAVSVKMLGGGLLIEWH------DNNHVFMTGEAKKEWEGKLD 280
            R  +V M GG L + W       +  HV MTG A   + G  D
Sbjct: 229 ERTCTVGMDGGALSVSWRAQDDPGEGGHVLMTGPATVSFVGTFD 272


>gi|209542703|ref|YP_002274932.1| Diaminopimelate epimerase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530380|gb|ACI50317.1| Diaminopimelate epimerase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 279

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 142/284 (50%), Gaps = 20/284 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F KM G+GN  +V+D R     +T   I AL+        DQ +++        D  
Sbjct: 2   MTPFHKMHGLGNDFVVVDERAERYGLTPARIAALADRHRGIGCDQFVVLQPATRDGADVL 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +R  N DG+E  +CGN  RCV   L  +  R+    +T  G+L A+ +  G ++VDMG P
Sbjct: 62  VRFFNADGTEAGACGNASRCVAALLWRQEGRRETVLQTRAGLLPARVDDAGVVTVDMGRP 121

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDLAS 182
            LDW+ +PLAR+ D +           HL L  +P   SMGNPHA FF+ DD+   D   
Sbjct: 122 ALDWRDVPLARAADTL-----------HLPLAGDPAAASMGNPHATFFL-DDMLDLDPVV 169

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL   P+F E  N+  A V S   L LR WERG GLT ACGS ACA+VV +      
Sbjct: 170 AGPLLEHDPLFPERANIGFAHVRSRTELRLRVWERGSGLTLACGSGACAAVVNAVRRGLV 229

Query: 243 NRAVSVKMLGGGLLIEWH------DNNHVFMTGEAKKEWEGKLD 280
            R  +V M GG L + W       +  HV MTG A   + G  D
Sbjct: 230 ERTCTVGMDGGALSVSWRAQDDPGEGGHVLMTGPATVSFVGTFD 273


>gi|323137808|ref|ZP_08072883.1| diaminopimelate epimerase [Methylocystis sp. ATCC 49242]
 gi|322396811|gb|EFX99337.1| diaminopimelate epimerase [Methylocystis sp. ATCC 49242]
          Length = 286

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 108/278 (38%), Positives = 150/278 (53%), Gaps = 21/278 (7%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           +M G GN+ILV+D+RG    +      A++      FDQ+M +HD ++   DAF+RI N 
Sbjct: 12  RMNGAGNEILVLDLRGLDHVLAPQEARAIAAAPGLRFDQLMALHDPREKGDDAFMRIYNV 71

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKL 129
           DGS   +CGNG RCV  +  +R  ++     T    +  +   +   +VDMG P LDW+ 
Sbjct: 72  DGSLSGACGNGARCVA-YALARDGKERLRLATDAARIETRREAETVFTVDMGRPRLDWRE 130

Query: 130 IPLARSFDKMDRDRFHIGPVNHLFLRNPFV--------VSMGNPHAIFFVEDDLYHYDLA 181
           IPL+R  D              + L  P          VSMGNPHA+FFV D L    L 
Sbjct: 131 IPLSREAD-----------TRTVALEPPVAGAPTQFSAVSMGNPHAVFFVPDALA-TPLE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  L  HP+F +  N+S A++ +   + LR WERG G T ACGSAACA++VA+     
Sbjct: 179 TLGPKLEHHPLFPQRANISFAQIVARYDILLRVWERGTGATKACGSAACATLVAAARAGF 238

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           T R   V++ GG L IEW D++HV MTG  + E+E  L
Sbjct: 239 TERRARVRLPGGDLHIEWRDDDHVMMTGPVEFEFETML 276


>gi|84514984|ref|ZP_01002347.1| diaminopimelate epimerase [Loktanella vestfoldensis SKA53]
 gi|84511143|gb|EAQ07597.1| diaminopimelate epimerase [Loktanella vestfoldensis SKA53]
          Length = 281

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 150/277 (54%), Gaps = 15/277 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
            + + F KM G+GN  +V+D RG    +T+  + A++       FDQ+ +I D  DA  D
Sbjct: 16  QTFLPFRKMHGLGNDFVVVDERGTTPRVTAALVQAIADRHRGVGFDQLAVISDTPDA--D 73

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
             +   N DGS   +CGN  RC+ R +  +  +++ T  T RG L A +   G  SV+MG
Sbjct: 74  LHLTFWNSDGSTAATCGNATRCIARLVMDQTGQRNLTITTDRGTLQAVDTGGGLTSVNMG 133

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P LDW  IPLA   D +        P++     +P    MGNPH  FFV DD    DLA
Sbjct: 134 QPQLDWHEIPLAEQIDTLQL------PIDG----SPTATGMGNPHCTFFV-DDAEAVDLA 182

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  HP+F +  N+  A +   + L +R WERGVG+T A GS++CA+ VA+     
Sbjct: 183 MRGALIEHHPLFPQRTNVQFASLIGPDHLRMRVWERGVGVTLASGSSSCATAVAAARRGL 242

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           T R V++ + GG L I+W D+  ++MTG     ++G+
Sbjct: 243 TGRKVTITLDGGDLAIDWRDDG-IWMTGATAYVFDGQ 278


>gi|329891138|ref|ZP_08269481.1| diaminopimelate epimerase [Brevundimonas diminuta ATCC 11568]
 gi|328846439|gb|EGF96003.1| diaminopimelate epimerase [Brevundimonas diminuta ATCC 11568]
          Length = 299

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/299 (36%), Positives = 160/299 (53%), Gaps = 27/299 (9%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH---FDQIMLIHDFQD 57
           M      + +M G GN  +V+       + T D + AL+ D  T    FDQ++ +   + 
Sbjct: 5   MSQPARPYIRMNGAGNAFIVVQAFEEPFHPTEDQVRALA-DPATGLGGFDQLIGVEPSET 63

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKE--NRDGS 115
           A  DAF+R+ N DGS V++CGN +RCV   L     ++    +T+ G   A+    R GS
Sbjct: 64  A--DAFMRVWNADGSMVETCGNALRCVGWLLLEATDKEEVVIDTLGGPTTARRAAGRVGS 121

Query: 116 ------------ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMG 163
                       ++VDMG P LDW  +PL+   D    +   +GP++   L  P  VSMG
Sbjct: 122 GDPEGSTAATHQVTVDMGAPRLDWSQVPLSEDMDTRGIE-LQVGPIDAPVLHTPGAVSMG 180

Query: 164 NPHAIFFVE--DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGL 221
           NPH +FF +  DD +   +   G+L+  HP+F EGVN+  A V + + + LR WERG GL
Sbjct: 181 NPHVVFFTDRLDDAF---VRGSGSLVEHHPLFPEGVNVGFADVLARDHIRLRVWERGAGL 237

Query: 222 TAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           T ACG+ ACA++VAS     T+R  +V + GG L I+W + + HVFMTG  + E  G L
Sbjct: 238 TLACGTGACAALVASARRGLTDRKAAVTVDGGELTIDWDEASGHVFMTGPVEVEGTGFL 296


>gi|326404965|ref|YP_004285047.1| diaminopimelate epimerase [Acidiphilium multivorum AIU301]
 gi|325051827|dbj|BAJ82165.1| diaminopimelate epimerase [Acidiphilium multivorum AIU301]
          Length = 277

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 140/274 (51%), Gaps = 10/274 (3%)

Query: 8   FAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G GN  +V+D R    D   + A            DQI+LI    D    AF+RI
Sbjct: 7   FLKMHGAGNDFVVLDARAHPLDLAPAAAARIADRHRGVGCDQIILIE--PDDGAAAFMRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
           +N DGSE  +CGN  RCV   L      +     T  G+L A+      + VDMG P L 
Sbjct: 65  LNADGSESGACGNATRCVAALLAGETGARRLAIRTNAGLLPAEIKGPTLVEVDMGAPKLG 124

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA   D +   R  +GPV     +NP   SMGNPHA FFV DDL H  + + G  
Sbjct: 125 WEDIPLAEPADTLSL-RLALGPV-----QNPAACSMGNPHATFFV-DDLTHLQIETIGPK 177

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L    +F E  N+  AR+ + + + LR WERG GLT ACGS ACA++V +       R  
Sbjct: 178 LEHARLFPERANIGFARIDAPDRIRLRVWERGAGLTLACGSGACAALVNAHRRGLAARRA 237

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            ++M GG L + W D+ HV M G     +EG+LD
Sbjct: 238 EIEMDGGTLTLTWRDDGHVLMEGPVALVFEGELD 271


>gi|254292484|ref|YP_003058507.1| diaminopimelate epimerase [Hirschia baltica ATCC 49814]
 gi|254041015|gb|ACT57810.1| diaminopimelate epimerase [Hirschia baltica ATCC 49814]
          Length = 281

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 106/275 (38%), Positives = 155/275 (56%), Gaps = 9/275 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           + +M G GN   ++D RG    ++++A+  ++   N   DQ++ + +      D F+RI 
Sbjct: 3   YYQMNGCGNAFAILDGRGEKLRLSAEAVRRIAKSANA--DQVVSLENSMRG--DIFMRIW 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKE--NRDGSISVDMGEPIL 125
           N  GSEV +CGN  RCV   +     R +   ET  G+L+A    N D  ISVDMG P+L
Sbjct: 59  NNTGSEVAACGNVSRCVGWIMMRERNRDTIKIETEAGLLIATRHGNGDTMISVDMGSPLL 118

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W+ IPLA   D    D   IGP++  +L+ P  V+MGNPH +FFV D+L   D+   G 
Sbjct: 119 KWEEIPLAERMDTRGID-VKIGPIDAPYLQLPGAVNMGNPHCVFFV-DELDAVDVVGIGP 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  H MF E  N+  A+V   + + LR WER  GLT ACG+ ACA+VVA       NR+
Sbjct: 177 LIEGHMMFPEKANVGFAQVLGRDCIRLRVWERDAGLTKACGTGACAAVVAGVRKGLLNRS 236

Query: 246 VSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            +V + GG L I+W + ++HV MTG  + E + ++
Sbjct: 237 CTVFVDGGDLHIDWREKDDHVIMTGPIELERQAEI 271


>gi|260428165|ref|ZP_05782144.1| diaminopimelate epimerase [Citreicella sp. SE45]
 gi|260422657|gb|EEX15908.1| diaminopimelate epimerase [Citreicella sp. SE45]
          Length = 279

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 150/278 (53%), Gaps = 16/278 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
           S  + F KM G+GN  +V+D R     +T   + A++       FDQ+ LI   +  + D
Sbjct: 8   SDTLPFMKMHGLGNDFVVLDGRAQTMRLTPSLVRAIADRHRGVGFDQLALI---EPGAGD 64

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A +   N DGS   +CGN  RC+ R+L  +  R   T  T RG L+A++   G  SV+MG
Sbjct: 65  ARLTFYNADGSTAGACGNATRCIARYLMDKTGRDRLTLVTERGALLAEDAGAGLTSVNMG 124

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P LDW  IPLAR  D ++       P++      P    MGNPH  FFVED     DL 
Sbjct: 125 QPQLDWHEIPLAREMDTLEL------PIDG----APTATGMGNPHCTFFVED-AEAVDLT 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           SFG +   HP++ E  N+ +A +   + + +R WERG GLT A GS++CA+ VA+     
Sbjct: 174 SFGPVHEHHPLYPERTNVQVASIIGPDHIRMRVWERGAGLTLASGSSSCATAVAAARRGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           T R V++++ GG L ++W ++  V+MTG     ++G  
Sbjct: 234 TGRKVTIELDGGTLQVDWREDG-VWMTGGTAHVFDGSF 270


>gi|197103593|ref|YP_002128970.1| diaminopimelate epimerase [Phenylobacterium zucineum HLK1]
 gi|229813239|sp|B4RCE2|DAPF_PHEZH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|196477013|gb|ACG76541.1| diaminopimelate epimerase [Phenylobacterium zucineum HLK1]
          Length = 277

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 149/276 (53%), Gaps = 12/276 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +V++ R      T+  + A++ D  T    DQ++ +   + A  DA +R
Sbjct: 9   FLKMNGLGNDFVVVETRSAPFEPTAAQVRAIA-DRATGIGCDQLIAVDPAEGA--DAHVR 65

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             N DG EV +CGNG RCV   L     +     ET  G LVA    +  +SVDMG P L
Sbjct: 66  FWNADGEEVGACGNGTRCVGWLLMQSSGKDEAVIETRAGRLVATRAGERLVSVDMGPPRL 125

Query: 126 DWKLIPLARSFD--KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
           +W  IPLA   D   +D   +H    +   +  P  VSMGNPH +FFV D       A  
Sbjct: 126 EWNEIPLAEPHDTRALDVVLYH----HADLMAPPGCVSMGNPHVVFFVPD-AEQAPAAEA 180

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  +  HP+F E VN+  A+V + + + LR WERG GLT ACG+ ACA++VA+       
Sbjct: 181 GPAIEGHPLFPEHVNVGFAQVKAPDRIRLRVWERGAGLTKACGTGACAAMVAASRRGLIG 240

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           R  ++++ GG L +EW  + HV MTG A  +++G+L
Sbjct: 241 RHATMELDGGELFVEWRADGHVIMTGPAAVDFQGEL 276


>gi|154251868|ref|YP_001412692.1| diaminopimelate epimerase [Parvibaculum lavamentivorans DS-1]
 gi|154155818|gb|ABS63035.1| Diaminopimelate epimerase [Parvibaculum lavamentivorans DS-1]
          Length = 293

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 158/282 (56%), Gaps = 10/282 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +V+D+R     + +DAI     D       DQ++ I   +    D F+ 
Sbjct: 8   FLKMNGLGNDFVVLDLR-REPFVLTDAIARAIADREKGIGCDQLITIEPARQGG-DVFMG 65

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I N DG  V++CGN  RC+ + +     + + T ET+ G  VA       I+VDMG P L
Sbjct: 66  IRNHDGGTVEACGNAARCIGKLILDETGKDAVTIETLAGDTVATRAEGDEITVDMGAPRL 125

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPL+  F         IGP+    + +P VV++GNPHA+FFVE D+   DL   G 
Sbjct: 126 DWNQIPLSEEFQDTRAIELEIGPLGAPIMHSPGVVNVGNPHAVFFVE-DVDAIDLERSGP 184

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  HP+F E  N+S+A+V S   + +RTWERG GLT ACG+AACA+ VA+    KT R 
Sbjct: 185 MLEHHPLFPERANISVAKVLSPTHIRIRTWERGAGLTRACGTAACAATVAAIRRRKTERK 244

Query: 246 VSVKMLGGGLLIEW--HDNN---HVFMTGEAKKEWEGKLDIK 282
           ++V + GG L +EW   D N   HV MTG    ++EG LD +
Sbjct: 245 ITVTLPGGDLTVEWLPDDENGYGHVLMTGPVAFDYEGTLDPR 286


>gi|304320387|ref|YP_003854030.1| diaminopimelate epimerase [Parvularcula bermudensis HTCC2503]
 gi|303299289|gb|ADM08888.1| diaminopimelate epimerase [Parvularcula bermudensis HTCC2503]
          Length = 282

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 151/272 (55%), Gaps = 9/272 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIM-LIHDFQDASVDAFIRIIN 68
           M+GIGN  +++D+RG    +  DA   L+   +    DQ++ L+ + + A+    + I N
Sbjct: 17  MDGIGNAFIIVDLRG-GGTLGEDAARGLAEAAEGVRIDQVIGLVAEGEGAA----MTIFN 71

Query: 69  CDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWK 128
            DGS   +CGN  RC+   L          F T  G + A    D  ++VDMG P L W+
Sbjct: 72  RDGSVAGACGNAARCIAWRLMEEQGTDEVIFGTPAGSVTATRAGDHRVTVDMGAPRLGWQ 131

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLA + +        +GP+++  L  P  VSMGNPH +FFVED +    L  FG L+ 
Sbjct: 132 DIPLAEACEDTRFLDIKVGPIDNPVLWGPSAVSMGNPHCVFFVED-VAAQRLDRFGPLIE 190

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
            HP+F EG N+S+A V     + LRTWERG GLT ACG+AACA++V++    +T R   V
Sbjct: 191 NHPLFPEGANVSVAEVPDPHHIRLRTWERGAGLTQACGTAACAALVSAVRRRRTGRRADV 250

Query: 249 KMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            + GG L I W + ++HV MTG+ +    G+L
Sbjct: 251 TLPGGTLDISWREADDHVLMTGDIRALRTGRL 282


>gi|254418556|ref|ZP_05032280.1| diaminopimelate epimerase [Brevundimonas sp. BAL3]
 gi|196184733|gb|EDX79709.1| diaminopimelate epimerase [Brevundimonas sp. BAL3]
          Length = 279

 Score =  178 bits (451), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 150/276 (54%), Gaps = 10/276 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH-FDQIMLIHDFQDASVDAFIRI 66
           F KM G GN  +VID        T D I AL+   +   FDQ++ I   + A  DAF+R+
Sbjct: 8   FIKMNGAGNDFIVIDALETPFRPTEDQIRALADRASGEGFDQLIAIEPSETA--DAFMRV 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS V++CGN +RCV   L         T +T  G   A    D  ++VDMG P LD
Sbjct: 66  WNADGSMVETCGNALRCVGWLLMEAGGGDRVTIDTAAGPTTATRAGDRRVTVDMGRPRLD 125

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV--EDDLYHYDLASFG 184
           W  +PLA   D    +   +GP++   L  P  VSMGNPH +FF   +DD +   +   G
Sbjct: 126 WTQVPLAEEMDTRGIE-LQVGPIDAPLLHTPGAVSMGNPHVVFFTDRQDDGF---VTGSG 181

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
           +L+  HP+F EGVN+  A V   + + LR WERG GLT ACG+ ACA+ VA+     T+R
Sbjct: 182 SLVEHHPLFPEGVNVGFAHVLDRDHIRLRVWERGAGLTKACGTGACAAQVAAARRGLTDR 241

Query: 245 AVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
             +V + GG L+I+W    +HV MTG  + E  G L
Sbjct: 242 KATVVVDGGELVIDWDPATDHVLMTGPVEIERTGAL 277


>gi|296532249|ref|ZP_06894993.1| diaminopimelate epimerase [Roseomonas cervicalis ATCC 49957]
 gi|296267419|gb|EFH13300.1| diaminopimelate epimerase [Roseomonas cervicalis ATCC 49957]
          Length = 276

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 143/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D R     ++   I ALS        DQ + + +  +A  D F
Sbjct: 1   MIPFRKMHGLGNDFIVVDARPAPLPLSPTRIAALSDRHRGIGCDQFITL-ERPEAGADVF 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSE ++CGN  RCV   L +   R      T+RG L  +    G+I  DMG P
Sbjct: 60  MRIHNPDGSEAEACGNATRCVAWLLMAETGRDHVVVRTVRGDLPCERLAGGTIRADMGPP 119

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W+ +PLA + D       H+ P++   + +P   SMGNPHA FFVE  L   D  + 
Sbjct: 120 SLAWQEVPLAEAMDTT-----HL-PIDLGAVADPAACSMGNPHATFFVE-TLEGLDWQAL 172

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L   HP+  +  N+  A V S E + L  WERG G T ACGS ACA++V +       
Sbjct: 173 GPLAEHHPLLPQRANIGFAEVVSPEHIRLAIWERGAGPTLACGSGACATLVNAHRRGLAG 232

Query: 244 RAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIKT 283
           R   + + GG L +EW   +NHV M G     + G+ D  T
Sbjct: 233 RRARIDLPGGPLELEWRLSDNHVLMGGPVATAFLGQFDPDT 273


>gi|326388654|ref|ZP_08210247.1| diaminopimelate epimerase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206905|gb|EGD57729.1| diaminopimelate epimerase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 269

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 107/275 (38%), Positives = 148/275 (53%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R     +++    AL+        DQ++L+   + A  D  +
Sbjct: 3   IPFRKMHGLGNDFVVIDARERAVEMSARRAAALADRHTGIGCDQLILLEPSETA--DVRM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           RI N DG EV++CGN  R V  +L    +      ET+ GI+ A  + D  ISV MG P 
Sbjct: 61  RIFNPDGGEVEACGNASRAVGLYLGGDKR-----IETLGGIIAASTS-DTGISVAMGRPR 114

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             W  IPLA   D +        PV    L  P  V++GNPH IFFV D  +  DLA  G
Sbjct: 115 FGWDEIPLAYPMDTLTM------PVGWEDLVEPVAVNVGNPHVIFFVPDT-HSVDLARLG 167

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+   P+F   +N+++A +T  ++LDLR WER  GLT ACG+ ACAS +A+     T R
Sbjct: 168 PLIENDPLFPRRINVNVATLTGPDALDLRVWERAAGLTRACGTGACASAIAAMRRKLTGR 227

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V+V + GG L+IEW D + + MTG A   +EG  
Sbjct: 228 RVTVTLPGGPLVIEWTDADEIIMTGPATTSFEGSF 262


>gi|126734339|ref|ZP_01750086.1| Diaminopimelate epimerase [Roseobacter sp. CCS2]
 gi|126717205|gb|EBA14069.1| Diaminopimelate epimerase [Roseobacter sp. CCS2]
          Length = 281

 Score =  175 bits (444), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 152/279 (54%), Gaps = 19/279 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDAS 59
           SS + F KM G+GN  +V+D RG    +  D   A++  D      FDQ+ ++ +  DA 
Sbjct: 15  SSFLPFMKMHGLGNDFVVVDERGITPRV--DKAVAVAIADRHRGVGFDQLAVMSETPDA- 71

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
            D  +   N DGS+  +CGN  RC+ R +  +    + T +T RGIL AK+  +G  SV+
Sbjct: 72  -DVRLVFWNSDGSQAGACGNATRCIARHVMDQTGAAALTLKTERGILQAKDAGNGLTSVN 130

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG+P LDW+ +PLA + D ++       P+       P    MGNPH  FFV D     D
Sbjct: 131 MGQPQLDWQHVPLAHAMDTLEL------PIKGA----PTATGMGNPHCTFFVYD-AEAID 179

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           LA+ G  L  HP++ E  N+  A +     L +R WERGVG+T A GS++CA+ VA+   
Sbjct: 180 LATKGAELEHHPLYPERTNVQFASLIGPNHLRMRVWERGVGITLASGSSSCATAVAAARR 239

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
             T+R V++ + GG L I W D+  V+MTG     ++G+
Sbjct: 240 GLTDRDVTIDLDGGTLQISWRDDG-VWMTGPTAHVFDGQ 277


>gi|330993222|ref|ZP_08317159.1| Diaminopimelate epimerase [Gluconacetobacter sp. SXCC-1]
 gi|329759773|gb|EGG76280.1| Diaminopimelate epimerase [Gluconacetobacter sp. SXCC-1]
          Length = 274

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 140/279 (50%), Gaps = 17/279 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDA 62
           M  F KM G+GN  +V+D R    ++T   I AL  D +T    DQ + +        D 
Sbjct: 2   MTGFLKMHGLGNDFVVVDERTHRHDLTPARIAALC-DRHTGIGCDQFVTLRPACAEGADV 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           F+R  N DGSE  +CGN  RCV   +     R     +T  G+L A   R G ++VDMG 
Sbjct: 61  FVRFFNADGSESGACGNASRCVADLVARESGRAQVGLQTRAGVLSATLVRPGVVTVDMGV 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P   W  +PLA + D +           HL +  +P  VSMGNPHA FF+       D  
Sbjct: 121 PAQGWADVPLAEAMDTL-----------HLPMAGDPAAVSMGNPHATFFLPAP-DGMDPC 168

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  HP+F +  N+  A VTS  S+ LR WERG GLT ACGS ACA+VV +     
Sbjct: 169 VAGPELEHHPLFPQRANIGFAHVTSRGSMRLRVWERGSGLTRACGSGACAAVVNAVRRGL 228

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            +R  +V+M GG L I W  D+ HV MTG A   + G  
Sbjct: 229 VDRTCTVEMDGGKLEITWRGDDGHVLMTGPATTSFTGTF 267


>gi|167648823|ref|YP_001686486.1| diaminopimelate epimerase [Caulobacter sp. K31]
 gi|189082829|sp|B0T542|DAPF_CAUSK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167351253|gb|ABZ73988.1| Diaminopimelate epimerase [Caulobacter sp. K31]
          Length = 289

 Score =  174 bits (442), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 153/283 (54%), Gaps = 9/283 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH-------FDQIMLIHDFQDASV 60
           F KM G+GN  +VI+      + T++ I A++   N          DQ++ I   +    
Sbjct: 5   FLKMNGLGNDFVVIETLTQPFHPTAEEIRAIAKRPNAKEGEGGIGCDQVIAIDPPRAEGA 64

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
            A++R  N DG E  +CGNG RCV   L    ++ S  F+T+ G L  K   D  ++VDM
Sbjct: 65  SAYVRFWNSDGEETGACGNGTRCVAWLLMQSGQKDSVAFDTVAGRLSGKMAGDKLVTVDM 124

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P L W  IPLA   D +  +   +GP++   +  P  VSMGNPH +FFV+  +     
Sbjct: 125 GQPGLAWNQIPLAEEMDTVGIE-LQVGPIDAPLVHTPGCVSMGNPHVVFFVDAPVSDAFA 183

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  HP+F EGVN+  A + + + + L+ WERG GLTAACG+ ACA+ VA+    
Sbjct: 184 RGTGSLVEHHPLFPEGVNVGFAHIAARDHIKLKVWERGAGLTAACGTGACAAQVAAVRRG 243

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
            T+R   V+   G L IEW + + HV MTG    E+ GKL  K
Sbjct: 244 LTDRVAKVEFESGALTIEWREADGHVIMTGPVTMEFVGKLPEK 286


>gi|89067276|ref|ZP_01154789.1| diaminopimelate epimerase [Oceanicola granulosus HTCC2516]
 gi|89046845|gb|EAR52899.1| diaminopimelate epimerase [Oceanicola granulosus HTCC2516]
          Length = 284

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/277 (37%), Positives = 145/277 (52%), Gaps = 18/277 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
            S + F KM G+GN  +V+D R  H    +D I A++       +DQ+ +I    DA  D
Sbjct: 20  PSRLPFMKMHGLGNDFVVLDRRDGHAMPGADVIRAMADRRRGVGYDQLAVIEGAADA--D 77

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A +   N DGS+  +CGN  RC+   L     R      T RG L A E   G ++V+MG
Sbjct: 78  ARLTFWNSDGSQSAACGNATRCIAAHLMDETGRDDLALVTARGRLAA-ERHGGVVAVNMG 136

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDL 180
            P  DW+ +PLAR  D +           HL +  +P    MGNPH  FFVED     DL
Sbjct: 137 APSTDWQGVPLAREVDTL-----------HLPIPGDPVATGMGNPHCTFFVED-AESVDL 184

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           ASFG     HP+F E  N+ +A+V     + +R WERGVG+T A GS++CA+ VA+    
Sbjct: 185 ASFGAEHEHHPLFPERTNVQLAQVLDRARIRMRVWERGVGITEASGSSSCATAVAAARRG 244

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
            T R V+V + GG L I+W D+  V+M G     ++G
Sbjct: 245 LTERRVTVLLDGGELEIDWRDDG-VWMAGPTAHVFDG 280


>gi|295691528|ref|YP_003595221.1| diaminopimelate epimerase [Caulobacter segnis ATCC 21756]
 gi|295433431|gb|ADG12603.1| diaminopimelate epimerase [Caulobacter segnis ATCC 21756]
          Length = 284

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 149/275 (54%), Gaps = 4/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALST--DDNTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +V+     +   T + I A++   D     DQ++ I   +     A++R
Sbjct: 5   FLKMNGLGNDFVVVQTLTQNFEPTPEEIRAIAKRGDGGIGCDQVIAIDPPKAEGASAYVR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             N DG E  +CGNG RCV   L     +    F+T+ G L      +  ++VDMG P L
Sbjct: 65  FWNSDGEETGACGNGTRCVAWLLMQSAGKTEVAFDTVAGRLSGVAAGEKLVTVDMGPPRL 124

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           +W  IPLA + D   R    +GP++  ++  P  VSMGNPH +FFV+  +        G+
Sbjct: 125 EWSQIPLAEAMDTA-RVELQVGPIDAPWVHTPVCVSMGNPHVVFFVDAPVSDEFATKTGS 183

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  HP+F EGVN+  A V S + + L+ WERG GLTAACG+ ACA+ VA+     T+R 
Sbjct: 184 LVEHHPLFPEGVNVGFAHVESRDHIRLKVWERGAGLTAACGTGACAAQVAAVRRGLTDRK 243

Query: 246 VSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
             V+   G L IEW +++ HV MTG    ++ GKL
Sbjct: 244 AKVEFESGALTIEWRESDGHVIMTGPVSMDFAGKL 278


>gi|126730998|ref|ZP_01746807.1| diaminopimelate epimerase [Sagittula stellata E-37]
 gi|126708714|gb|EBA07771.1| diaminopimelate epimerase [Sagittula stellata E-37]
          Length = 279

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 152/287 (52%), Gaps = 18/287 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASV 60
           +++ + F KM G+GN  +VID R     +T + A+          FDQ+ LI    +A  
Sbjct: 8   RATGLPFMKMHGLGNDFVVIDARARSVQVTPELAMRLADRHMGVGFDQLALIEPGGNA-- 65

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DA +  +N DGS   +CGN  RC+ R L +   +      T  G L A +  +G  SV+M
Sbjct: 66  DAHLVFLNSDGSTSAACGNATRCIARHLMTETGKDRLVLTTDHGALQAVDTGNGMTSVNM 125

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P+LDW+ IPLA   D +     H+ P++     +P   SMGNPH  FFV D     DL
Sbjct: 126 GPPVLDWQNIPLASEVDTL-----HL-PID----GDPVATSMGNPHCTFFVAD-AEAVDL 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
             FG  +  HP++ +  N+ +A +   + L +R WERG GLT A GS++CA+ VA+    
Sbjct: 175 TDFGPRIEHHPLYPQRTNVQVATLIGPDHLRMRVWERGAGLTLASGSSSCATAVAAARRG 234

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWI 287
            T RAV + + GG L ++W ++  V+MTG     + G L   T +W+
Sbjct: 235 LTGRAVHIDLDGGTLHVDWREDG-VWMTGPTSHVFTGTL---TAEWL 277


>gi|94495526|ref|ZP_01302106.1| diaminopimelate epimerase [Sphingomonas sp. SKA58]
 gi|94424914|gb|EAT09935.1| diaminopimelate epimerase [Sphingomonas sp. SKA58]
          Length = 266

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/277 (38%), Positives = 149/277 (53%), Gaps = 16/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F+KM G+GN  +VID R     +T     A++        DQ+++I D  DA V   
Sbjct: 1   MGRFSKMHGLGNDFVVIDARAAPVAMTEARARAIADRHAGIGCDQLIVIGDAPDADVS-- 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           ++I N DGSEV++CGN  RCV  F+         T  T  G+L A+   DG  SVDMG P
Sbjct: 59  MQIFNADGSEVEACGNATRCVPLFIG-----HDVTIRTRAGLLDARLI-DGGASVDMGAP 112

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             DW  IPLA + D +        P +   L  P  V++GNPH IFFV DDL   D A  
Sbjct: 113 RFDWNAIPLAYAMDTLTM------PASWEDLPAPAAVNVGNPHVIFFV-DDLDAVDTARL 165

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G ++ + P+F + VN++ A+V     + L  WERG GLT ACG+ ACA+ VA+      +
Sbjct: 166 GPMIEQDPLFPQRVNVNFAQVVGENHIRLIVWERGAGLTRACGTGACATAVAAIRRKLAH 225

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             V+V + GG L+I+W     + MTG A   ++G+ D
Sbjct: 226 GPVTVTLPGGDLVIDWRPGGTIQMTGPATHVFDGEAD 262


>gi|326204224|ref|ZP_08194084.1| diaminopimelate epimerase [Clostridium papyrosolvens DSM 2782]
 gi|325985735|gb|EGD46571.1| diaminopimelate epimerase [Clostridium papyrosolvens DSM 2782]
          Length = 277

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 156/285 (54%), Gaps = 21/285 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+G+GN  + +D   C  NI  +         + HF    D ++LI   +    D  
Sbjct: 3   FTKMQGLGNDYIYVD---CTKNIIDNPSVVSKKVSDRHFGIGSDGLVLI--MKSDIADFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGI----LVAKENRDGSIS 117
           +R+ N DGSE + CGN +RCV +++       +K+ T ET+ GI    L  ++N+   + 
Sbjct: 58  MRMFNSDGSESEMCGNAIRCVGKYVFDNGLTDKKNLTIETLAGIKVLDLKIEDNKVVQVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL+ K IP+    D+   +   +   N+        VSMGNPHAI +V DD   
Sbjct: 118 VDMGEPILESKQIPVDSEKDRFISESVEVDGYNYKVT----AVSMGNPHAITYV-DDTAS 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + L   G  +  H +F + +N     V    +L +R WERG G T ACG+ A A +VAS 
Sbjct: 173 FPLYEVGPKMETHKLFPKKINAEFVEVIDRTTLKMRVWERGAGETLACGTGASAVLVASV 232

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               + RA ++K+LGG L+IEW + +NHV+MTG A+K +EG+++I
Sbjct: 233 LNGLSERAATIKLLGGDLIIEWSEKDNHVYMTGPAEKVFEGEIEI 277


>gi|83592519|ref|YP_426271.1| diaminopimelate epimerase [Rhodospirillum rubrum ATCC 11170]
 gi|83575433|gb|ABC21984.1| diaminopimelate epimerase [Rhodospirillum rubrum ATCC 11170]
          Length = 280

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 153/284 (53%), Gaps = 17/284 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +VID R    ++T + + AL+        DQ + I   +   V AF+ +
Sbjct: 8   FLKMHGLGNDFIVIDARTRPLDLTPERVRALADRHSGVGCDQFVTIEPARGGGV-AFMGL 66

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DG  V+SCGN  RCV R L    + +S   ET+ G++ A+      I VDMG   L 
Sbjct: 67  RNADGEIVESCGNASRCVGRLLLEEREAESVLIETLGGMVEARRASGELIEVDMGPARLT 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA + D +  +   +GP     L +P  VSMGNPHA+FFV DD    DLA++G L
Sbjct: 127 WQEIPLAGAADTLHIE-LSVGP-----LSDPCAVSMGNPHAVFFV-DDADAIDLATWGPL 179

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLHKTN 243
           +  H +F    N+    + +   L +R WERGVG+T ACG+ ACAS VA+   G +    
Sbjct: 180 IEHHGLFPNRTNVEAVHLRADGRLRMRVWERGVGITRACGTGACASAVAAMRRGLI--AG 237

Query: 244 RAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKTGKW 286
           R   V + GG L I W +++ HV MTG A   + G LD   G W
Sbjct: 238 RTAEVVLDGGTLGIVWRESDGHVLMTGSATLAYSGVLD--EGAW 279


>gi|126727810|ref|ZP_01743640.1| Diaminopimelate epimerase [Rhodobacterales bacterium HTCC2150]
 gi|126702937|gb|EBA02040.1| Diaminopimelate epimerase [Rhodobacterales bacterium HTCC2150]
          Length = 278

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 104/274 (37%), Positives = 148/274 (54%), Gaps = 18/274 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +VID RG    +T     AL   +    FDQ+  I D    + D  +  
Sbjct: 12  FMKMHGLGNDFVVIDSRGRDAVVTEKLARALGDRNRGVGFDQLAEIRD--GVTSDVILDF 69

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS   +CGN  RCV  FL  +      +  T RG+L AK + D  +S++MG P LD
Sbjct: 70  WNSDGSRAGACGNATRCVSEFLMRQAGTGELSLTTERGLLRAKWSGD-LVSINMGLPQLD 128

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           W+ +PLAR             PV+HL +  +P  V MGNPH +FFV DD+   D A  G 
Sbjct: 129 WQDVPLARDV-----------PVDHLPIDGDPVAVGMGNPHCVFFV-DDIADVDPAIAGP 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            +  H +F E  N+  A+V S + + +R WERG G+T ACGS ACA+ VA+     T++ 
Sbjct: 177 PIENHELFPERCNVEFAQVRSRDEIRMRVWERGTGITLACGSGACATAVAAHLRGLTDKC 236

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           V +++ GG L ++W D+  V+MTG     ++ +L
Sbjct: 237 VRMEVDGGWLTLDWRDDG-VWMTGPTAHVFDARL 269


>gi|163745242|ref|ZP_02152602.1| diaminopimelate epimerase [Oceanibulbus indolifex HEL-45]
 gi|161382060|gb|EDQ06469.1| diaminopimelate epimerase [Oceanibulbus indolifex HEL-45]
          Length = 277

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 143/280 (51%), Gaps = 18/280 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASV 60
           Q+  + F KM G+GN  +V+D R    N++     A+        FDQ+ +I      + 
Sbjct: 5   QTPGLPFMKMHGLGNDFVVLDARAEAINVSPAMAQAIGHRQFGVGFDQLAVI---TQGAG 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DA +   N DGS   +CGN  RC+ RFL     R S    T RG L AK+  +G  SV+M
Sbjct: 62  DAQLTFYNSDGSLSAACGNATRCIARFLMDETGRDSLHLTTARGDLAAKDAGNGLTSVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYD 179
           G P L W  +PLAR  D +           HL +  +P    MGNPH  FFV+D +   D
Sbjct: 122 GHPQLKWDEVPLAREMDTL-----------HLPIEGDPVAAGMGNPHCTFFVKD-VEAVD 169

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L+  G      P+F E  N+ +A++     + +R WERGVG+T A GS++CA+ VA+   
Sbjct: 170 LSDIGPRAEHDPLFPERTNVQVAQIVGPNHIRMRVWERGVGVTLASGSSSCATAVAAARR 229

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             T RAV + + GG L I+W D+  V+MTG     + G  
Sbjct: 230 GLTGRAVRIDLDGGTLHIDWRDDG-VWMTGPTMHVFSGTF 268


>gi|114766737|ref|ZP_01445675.1| diaminopimelate epimerase [Pelagibaca bermudensis HTCC2601]
 gi|114541056|gb|EAU44112.1| diaminopimelate epimerase [Roseovarius sp. HTCC2601]
          Length = 279

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 143/275 (52%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     +T     A++       FDQ+ LI   +    DA +
Sbjct: 11  LSFMKMHGLGNDFVVLDGRARRITVTPGLARAIADRHRGVGFDQLALI---ETGEGDARL 67

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL     +   T  T RG L A++  DG  SV+MG P 
Sbjct: 68  TFYNADGSTAGACGNATRCIARFLMDESGKDRLTLVTERGKLFAQDAGDGLTSVNMGHPQ 127

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   D +        P+       P    MGNPH  FFVE+     DL +FG
Sbjct: 128 LDWQDIPLASEMDTLAL------PIEG----TPVATGMGNPHCTFFVEN-AEAIDLEAFG 176

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  N+ +A +   + L +R WERGVG+T + GS++CA+ VA+     T R
Sbjct: 177 PRFEHHPLYPQRTNVQVASLIGPDHLRMRVWERGVGVTLSSGSSSCATAVAAARRGLTGR 236

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V++++ GG L I+W D+  V+MTG     ++G  
Sbjct: 237 KVTLELDGGTLQIDWRDDG-VWMTGATAHVFDGSF 270


>gi|297617036|ref|YP_003702195.1| diaminopimelate epimerase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144873|gb|ADI01630.1| diaminopimelate epimerase [Syntrophothermus lipocalidus DSM 12680]
          Length = 282

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 158/293 (53%), Gaps = 33/293 (11%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +VI+      +    +  A+   D  HF    D ++++   +D  +D F
Sbjct: 3   FTKMHGLGNDFIVIEAEKSELSPEDYSRTAIKLCDR-HFGIGGDGLVIVG--KDRELDVF 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +RI N DGSE + CGN +RCV +F+  R  +     +  T+ G     ++ K      + 
Sbjct: 60  MRIFNPDGSEPEMCGNAIRCVSKFVWERGLVSTTRISVNTLAGPRYPEVILKNGEVEKVR 119

Query: 118 VDMGEPILDWKLIPLARSFDKM-------DRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           VDMGEPIL+  LIP+  S  K+          RF I             VSMGNPH + F
Sbjct: 120 VDMGEPILERSLIPMLGSPGKVVGEELDTTAGRFRI-----------TAVSMGNPHCVVF 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V D+     ++ +G +L  HP+F    N+  A++    ++ +R WERG G T ACG+ AC
Sbjct: 169 V-DEFSSVPVSEWGPVLENHPVFPSRTNVEFAKIEDENTVSMRVWERGAGETLACGTGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
           A++VAS     T R  +V++ GG L+IEW  DNNHV+MTGEAK+ + G++D++
Sbjct: 228 ATLVASYLNDLTGRRATVRLKGGELIIEWDPDNNHVYMTGEAKEVFTGEVDLR 280


>gi|294012736|ref|YP_003546196.1| diaminopimelate epimerase [Sphingobium japonicum UT26S]
 gi|292676066|dbj|BAI97584.1| diaminopimelate epimerase [Sphingobium japonicum UT26S]
          Length = 266

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 150/277 (54%), Gaps = 16/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F+KM G+GN  +VID R    ++T     A++        DQ++LI +   A  D  
Sbjct: 1   MGRFSKMHGLGNDFVVIDARESTLDMTEARAMAIADRHAGIGCDQLILIGNSDRA--DVS 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSEV++CGN  RCV  F+      +    ET  G+L AK   DG  SVDMG+P
Sbjct: 59  MRIFNSDGSEVEACGNATRCVPLFVG-----RDVLIETKAGLLDAKA-VDGGASVDMGQP 112

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L+W  IPLA + D +        PV+   L  P  V++GNPH IFF+ DDL   +    
Sbjct: 113 RLEWDAIPLAYAMDTLTM------PVSWEDLPAPVAVNVGNPHVIFFL-DDLDGVNFDRL 165

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+   P+F   VN++ A++     + L  WERG GLT ACG+ ACA+ VA+      +
Sbjct: 166 GPLIEHDPLFPARVNVNFAQIAGNNHIRLVVWERGAGLTRACGTGACATAVAAVRRKLAS 225

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              +V + GG L+I+W    H+ MTG A   ++G+ D
Sbjct: 226 GPTTVSLPGGDLVIDWTPGGHIMMTGPATHVFDGEAD 262


>gi|85373610|ref|YP_457672.1| diaminopimelate epimerase [Erythrobacter litoralis HTCC2594]
 gi|122544848|sp|Q2NBR6|DAPF_ERYLH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|84786693|gb|ABC62875.1| diaminopimelate epimerase [Erythrobacter litoralis HTCC2594]
          Length = 269

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 105/278 (37%), Positives = 150/278 (53%), Gaps = 19/278 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDA 62
           V F KM G+GN  +++D R      +T+    AL+ D  T    DQ++L+      S D 
Sbjct: 3   VSFTKMHGLGNDFIMLDARAESLPPMTAATARALA-DRKTGIGCDQVILLEPSD--SADF 59

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +RI N DG EV++CGN  R V     + +  ++   ET  G+ +A     G   VDMG 
Sbjct: 60  RMRIFNADGGEVEACGNASRAV-----ALLHGEAANVETSGGV-IAIAPASGGARVDMGV 113

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  DW+ IPLA + D +        PV    L  P  V++GNPH +FFV DD     L +
Sbjct: 114 PRFDWEAIPLAYAMDTLSL------PVGWGELEAPAAVNVGNPHVVFFV-DDADAVPLDT 166

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +   P+F E +N++IA +T  ++L L  WERGVGLT ACG+ ACA+ +A+     T
Sbjct: 167 MGPGIETDPLFPERINVNIASLTGDDALKLHVWERGVGLTRACGTGACATAIAAMRRGLT 226

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            R V+V + GG L IEW  ++H+ MTG A + + G  D
Sbjct: 227 GRKVAVTLPGGTLQIEWDADDHIIMTGPAAESFRGTFD 264


>gi|127511257|ref|YP_001092454.1| diaminopimelate epimerase [Shewanella loihica PV-4]
 gi|166225756|sp|A3Q9P7|DAPF_SHELP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|126636552|gb|ABO22195.1| diaminopimelate epimerase [Shewanella loihica PV-4]
          Length = 279

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 152/283 (53%), Gaps = 12/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIHFTKMHGLGNDFMVVD--GVTQNVYFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+ S+  + ++     T  G +  +  RDGS++V+
Sbjct: 59  FHYRIFNADGSEVEQCGNGARCFARFVKSKGLINKQKIKVSTSSGKMTLRLERDGSVTVN 118

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG P+L+   IP  A+  +K    +  +      FL     VSMGNPH +  V DD+ + 
Sbjct: 119 MGIPVLEPSRIPFNAKKAEKTYLLQADMPEGMQTFLCG--AVSMGNPHCVLEV-DDVANA 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G+LL KH  F +GVN+   +V     + LR +ERG   T ACGS ACA+V     
Sbjct: 176 DVERIGSLLTKHERFPKGVNVGFMQVVDANHIKLRVYERGAAETLACGSGACAAVAVGQL 235

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
             K  R V V + GG L I W  +   ++MTG A+  ++G++ 
Sbjct: 236 QGKLARRVRVDLPGGSLTINWEGEGKPLWMTGPAEHVYDGQIQ 278


>gi|261405790|ref|YP_003242031.1| diaminopimelate epimerase [Paenibacillus sp. Y412MC10]
 gi|261282253|gb|ACX64224.1| diaminopimelate epimerase [Paenibacillus sp. Y412MC10]
          Length = 279

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 158/288 (54%), Gaps = 20/288 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIM---LIHDFQDASVD 61
           M++F KM G+GN  +V+        + SDA + L+      F  I    L++    A  D
Sbjct: 1   MMEFTKMHGLGNDFVVVY---GERELPSDA-SELAVKLCNRFFGIGADGLVYILPSAKAD 56

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETI-RGI----LVAKENRDG 114
             +RI+N DGSE + CGN +RCV +++     + R+  T ETI  G+    L  ++ +  
Sbjct: 57  FMMRIMNSDGSEAEQCGNAIRCVAKYVYDHGHIDREEITIETIGAGVQQVRLTVQDGQVS 116

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           S+ VDMGEP+L+   +P     + +      +      F      VSMGNPH + +V DD
Sbjct: 117 SVRVDMGEPVLNGLSVPTLVDLNPVVNHPVEVDGREFRFT----AVSMGNPHCVIYV-DD 171

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
             ++DL  +G  L  HP+F   +N+  A V S   +D+R WERG G T ACG+ ACA++V
Sbjct: 172 AVNFDLGVWGPKLEVHPLFPRKINVEFATVNSRGQVDMRVWERGAGPTLACGTGACATLV 231

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +S     T+R+ ++ + GG L IEW + +NHV+MTG A+  ++GKL I
Sbjct: 232 SSVLNGATDRSATISLKGGDLFIEWDELDNHVYMTGPAEVVYKGKLAI 279


>gi|254512917|ref|ZP_05124983.1| diaminopimelate epimerase [Rhodobacteraceae bacterium KLH11]
 gi|221532916|gb|EEE35911.1| diaminopimelate epimerase [Rhodobacteraceae bacterium KLH11]
          Length = 280

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 141/275 (51%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +++D R     IT      +        FDQ+ +I   Q    DA +
Sbjct: 12  LPFMKMHGLGNDFVIVDARAHTVPITPAMARGIGHRRFGVGFDQLAVIEQGQ---ADAHL 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL +   + +    T RG L+A++  DG  S++MG+P 
Sbjct: 69  VFYNADGSTSAACGNATRCIARFLMNESGKSNLALTTERGTLLARDAGDGLTSINMGQPQ 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   + ++       P+       P    MGNPH  FFV D      L  FG
Sbjct: 129 LDWQEIPLAEDVNTLEL------PIEG----GPTATGMGNPHCTFFVVD-AEAIPLEEFG 177

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A+VT  + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 178 ARYEYHPLYPERTNVQVAQVTGPDRIRMRVWERGVGITLASGSSSCATAVAAARRGLTGR 237

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG + I+W D+  V+MTG       G L
Sbjct: 238 EVQIDLDGGTIWIDWRDDG-VWMTGPTCHVLSGTL 271


>gi|329926558|ref|ZP_08280971.1| diaminopimelate epimerase [Paenibacillus sp. HGF5]
 gi|328939099|gb|EGG35462.1| diaminopimelate epimerase [Paenibacillus sp. HGF5]
          Length = 286

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 158/288 (54%), Gaps = 20/288 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIM---LIHDFQDASVD 61
           M++F KM G+GN  +V+        + SDA + L+      F  I    L++    A  D
Sbjct: 8   MMEFTKMHGLGNDFVVVY---GERELPSDA-SELAVKLCNRFFGIGADGLVYILPSAKAD 63

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETI-RGI----LVAKENRDG 114
             +RI+N DGSE + CGN +RCV +++     + R+  T ETI  G+    L  ++ +  
Sbjct: 64  FMMRIMNSDGSEAEQCGNAIRCVAKYVYDHGHIDREEITIETIGAGVQQVRLTVQDGQVS 123

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           S+ VDMGEP+L+   +P     + +      +      F      VSMGNPH + +V DD
Sbjct: 124 SVRVDMGEPVLNGLSVPTLVDLNPVVNHPVEVEGREFRFT----AVSMGNPHCVIYV-DD 178

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
             ++DL  +G  L  HP+F   +N+  A V S   +D+R WERG G T ACG+ ACA++V
Sbjct: 179 AVNFDLGVWGPKLEVHPLFPRKINVEFATVNSRGQVDMRVWERGAGPTLACGTGACATLV 238

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +S     T+R+ ++ + GG L IEW + +NHV+MTG A+  ++GKL I
Sbjct: 239 SSVLNGATDRSATISLKGGDLFIEWDELDNHVYMTGPAEVVYKGKLAI 286


>gi|87199423|ref|YP_496680.1| diaminopimelate epimerase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135104|gb|ABD25846.1| diaminopimelate epimerase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 275

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 107/276 (38%), Positives = 148/276 (53%), Gaps = 16/276 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN-THFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R    ++T+    AL+        DQ++++     A  D  +
Sbjct: 9   IPFRKMHGLGNDFVVIDAREAAVSMTAARAAALADRRTGIGCDQLIVLEPSDVA--DVRM 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           RI N DGSEV++CGN  R V   L       +   ET+ G L+  E R   +SVDMG P 
Sbjct: 67  RIFNNDGSEVEACGNASRAVGLLLGG-----TQFIETLGG-LIRSEARPDGVSVDMGAPR 120

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L W  IP++ + D ++       PV    L NP  V++GNPH IFFV DD    DLA  G
Sbjct: 121 LRWDEIPVSYAMDTLEM------PVGWEDLENPVGVNVGNPHVIFFV-DDADAVDLARLG 173

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+   P+F E +N+++A V   + L LR WERG GLT ACG+ ACA+ VA+     T R
Sbjct: 174 PLIENDPLFPERINVNVASVVGPDHLKLRVWERGAGLTRACGTGACATAVAAIRRKLTGR 233

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            V + + GG L I W +   + MTG A   +EG  +
Sbjct: 234 KVRIDLPGGPLTITWPEGGTIDMTGPATLSFEGAFE 269


>gi|307294712|ref|ZP_07574554.1| diaminopimelate epimerase [Sphingobium chlorophenolicum L-1]
 gi|306879186|gb|EFN10404.1| diaminopimelate epimerase [Sphingobium chlorophenolicum L-1]
          Length = 266

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 150/277 (54%), Gaps = 16/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F+KM G+GN  +VID R    ++T     A++        DQ++LI +   A  D  
Sbjct: 1   MGRFSKMHGLGNDFVVIDARETALDMTEARAMAIADRHAGIGCDQLILIGNSDRA--DVS 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSEV++CGN  RCV  F+      +    ET  G+L AK   DG  SVDMG+P
Sbjct: 59  MRIFNSDGSEVEACGNATRCVPLFIG-----RDVLIETKAGLLDAKA-VDGGASVDMGQP 112

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L+W  IPL+ + D +        PV+   L  P  V++GNPH IFFV DDL   +    
Sbjct: 113 RLEWDAIPLSYAMDTLTM------PVSWEDLPAPVAVNVGNPHVIFFV-DDLDGVNFDRL 165

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+   P+F   VN++ A++     + L  WERG GLT ACG+ ACA+ VA+      +
Sbjct: 166 GPLIEHDPLFPARVNVNFAQMVGDNHIRLIVWERGAGLTRACGTGACATAVAAVRRKLVS 225

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              +V + GG L+I+W    H+ MTG A   ++G+ D
Sbjct: 226 GPTTVSLPGGDLVIDWTPGGHIMMTGPATHVFDGEAD 262


>gi|260574289|ref|ZP_05842294.1| diaminopimelate epimerase [Rhodobacter sp. SW2]
 gi|259023755|gb|EEW27046.1| diaminopimelate epimerase [Rhodobacter sp. SW2]
          Length = 279

 Score =  168 bits (426), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 103/274 (37%), Positives = 144/274 (52%), Gaps = 17/274 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN--THFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID RG    +T+ A+     D +    FDQ+  I D   A  D  + 
Sbjct: 12  FMKMHGLGNDFVVIDSRG-RGAVTTPALARALGDRHRGVGFDQLAEIRD--SAEADFALD 68

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             N DGS   +CGN  RCV  F+     + + T  T RG L A    DG +SV+MG P L
Sbjct: 69  FWNSDGSRAGACGNATRCVAEFVMRGSGKAAVTLTTTRGHLQAVRRADGLVSVNMGAPQL 128

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  +PLAR  D +     H+ P++     +P  V MGNPH +FFV  +    ++A  G 
Sbjct: 129 DWAEVPLARPADTL-----HL-PISG----DPVAVGMGNPHCVFFV-GNAETVNVADLGA 177

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L    P+F +  N+  A +T  + L +R WERG G+T ACGS ACA+ VA+     T R 
Sbjct: 178 LFETDPLFPQKTNVEFATLTGPDRLRMRVWERGAGITLACGSGACATAVAAHRRGLTGRK 237

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           V++ + GG L I+W  +  V+MTG     ++  L
Sbjct: 238 VTLDLDGGALEIDWRSDG-VWMTGPTAHVFDAML 270


>gi|257060198|ref|YP_003138086.1| diaminopimelate epimerase [Cyanothece sp. PCC 8802]
 gi|256590364|gb|ACV01251.1| diaminopimelate epimerase [Cyanothece sp. PCC 8802]
          Length = 281

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 148/285 (51%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITS--DAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F+K +G+GN  ++ID R  H  + S   AI           D ++ +     A+ D  
Sbjct: 3   IEFSKYQGLGNDFILIDNRSSHTPLVSPEQAIKMCDRHFGIGADGVIFVLP-GTANTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE Q CGNG+RC+ RF+          K++  +T+ G++  +    G + VD
Sbjct: 62  MRIFNSDGSEPQMCGNGIRCLARFIAHLEGGETLGKTYQIDTLAGVISPRLEAQGQVKVD 121

Query: 120 MGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P L  K IP  L  S DK+      +     L       VSMGNPH I FV+D ++ 
Sbjct: 122 MGTPYLLAKEIPTTLGNSNDKVINHSLEVAGQTWLVT----CVSMGNPHCITFVKD-VWG 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            DL + G     HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA  
Sbjct: 177 IDLPTLGPQFEHHPGFPERTNTEFIEVVRRDYVKMRVWERGAGITLACGTGACASVVAGV 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
             ++ +R   V++ GG L IEW + NN ++MTG A+  + G  ++
Sbjct: 237 LTNQCDRYCIVELPGGNLTIEWSEMNNRIYMTGPAELVFTGIYNL 281


>gi|330813437|ref|YP_004357676.1| diaminopimelate epimerase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486532|gb|AEA80937.1| diaminopimelate epimerase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 263

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 148/271 (54%), Gaps = 8/271 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G+GN  L++D R     +++  I  L+  +N  FDQ+++I    D++ +  I   N D
Sbjct: 1   MNGLGNDFLILDNRTKPTILSNVQIRHLANRNNIGFDQLIIIESGNDSAHN--ILFYNSD 58

Query: 71  GSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLI 130
           G E ++CGNG RCV  FL    K K  +  T  GIL + +N + +I++DMGEPI DW+ I
Sbjct: 59  GEEAEACGNGSRCVAHFLMEEKKIKKISINTKSGILNSIDNGNKNITIDMGEPIFDWEKI 118

Query: 131 PLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKH 190
           PL+   ++MD     I   ++    + + +S+GNPH IFF  +D+    L   G  +  H
Sbjct: 119 PLS---EEMDPSNVCITLKDNSSF-DGYALSVGNPHIIFF--NDIETDKLKIIGPEIENH 172

Query: 191 PMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKM 250
             F +  N++ A++    ++ +  WERG GLT ACG+ ACA+ VAS   + T R V++  
Sbjct: 173 KTFPKKCNVTFAKIIDQNNIKVNVWERGAGLTKACGTGACATAVASAKKNLTERLVNIHF 232

Query: 251 LGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             G L I+W  NN + M+G      E  + I
Sbjct: 233 QTGKLSIDWKKNNRIHMSGPVSDIQEVNISI 263


>gi|149204847|ref|ZP_01881809.1| diaminopimelate epimerase [Roseovarius sp. TM1035]
 gi|149141717|gb|EDM29772.1| diaminopimelate epimerase [Roseovarius sp. TM1035]
          Length = 277

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 138/266 (51%), Gaps = 16/266 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D RG    +T   I A++       FDQ+ +I        DA +
Sbjct: 9   LPFFKMHGLGNDFVVLDGRGRDLGLTPALIMAIADRHRGIGFDQLAVI---SQGMGDAHL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R L     +      T RG LVA +   G  SV+MG+P 
Sbjct: 66  TFYNADGSTSAACGNATRCIARHLMDESGKARLELSTARGALVAVDAGGGLTSVNMGQPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA + D ++       P+       P    MGNPH  FFV D      LA FG
Sbjct: 126 LDWAEIPLAEAMDTLEL------PIEG----GPVATGMGNPHCTFFVAD-AEAVPLAQFG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A V   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 PRYEHHPLYPERTNVQVATVIGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGE 270
           AV V + GG + ++W ++  V+MTGE
Sbjct: 235 AVRVDLDGGTIHVDWREDG-VWMTGE 259


>gi|163796736|ref|ZP_02190694.1| Diaminopimelate epimerase [alpha proteobacterium BAL199]
 gi|159177990|gb|EDP62537.1| Diaminopimelate epimerase [alpha proteobacterium BAL199]
          Length = 278

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 141/282 (50%), Gaps = 16/282 (5%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVD 61
           S + F KM G+GN  +V+D R  H    S+       D      +DQ + I   ++    
Sbjct: 2   SGLAFTKMHGLGNDFVVVDGR-VHPATLSEVQYRAVGDRRRGVGYDQFLTILPARNGGT- 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A++ I N DG+E Q+CGNG RCV   L     +     ETI G L+  +  DG ++VDMG
Sbjct: 60  AYMAIHNPDGTEAQACGNGTRCVAAVLMGETGQSEVAIETIAGRLICTDAGDGRVTVDMG 119

Query: 122 EPILDWKLIPLARSFDKMD---RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
              LDW+ IPLA   D +     +    GP           V+MGNPHA+FFV D     
Sbjct: 120 PANLDWRAIPLASDTDTLSVTVPEAGTFGPAT--------AVNMGNPHAVFFVPD-AEAV 170

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL++ G  +    +F E  N+    V + + L +R WER  G+T ACGS ACA++VA+  
Sbjct: 171 DLSTVGPRIEHSAVFPERANIEFVTVLARDRLRMRVWERSAGITQACGSGACAALVAAVR 230

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              T R  +V + GG L I W  + HV MTG     + G LD
Sbjct: 231 RGLTERRATVVLDGGPLEIFWRSDGHVEMTGPVATSFAGTLD 272


>gi|259417389|ref|ZP_05741308.1| diaminopimelate epimerase [Silicibacter sp. TrichCH4B]
 gi|259346295|gb|EEW58109.1| diaminopimelate epimerase [Silicibacter sp. TrichCH4B]
          Length = 275

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 139/267 (52%), Gaps = 14/267 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQD-ASVDA 62
           M+ F KM G+GN  +VID R     IT      ++       FDQ+ +I   ++ AS DA
Sbjct: 1   MLTFMKMHGLGNDFVVIDARTQDIQITPAMAKGIAHRQLGMGFDQLAVIFAAKEGASADA 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +   N DGS   +CGN  RC+ R+L  +  + +    T RG L AK+  +G  SV+MG 
Sbjct: 61  HLVFYNADGSTSAACGNATRCIARYLMDQSGKDALNLTTDRGELAAKDAGNGLTSVNMGA 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L W  IPL+   D ++       P+       P    MGNPH  FFVED      L  
Sbjct: 121 PQLLWDEIPLSEEMDTLEL------PIEGA----PTATGMGNPHCTFFVEDAEL-IPLEE 169

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG     HP++ E  N+ IA V   + L +R WERGVG+T A GS++CA+ VA+     T
Sbjct: 170 FGPRYEHHPLYPERTNVQIAHVMGPDHLRMRVWERGVGVTLASGSSSCATAVAAARKGLT 229

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTG 269
            R V + + GG L I+W ++  V+MTG
Sbjct: 230 GRNVQIDLDGGTLWIDWREDG-VWMTG 255


>gi|255262180|ref|ZP_05341522.1| diaminopimelate epimerase [Thalassiobium sp. R2A62]
 gi|255104515|gb|EET47189.1| diaminopimelate epimerase [Thalassiobium sp. R2A62]
          Length = 271

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 144/271 (53%), Gaps = 15/271 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V+D RG    + S    A+        FDQ+ ++ +  DA V   +  
Sbjct: 11  FMKMHGLGNDFVVVDERGITPRVDSTIAKAIGDRHRGVGFDQLAVLSNTDDADVQ--LTF 68

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS   +CGN  RC+   L  +   ++ T +T RG+L A  +  G  SV+M  P+LD
Sbjct: 69  YNADGSTAGACGNATRCIANHLLEQTSTRAMTLQTERGLLSAMSDVAGVTSVNMLHPLLD 128

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W  +PLA + D +        P++      P    MGNPH  FFV DD+    L +FG  
Sbjct: 129 WAYVPLAENVDTLAL------PID----GGPTATGMGNPHCTFFV-DDVEAVALETFGAR 177

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           +  HP+F E  N+ +A++   + + +R WERGVG+T + GS++CA+ VA+     T  +V
Sbjct: 178 MEHHPLFPERTNVQVAQIIGPDHIRMRVWERGVGITLSSGSSSCATAVAAARRGLTGCSV 237

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
            + + GG L I+W D+  V+MTG     ++G
Sbjct: 238 QIDLDGGTLHIDWRDDG-VWMTGPTAHVFDG 267


>gi|109900372|ref|YP_663627.1| diaminopimelate epimerase [Pseudoalteromonas atlantica T6c]
 gi|123170519|sp|Q15NG5|DAPF_PSEA6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|109702653|gb|ABG42573.1| diaminopimelate epimerase [Pseudoalteromonas atlantica T6c]
          Length = 276

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 143/280 (51%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I+ L+  +    FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFVVIDNVTQNVFFSKEKISQLADRNFGIGFDQLLVVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R      T  G +V    RDG I+V+MGE
Sbjct: 63  RIFNSDGSEVSQCGNGARCFARFVKMKGLTNRNKIVVSTKAGRIVLYHERDGQITVNMGE 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IPL  +      + + I   +H F      VSMGNPH +  V DD+   D+  
Sbjct: 123 PIFEPAKIPLKAN---KQENIYIIRENDHTFFCG--AVSMGNPHCVLLV-DDVETADVEG 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F EG N+   ++ +   + LR +ERGVG T ACGS ACA+V       K 
Sbjct: 177 IGKTLVAHERFPEGANIGFMQILNSGHIKLRVYERGVGETLACGSGACAAVAVGQMQKKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           N+ V+V + GG L I W     +  MTG A+  ++G + +
Sbjct: 237 NKEVTVDLPGGTLKIRWQGPGSILKMTGTAEHVFDGNITL 276


>gi|120600507|ref|YP_965081.1| diaminopimelate epimerase [Shewanella sp. W3-18-1]
 gi|146294665|ref|YP_001185089.1| diaminopimelate epimerase [Shewanella putrefaciens CN-32]
 gi|166225757|sp|A4YBF7|DAPF_SHEPC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166225759|sp|A1RPD2|DAPF_SHESW RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|120560600|gb|ABM26527.1| diaminopimelate epimerase [Shewanella sp. W3-18-1]
 gi|145566355|gb|ABP77290.1| diaminopimelate epimerase [Shewanella putrefaciens CN-32]
 gi|319427901|gb|ADV55975.1| diaminopimelate epimerase [Shewanella putrefaciens 200]
          Length = 275

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 148/283 (52%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIQFTKMHGLGNDFMVVD--GVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+
Sbjct: 59  FHYRIFNADGSEVEQCGNGARCFARFVRNKGLTNKNKIRVSTSSGKMTLRLERDGTVTVN 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG PIL+  LIP      K     + +      FL      SMGNPH +  VED +    
Sbjct: 119 MGVPILEPSLIPFKA---KKPEKTYLLQTAQQTFLCG--AASMGNPHCVLDVED-VASAA 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 173 VAEIGALLTKHERFPRGVNVGFMQVINSGHIKLRVYERGAAETLACGTGACAAVVVGQIQ 232

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K ++ V V + GG L I W  +   ++MTG A+  ++G++ +
Sbjct: 233 GKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|206890939|ref|YP_002248958.1| diaminopimelate epimerase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742877|gb|ACI21934.1| diaminopimelate epimerase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 279

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 157/283 (55%), Gaps = 18/283 (6%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  ++ID ++         AI+  +       DQ++L++  Q A  D  +
Sbjct: 4   INFVKMHGLGNDFILIDCLKNDLPKPQEFAIHYCNRRFGIGADQLLLLYPSQIA--DFKM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           +I N DGSEV+ CGNG+RC  +++  R    +     ET+ GI+  K+  +  + VDMG+
Sbjct: 62  KIFNADGSEVEMCGNGIRCFAKYIWDRGLSNKDVLEVETLAGIIKPKKVGE-LVQVDMGK 120

Query: 123 PILDWKLIPLA----RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           P      IP+      +FD M         +N         VSMGNPHA+ F++++  ++
Sbjct: 121 PEFHPNKIPVDVEGDSAFDLMLEVSGWHARIN--------CVSMGNPHAVIFLDEEPKNF 172

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +  +G L+  HP+F +  N+  A V +   + +R WERG G T ACG+ ACA+ VA+  
Sbjct: 173 AVTKYGPLIENHPIFPKRTNVEFAYVKNSSEIVMRVWERGAGETLACGTGACATAVAAMV 232

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              TN+ V+V +LGG LLIEW  + HV+MTG A++ +EG + +
Sbjct: 233 KEFTNKKVTVHLLGGDLLIEWAADGHVYMTGPAQEVFEGVVKV 275


>gi|218247127|ref|YP_002372498.1| diaminopimelate epimerase [Cyanothece sp. PCC 8801]
 gi|226724207|sp|B7K1E7|DAPF_CYAP8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218167605|gb|ACK66342.1| Diaminopimelate epimerase [Cyanothece sp. PCC 8801]
          Length = 281

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 148/285 (51%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITS--DAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F+K +G+GN  ++ID R  H  + S   AI           D ++ +     A+ D  
Sbjct: 3   IEFSKYQGLGNDFILIDNRSSHTPLVSPEQAIKMCDRHFGIGADGVIFVLP-GTANTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE Q CGNG+RC+ RF+          K++  +T+ G++  +    G + VD
Sbjct: 62  MRIFNSDGSEPQMCGNGIRCLARFIAHLEGGETLGKTYQIDTLAGVISPRLEAQGQVKVD 121

Query: 120 MGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P L  K IP  L  S DK+      +     L       VSMGNPH I FV+D ++ 
Sbjct: 122 MGTPYLLAKEIPTTLGNSNDKVINHSLEVAGQTWLVT----CVSMGNPHCITFVKD-VWG 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            DL + G     HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA  
Sbjct: 177 IDLPTLGPQFEHHPGFPERTNTEFIEVVRRDYVKMRVWERGAGITLACGTGACASVVAGV 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
             ++ +R   V++ GG L IEW + +N ++MTG A+  + G  ++
Sbjct: 237 LTNQCDRYCIVELPGGNLTIEWSEMDNRIYMTGPAELVFTGIYNL 281


>gi|260431874|ref|ZP_05785845.1| diaminopimelate epimerase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415702|gb|EEX08961.1| diaminopimelate epimerase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 277

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 138/275 (50%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +++D R     IT      +        FDQ+ +I    +   DA +
Sbjct: 9   LPFMKMHGLGNDFVIVDARAHPVQITPALARGIGHRQFGVGFDQLAVI---VNGESDAHL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL     +   T  T  G L A++  DG  SV+MG P 
Sbjct: 66  VFYNADGSISATCGNATRCIARFLMQESGKSELTLSTSHGTLQARDAGDGLTSVNMGHPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA   D ++       P+       P    MGNPH  FFVED      L  FG
Sbjct: 126 LDWADIPLAEEVDTLEL------PIE----GGPVATGMGNPHCTFFVED-AEAIPLEEFG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  N+ +A++   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 ARYEHHPLYPQRTNVQVAQIIGPDHIRMRVWERGVGITLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V +++ GG + I+W ++  V+MTG     + G L
Sbjct: 235 KVQIELDGGTIWIDWREDG-VWMTGPTCHVFSGTL 268


>gi|296114904|ref|ZP_06833552.1| diaminopimelate epimerase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978610|gb|EFG85340.1| diaminopimelate epimerase [Gluconacetobacter hansenii ATCC 23769]
          Length = 274

 Score =  166 bits (419), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 141/279 (50%), Gaps = 15/279 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +++D R    ++T   I ALS        DQ +++        D F+R 
Sbjct: 5   FYKMHGLGNDFVIMDERASRLDLTPARIAALSDRQRGIGCDQFVVLRPACRDGADVFVRF 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DG+E  +CGN  RCV   +       +   +T  G+L  +   DG I+VDMG P LD
Sbjct: 65  FNADGTESGACGNASRCVAALIGDERGTMAPVLQTRAGLLPTRIAGDGVITVDMGPPALD 124

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFL-RNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           W+ IPL R  D +           HL L  +P   SMGNPHA  F+ D     D    G 
Sbjct: 125 WRDIPLVREVDTL-----------HLPLWGDPAAASMGNPHATVFL-DVGDTTDPRVRGP 172

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            +   P+F E  N+  A+V + + + LR WERG GLT ACGS ACA+VV +       R 
Sbjct: 173 AMECDPLFPERANIGFAQVRARDDMRLRVWERGAGLTLACGSGACAAVVNAVRRGLVGRT 232

Query: 246 VSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKT 283
             V+M GG L + W +++ HV M+G A   +EG + + T
Sbjct: 233 CVVEMDGGVLSVTWRESDGHVLMSGPAVMSFEGTVALDT 271


>gi|58616748|ref|YP_195947.1| diaminopimelate epimerase [Ehrlichia ruminantium str. Gardel]
 gi|58416360|emb|CAI27473.1| Diaminopimelate epimerase [Ehrlichia ruminantium str. Gardel]
          Length = 265

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 143/276 (51%), Gaps = 16/276 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMR-GCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G  N  ++ID R   + NI    I    T      DQ+++I   + A  D F
Sbjct: 1   MINFIKMHGTLNDFVIIDCREKMYHNINFKKIAHRKTGIGC--DQVIVITSSKKA--DCF 56

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I I N DGS+V+ CGN  RCV   L++  K  + T E    IL         I V+MG P
Sbjct: 57  IHIYNPDGSKVEMCGNAARCVAYLLSNEKKNDNITIELSDRILSCVRTSHDKIQVNMGYP 116

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE--DDLYHYDLA 181
              WK IP+  + D +        P+    L  P  V++GNPHA+FFV+  DD+    L 
Sbjct: 117 KFHWKDIPVLHACDTLYL------PIKTELLSYPVGVNIGNPHAVFFVDSIDDI---PLT 167

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  H +F    N+SIA+V S   + LR WERG G TA+CGSAACA++VA+   + 
Sbjct: 168 KIGPELENHTLFPNKANISIAQVISRNEIKLRVWERGTGETASCGSAACATLVAAVRRNY 227

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           TN   ++ + GG LLI + D+N + M G     + G
Sbjct: 228 TNHHATIYLQGGNLLILYKDDNTILMEGVVSYVFSG 263


>gi|58039894|ref|YP_191858.1| diaminopimelate epimerase [Gluconobacter oxydans 621H]
 gi|81557036|sp|Q5FQZ4|DAPF_GLUOX RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|58002308|gb|AAW61202.1| Diaminopimelate epimerase [Gluconobacter oxydans 621H]
          Length = 257

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 141/273 (51%), Gaps = 22/273 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R     + +  I  L         DQ++L+     A  D  +
Sbjct: 3   LSFTKMHGLGNDFVVIDGRQNDPALETATIRHLCDRRFGIGCDQLVLLTPPTLAGADVHV 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           R  N DGSE  +CGN  RCV +F+       + T +T  G+L   ++ D   +VDMG P 
Sbjct: 63  RFFNPDGSEAGACGNASRCVAKFVGG-----APTLQTAAGLLPTAQDGD-LFTVDMGTPR 116

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ +PL+R+ D +           HL L +    SMGNPHA  F   D +  +  + G
Sbjct: 117 LDWQDVPLSRACDTL-----------HLPLHDAAACSMGNPHATLF--GDAFRAE--ALG 161

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             L + P+F E  N+  A++ S   + LR WERG GLT ACGS ACA+VV +     T R
Sbjct: 162 PGLERDPLFPERANIGFAQILSPIHMRLRVWERGAGLTLACGSGACAAVVNAVRRGLTER 221

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             +V M GG L I W ++ HVFMTG A   + G
Sbjct: 222 TCTVTMDGGDLRITWREDGHVFMTGPAVTVFHG 254


>gi|85704066|ref|ZP_01035169.1| diaminopimelate epimerase [Roseovarius sp. 217]
 gi|85671386|gb|EAQ26244.1| diaminopimelate epimerase [Roseovarius sp. 217]
          Length = 277

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 139/275 (50%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     +T   I A++       FDQ+ +I        DA +
Sbjct: 9   LPFFKMHGLGNDFVVLDGRARDLGLTPGLIMAIADRHRGIGFDQLAVI---TQGMGDAHL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R+L     +      T RG LVA +   G  SV+MG+P 
Sbjct: 66  TFYNADGSTSAACGNATRCIARYLMDESGKARLELSTARGALVAVDAGGGLTSVNMGQPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA + D ++       P+       P    MGNPH  FFV  D     LA FG
Sbjct: 126 LDWAEIPLAEAMDTLEL------PIEG----GPVATGMGNPHCTFFVA-DAEAVPLAQFG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A V   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 PRYEHHPLYPERTNVQVATVIGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG + ++W ++  V+MTGE      G L
Sbjct: 235 RVRIDLDGGTIHVDWREDG-VWMTGETAHVASGVL 268


>gi|315646169|ref|ZP_07899289.1| diaminopimelate epimerase [Paenibacillus vortex V453]
 gi|315278368|gb|EFU41684.1| diaminopimelate epimerase [Paenibacillus vortex V453]
          Length = 278

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 157/285 (55%), Gaps = 16/285 (5%)

Query: 6   VDFAKMEGIGNKILVI-DMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  +V+   +   ++ +  A+           D ++ I   + A  D  +
Sbjct: 1   MEFTKMHGLGNDFVVVYGEQELPNDASERAVKLCHRFFGIGADGLVYILPSRKA--DFMM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETI-RGI----LVAKENRDGSIS 117
           RI+N DGSE + CGN +RCV +++     + R+  T ETI  G+    L  ++ +  S+ 
Sbjct: 59  RIMNSDGSEAEQCGNAIRCVAKYVYDHGHINREEITIETIGAGVQQVRLTVQDGQVSSVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEP+L+   +P     + +      +      F      VSMGNPH + +V DD  +
Sbjct: 119 VDMGEPVLNGLSVPTTIDLNPVVDHPVEVDGREFRFT----AVSMGNPHCVIYV-DDAVN 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           +DL ++G  L  HP+F   +N+  A V S + +D+R WERG G T ACG+ ACA++V+S 
Sbjct: 174 FDLGTWGPKLEVHPLFPRKINVEFATVNSRDQVDMRVWERGAGPTLACGTGACATLVSSV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
               T+R+ ++ + GG L IEW +N NHV+MTG A+  ++G L I
Sbjct: 234 LNGSTDRSATISLKGGDLFIEWDENDNHVYMTGPAELVYKGTLAI 278


>gi|103488207|ref|YP_617768.1| diaminopimelate epimerase [Sphingopyxis alaskensis RB2256]
 gi|123252939|sp|Q1GPI7|DAPF_SPHAL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|98978284|gb|ABF54435.1| diaminopimelate epimerase [Sphingopyxis alaskensis RB2256]
          Length = 268

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 142/277 (51%), Gaps = 22/277 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH---FDQIMLIHDFQDASVDAFI 64
           F KM G+GN  +VID R     +T    +A++  D  H    DQ++L+      S D  +
Sbjct: 5   FTKMHGLGNDFVVIDARVAPVEMTPARAHAIA--DRRHGIGCDQLILLE--PSTSADVKM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           RI N DG EV++CGN  RCV   +      K    ET+ G+L      DG   V +GEP+
Sbjct: 61  RIFNADGGEVEACGNATRCVATLIG-----KPAVIETLAGMLRVTPA-DGGAEVTLGEPV 114

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV-EDDLYHYDLASF 183
            DW  IPLA   D  D       PV    L +   V++GNPH +FFV E D    D    
Sbjct: 115 FDWDHIPLAMPMDTRDM------PVAWDELEHGAAVNVGNPHIVFFVPEADAVALD--QL 166

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  +   P+F E VN+++A +     L LR WERGVGLT ACG+ ACA+ VA+       
Sbjct: 167 GPRIETDPLFPERVNVNVASLDGENQLQLRVWERGVGLTQACGTGACATAVAAIRAGLVR 226

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             V+V + GG L+I W     + M+G A + ++G+ D
Sbjct: 227 SPVTVALPGGDLVIRWAPGEPIVMSGAATRVFDGETD 263


>gi|57238764|ref|YP_179900.1| diaminopimelate epimerase [Ehrlichia ruminantium str. Welgevonden]
 gi|57160843|emb|CAH57741.1| diaminopimelate epimerase [Ehrlichia ruminantium str. Welgevonden]
          Length = 265

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 140/274 (51%), Gaps = 12/274 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMR-GCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G  N  ++ID R   + NI    I    T      DQ+++I   + A  D F
Sbjct: 1   MINFIKMHGTLNDFVIIDCREKMYHNINFKKIAHRKTGIGC--DQVIVITSSKKA--DCF 56

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I I N DGS+V+ CGN  RCV   L++  K  + T E    IL         I V+MG P
Sbjct: 57  IHIYNPDGSKVEMCGNAARCVAYLLSNEKKNDNITIELSDRILSCVRTSHDKIQVNMGYP 116

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              WK IP+    D +        P+    L  P  V++GNPHA+FFV D +    L   
Sbjct: 117 KFHWKDIPVLHECDTLYL------PIKTELLSYPVGVNIGNPHAVFFV-DSIDDIPLTKI 169

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  H +F    N+SIA+V S   + LR WERG G TA+CGSAACA++VA+   + TN
Sbjct: 170 GPELENHTLFPNKANISIAQVISRNEIKLRVWERGTGETASCGSAACATLVAAVRRNYTN 229

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
              ++ + GG LLI + D+N + M G     + G
Sbjct: 230 HHATIYLQGGNLLILYKDDNTILMEGVVSYVFSG 263


>gi|83643200|ref|YP_431635.1| diaminopimelate epimerase [Hahella chejuensis KCTC 2396]
 gi|123535219|sp|Q2SQ64|DAPF_HAHCH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|83631243|gb|ABC27210.1| diaminopimelate epimerase [Hahella chejuensis KCTC 2396]
          Length = 276

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 144/281 (51%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H +   + +  L+  +    FDQ++++        D  
Sbjct: 2   LIKFTKMHGLGNDFMVVDLISQHAHFRPEQVRRLADRNFGVGFDQLLIVEPPGRPDADFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+       +K+   ET +GI+    N+DG ++VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVKENRLTNKKNIRVETKKGIIELIVNKDGLVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    +L P    F    ++  +   VN + +     VSMGNPH +  V DD+    + 
Sbjct: 122 AP----RLAPADIPFVAETQEAIYPIEVNGV-MYEISAVSMGNPHGVLVV-DDVNKAPVH 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  HP F E  N+   +V       LR +ERG G T ACG+ ACA+VVA      
Sbjct: 176 KLGKALENHPRFPERANIGFLQVVHRRFAKLRVFERGAGETLACGTGACAAVVAGRLRGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +R V +K+ GG L I W    H V MTG A + ++G++ I
Sbjct: 236 LDRKVEIKLPGGNLKISWEGEGHPVMMTGPAVRVFDGQVRI 276


>gi|148555836|ref|YP_001263418.1| diaminopimelate epimerase [Sphingomonas wittichii RW1]
 gi|166225760|sp|A5VAG4|DAPF_SPHWW RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148501026|gb|ABQ69280.1| diaminopimelate epimerase [Sphingomonas wittichii RW1]
          Length = 274

 Score =  165 bits (417), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 143/280 (51%), Gaps = 19/280 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAF 63
           V F KM G+GN  +VID R       + A      D  T    DQ++L+     A  DA 
Sbjct: 3   VRFHKMHGLGNDFVVIDARATAPVEMTAARARALADRKTGVGCDQLILLE--PSAVADAR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSEV++CGN  RCVV  L       S   ET+ G+L  + + DG +SV++GEP
Sbjct: 61  MRIFNADGSEVEACGNATRCVVSLLGG-----SARIETVAGLLEGR-SADGQVSVELGEP 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV-EDDLYHYDLAS 182
             DW  IPLA + D          PV    L  P   ++GNPH +FFV E D    D   
Sbjct: 115 RFDWDAIPLAYAMDT------RAMPVAWEELEAPMAANVGNPHVVFFVPETDAVALD--R 166

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +   P+F   +N+++A V    ++ LR WERGVGLT ACG+ ACA+ V++      
Sbjct: 167 LGPRIETDPLFPARINVNVATVDDRANIRLRVWERGVGLTDACGTGACATAVSAIRAGLV 226

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           +  V V + GG L I+W     + MTG A   +  + D+ 
Sbjct: 227 DSPVRVTLPGGPLTIDWAPGRPIVMTGPATHVFTAETDLS 266


>gi|24375790|ref|NP_719833.1| diaminopimelate epimerase [Shewanella oneidensis MR-1]
 gi|29839322|sp|Q8E9H5|DAPF_SHEON RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|24350738|gb|AAN57277.1|AE015863_6 diaminopimelate epimerase [Shewanella oneidensis MR-1]
          Length = 275

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 149/283 (52%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIQFTKMHGLGNDFMVVD--GITQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV++CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+
Sbjct: 59  FHYRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVN 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P+L+   IP      K     + +      FL      SMGNPH +  VED + + +
Sbjct: 119 MGVPVLEPSQIPFKA---KKAEKTYLLQTPQQTFLCG--AASMGNPHCVLDVED-VANAN 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 173 VAEIGALLTKHERFPRGVNVGFMQVVNAGHIKLRVYERGAAETLACGTGACAAVVVGQIQ 232

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K ++ V V + GG L I W  +   ++MTG A+  ++G++ +
Sbjct: 233 GKLDQQVQVDLPGGSLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|83949967|ref|ZP_00958700.1| diaminopimelate epimerase [Roseovarius nubinhibens ISM]
 gi|83837866|gb|EAP77162.1| diaminopimelate epimerase [Roseovarius nubinhibens ISM]
          Length = 277

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 140/276 (50%), Gaps = 17/276 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAF 63
           + F KM G+GN  +V D R   D   + A+  L  D +     DQ+ LI    +   DA 
Sbjct: 9   LPFMKMHGLGNDFVVFDGR-ARDIAITPALARLVADRHRGIGCDQLALI--TAEGPGDAH 65

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +   N DGS   +CGN  RC+ R L   + R +    T RG L A++   G  SV+MG P
Sbjct: 66  LTFWNADGSMAAACGNATRCIARHLMDDLGRDALHLTTARGDLAARDMGQGVTSVNMGAP 125

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            LDW  IPLA + D ++       P+       P    MGNPH  FFVED      LA F
Sbjct: 126 QLDWAEIPLAEAMDTLEL------PIEG----GPTATGMGNPHCTFFVED-AERVALAEF 174

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G     HP+F E  N+ +A +   + L +R WERGVG T A GS++CA+ VA+     T 
Sbjct: 175 GPRYEHHPLFPERTNVQVASLIGPDHLRMRVWERGVGPTLASGSSSCATAVAAARRGLTG 234

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           R V++ + GG L I+W ++  V+MTG      +G L
Sbjct: 235 RCVTITLDGGTLEIDWREDG-VWMTGRTAHVCDGVL 269


>gi|113968736|ref|YP_732529.1| diaminopimelate epimerase [Shewanella sp. MR-4]
 gi|114049120|ref|YP_739670.1| diaminopimelate epimerase [Shewanella sp. MR-7]
 gi|122944336|sp|Q0HQJ2|DAPF_SHESR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123130815|sp|Q0HN95|DAPF_SHESM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|113883420|gb|ABI37472.1| diaminopimelate epimerase [Shewanella sp. MR-4]
 gi|113890562|gb|ABI44613.1| diaminopimelate epimerase [Shewanella sp. MR-7]
          Length = 275

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 149/283 (52%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIQFTKMHGLGNDFMVVD--GVTQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV++CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+
Sbjct: 59  FHYRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVN 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P+LD   IP      K     + +      FL      SMGNPH +  VED + + +
Sbjct: 119 MGVPVLDPSQIPFKA---KKAEKTYLLQTSQQTFLCG--AASMGNPHCVLDVED-VANAN 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 173 VAEIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGQIQ 232

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K ++ V V + GG L I W  +   ++MTG A+  ++G++ +
Sbjct: 233 GKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|167045713|gb|ABZ10360.1| putative diaminopimelate epimerase [uncultured marine bacterium
           HF4000_APKG2098]
          Length = 275

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 150/262 (57%), Gaps = 4/262 (1%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           KM+G+GN  ++ D R    ++T + I  +S  ++   DQ++ I   +D + +AF++  N 
Sbjct: 8   KMDGLGNDFIIFDKRKKSVSLTKEQIIKISDRNSIGCDQVIFIE--KDENSNAFLKFYNS 65

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKL 129
           DG E+ +CGNG RCV   L      K  +  T  GIL A+ N    +S++MGEP  +W  
Sbjct: 66  DGGEISACGNGSRCVAYLLMKENNNKKISLGTKVGILQAELNDKNLVSINMGEPNFEWNK 125

Query: 130 IPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAK 189
           IPL++  D  +  +  I  ++    R  F +S+GNPH IFFVED    ++L   G  +  
Sbjct: 126 IPLSKKMDTQNL-KIKINGIDGKEARGGFSLSIGNPHVIFFVED-FNQFNLKEIGPKIEN 183

Query: 190 HPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVK 249
           +  F E  N+++A + +   + ++ WERGVGLT ACG+AACA+ V+   L  + R V ++
Sbjct: 184 YSYFPEKCNVTLASIKNKNHVKVKVWERGVGLTKACGTAACATAVSGAVLKLSERCVDIE 243

Query: 250 MLGGGLLIEWHDNNHVFMTGEA 271
            + G L I+W  +N+++MTG+ 
Sbjct: 244 FVEGLLNIDWKKDNNIYMTGKV 265


>gi|148652161|ref|YP_001279254.1| diaminopimelate epimerase [Psychrobacter sp. PRwf-1]
 gi|172048462|sp|A5WCB3|DAPF_PSYWF RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148571245|gb|ABQ93304.1| diaminopimelate epimerase [Psychrobacter sp. PRwf-1]
          Length = 293

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 144/283 (50%), Gaps = 18/283 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+  +    FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLELTPELITLLADRNLGIGFDQLLVVEPPMRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ +R    ++    ET  GIL    +  G + VDMG
Sbjct: 62  YRIFNSDGSEVEQCGNGARCFARFVQARKLSFKQRIRVETKSGILTLSTDNYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI----GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           +P  +   IP         ++ +H+     PV        +V +MGNPHA+  V DD+  
Sbjct: 122 KPRFEPAEIPFTPKAITKIQNAYHLDVEGTPVQL------YVANMGNPHAVIKV-DDILT 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---V 234
            D+   G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V   +
Sbjct: 175 ADVEKLGKAIESHPAFPERVNVGFMQVMNQRHIRLRVYERGVGETQACGTGACAAVATGI 234

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             G L +    +  ++ GG LLI W     V MTG     +EG
Sbjct: 235 REGWLDE-GEEIRAQLYGGSLLIRWSPGYSVMMTGPTAFVYEG 276


>gi|117918848|ref|YP_868040.1| diaminopimelate epimerase [Shewanella sp. ANA-3]
 gi|166225758|sp|A0KS65|DAPF_SHESA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|117611180|gb|ABK46634.1| diaminopimelate epimerase [Shewanella sp. ANA-3]
          Length = 275

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 149/283 (52%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIQFTKMHGLGNDFMVVD--GVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV++CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+
Sbjct: 59  FHYRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVN 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P+LD   IP      K     + +      FL      SMGNPH +  VED + + +
Sbjct: 119 MGVPVLDPSQIPFKA---KKAEKTYLLQTPQQTFLCG--AASMGNPHCVLDVED-VANAN 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 173 VAEIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGQIQ 232

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K ++ V V + GG L I W  +   ++MTG A+  ++G++ +
Sbjct: 233 GKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|58578685|ref|YP_196897.1| diaminopimelate epimerase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417311|emb|CAI26515.1| Diaminopimelate epimerase [Ehrlichia ruminantium str. Welgevonden]
          Length = 281

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 143/278 (51%), Gaps = 16/278 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMR-GCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           S +++F KM G  N  ++ID R   + NI    I    T      DQ+++I   + A  D
Sbjct: 15  SHVINFIKMHGTLNDFVIIDCREKMYHNINFKKIAHRKTGIGC--DQVIVITSSKKA--D 70

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            FI I N DGS+V+ CGN  RCV   L++  K  + T E    IL         I V+MG
Sbjct: 71  CFIHIYNPDGSKVEMCGNAARCVAYLLSNEKKNDNITIELSDRILSCVRTSHDKIQVNMG 130

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE--DDLYHYD 179
            P   WK IP+    D +        P+    L  P  V++GNPHA+FFV+  DD+    
Sbjct: 131 YPKFHWKDIPVLHECDTLYL------PIKTELLSYPVGVNIGNPHAVFFVDSIDDI---P 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G  L  H +F    N+SIA+V S   + LR WERG G TA+CGSAACA++VA+   
Sbjct: 182 LTKIGPELENHTLFPNKANISIAQVISRNEIKLRVWERGTGETASCGSAACATLVAAVRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           + TN   ++ + GG LLI + D+N + M G     + G
Sbjct: 242 NYTNHHATIYLQGGNLLILYKDDNTILMEGVVSYVFSG 279


>gi|84503501|ref|ZP_01001556.1| Diaminopimelate epimerase [Oceanicola batsensis HTCC2597]
 gi|84388179|gb|EAQ01132.1| Diaminopimelate epimerase [Oceanicola batsensis HTCC2597]
          Length = 289

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 145/276 (52%), Gaps = 18/276 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +++D RG     T     A+        FDQ+  I D ++   D  +
Sbjct: 21  LPFRKMHGAGNDFVILDSRGMAPVCTPGLARAVGDRHRGVGFDQLAEIRDGEN--CDIAL 78

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RCV     +   +   T  T RG+L   E R  ++ V+MG P+
Sbjct: 79  DFWNSDGSRAGACGNATRCVAAEWMTETGQDRVTIRTTRGVLRG-EMRGEAVWVNMGPPV 137

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLR-NPFVVSMGNPHAIFFVEDDLYHYDLASF 183
           LDW  +PLAR  D +           HL +  +P  V MGNPHA+FFVED +   D+A+ 
Sbjct: 138 LDWAQVPLAREVDLL-----------HLPIAGDPCGVGMGNPHAVFFVED-IDAVDVAAR 185

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  +   P++ E  N+   +V S + + +R WERG G+T ACGS ACA  VA+     T 
Sbjct: 186 GAEVEHDPLYPEATNVEFVQVRSHDEVRMRVWERGTGITLACGSGACAVAVAAHRRGLTG 245

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           R V +++ GG L ++W D+  V+MTG   + +EG+L
Sbjct: 246 RHVRIEVDGGWLELDWRDDG-VWMTGPVARVFEGRL 280


>gi|332304597|ref|YP_004432448.1| diaminopimelate epimerase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171926|gb|AEE21180.1| diaminopimelate epimerase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 276

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/280 (35%), Positives = 142/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I  L+  +    FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFVVIDNVTQNVFFSKEKIAQLADRNFGIGFDQLLVVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R      T  G +V    RDG ++V+MGE
Sbjct: 63  RIFNSDGSEVSQCGNGARCFARFVKMKGLTNRNKIVVSTKAGRIVLYHERDGQVTVNMGE 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL  +      + + I   +H F      VSMGNPH +  V DD+   D+  
Sbjct: 123 PEFEPSKIPLKAN---KQENIYIIRENDHTFFCG--AVSMGNPHCVLLV-DDIATTDVEG 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F EG N+   ++ +   + LR +ERGVG T ACGS ACA+V       K 
Sbjct: 177 IGKMLVAHERFPEGANIGFMQILNSGHIKLRVYERGVGETLACGSGACAAVAVGQMQKKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           N+ V+V + GG L I W     +  MTG A+  ++G + +
Sbjct: 237 NKDVTVDLPGGTLKIRWQGPGSILKMTGTAEHVFDGNITL 276


>gi|114568573|ref|YP_755253.1| diaminopimelate epimerase [Maricaulis maris MCS10]
 gi|114339035|gb|ABI64315.1| diaminopimelate epimerase [Maricaulis maris MCS10]
          Length = 294

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/275 (38%), Positives = 160/275 (58%), Gaps = 12/275 (4%)

Query: 11  MEGIGNKILVIDMRGCHD--NITSDAINALSTDDNTH-FDQIMLIHDFQDASVDAFIRII 67
           M G GNK ++ D+RG     N+++D++ A++     H FDQ++++ D  D S DAF+RI 
Sbjct: 28  MNGAGNKFILADVRGRAGVFNLSADSVKAMA---RAHPFDQLLVLED-SDTS-DAFMRIW 82

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DG EV +CGNG R     +       + + +T  G+L+A++    S+SVDMGEP LDW
Sbjct: 83  NSDGDEVGACGNGTRAAAWAMMQETGSDTLSLDTAGGVLLARDAGPMSVSVDMGEPRLDW 142

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             IPL R  D +  D F +   + + +  P  VSMGNPHA+FF+  D+ ++ +   G ++
Sbjct: 143 TEIPLVRPMDTLQLD-FAV-EKDGVRIEAPGAVSMGNPHAVFFIR-DIANFPVTGLGPVV 199

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
              P+F E VN   A++     + LR WERG G+TAACG+ ACA++VA+      +R   
Sbjct: 200 EHAPLFPERVNAGFAQILDARHIRLRVWERGAGITAACGTGACAALVAAHRRGLCDRQAM 259

Query: 248 VKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +   GG L +EW   +NHV +TG  + E   +LDI
Sbjct: 260 IHADGGDLSVEWRKSDNHVILTGPVEDEGPIELDI 294


>gi|110678169|ref|YP_681176.1| diaminopimelate epimerase [Roseobacter denitrificans OCh 114]
 gi|109454285|gb|ABG30490.1| diaminopimelate epimerase [Roseobacter denitrificans OCh 114]
          Length = 280

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 143/277 (51%), Gaps = 16/277 (5%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
           S + F KM G+GN  +V+D R    +IT     AL        FDQ+ LI + +     A
Sbjct: 10  SGLPFMKMHGLGNDFVVLDARRRSMDITPRFAQALGHRHTGVGFDQLALITNTKTGVHLA 69

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           F    N DGS   +CGN  RC+  ++ ++      T  T RG+L A    +G  SV+MG 
Sbjct: 70  FF---NADGSVSSACGNATRCIADYIMAQTGASDMTLSTDRGVLAACRAANGQTSVNMGA 126

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P LDW  +PLAR  D ++       P+       P    MGNPH  FFV DD+   D+A 
Sbjct: 127 PQLDWTEVPLAREMDTLEL------PIEG----TPTATGMGNPHCTFFV-DDVMQTDVAK 175

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H +F +  N+  A +T  +++ +R WERGVG+T A GS++CA  VA+     T
Sbjct: 176 LGAELEHHELFPQRTNVQFASITGPDTIRMRVWERGVGMTLASGSSSCAVAVAAARRGLT 235

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            R V V + GG L I+W ++  V+MTG  +  + G L
Sbjct: 236 GRKVQVDLDGGRLEIDWREDG-VWMTGPTQHVFSGTL 271


>gi|150398764|ref|YP_001322531.1| diaminopimelate epimerase [Methanococcus vannielii SB]
 gi|150011467|gb|ABR53919.1| Diaminopimelate epimerase [Methanococcus vannielii SB]
          Length = 292

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 159/293 (54%), Gaps = 31/293 (10%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           +V F KM G+GN  + I+     D    +  +   +D   HF    D ++LI D + A  
Sbjct: 15  VVKFTKMHGLGNDYIYINAV-LEDIKNPNEFSKFVSD--RHFGIGSDGLVLILDSKIA-- 69

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGS--- 115
           D  +R+ N DGSE + CGN +RCV +F+       +K  T ET+ G+ V +   +G    
Sbjct: 70  DFKMRMFNSDGSEAEMCGNAIRCVGKFVYDNKLTDKKIITIETLAGVKVLEMTVEGEEVV 129

Query: 116 -ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF-----VVSMGNPHAIF 169
            + VDMGEP L+   IP+         D++ +  +N     N +      VSMGNPHA+ 
Sbjct: 130 LVKVDMGEPTLEALKIPVIS-------DKYPV--INETIDSNGYNFKFTCVSMGNPHAVT 180

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           ++ED + +++L   G L   H  F +  N+    V + E+L +R WERG G T ACG+ A
Sbjct: 181 YIED-VDNFELQKIGPLFEAHEKFPKKTNVEFVNVINDETLKMRVWERGAGETLACGTGA 239

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           CA +V+S     + R  +VK+LGG L++EW + NNHV+MTG A K +EGK+ +
Sbjct: 240 CAVLVSSVLNGLSKRKATVKLLGGDLIVEWSESNNHVYMTGPATKVFEGKIKL 292


>gi|149186852|ref|ZP_01865162.1| diaminopimelate epimerase [Erythrobacter sp. SD-21]
 gi|148829519|gb|EDL47960.1| diaminopimelate epimerase [Erythrobacter sp. SD-21]
          Length = 273

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 140/283 (49%), Gaps = 18/283 (6%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD--DNTHFDQIMLIHDFQD 57
           M+ +M V F KM G+GN  +V+D R     +      A   D  +    DQ++L+     
Sbjct: 1   MRGTMRVPFIKMHGLGNDFVVLDARETALPVLDKGRAAAIADRHEGIGCDQLILLE--PS 58

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSIS 117
            S D  +RI N DGSEV +CGN  R V        +      ET  G+L A  + DG   
Sbjct: 59  GSADFRMRIFNHDGSEVGACGNATRAVALLHGVEAR-----IETAGGLLSASPS-DGGAR 112

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P  DW  IPLA   D +        PV    L NP  V++GNPH IFFVED    
Sbjct: 113 VDMGTPRFDWDAIPLAYPMDTLSM------PVGWEMLENPGAVNVGNPHVIFFVED-TNA 165

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G  + K P+F E VN+++A + S   + LR WERG GLT ACG+ ACA+ V + 
Sbjct: 166 VPLDRIGPEIEKDPLFPERVNVNVATIESRSRIRLRVWERGAGLTRACGTGACATAVRAM 225

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
                +  V+V + GG L I W     + MTG A + + G  +
Sbjct: 226 RRKLVDSPVTVALPGGELEIAWEPGGTIQMTGPATEAFRGSFE 268


>gi|83595884|gb|ABC25246.1| diaminopimelate epimerase [uncultured marine bacterium Ant4D3]
          Length = 276

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 147/282 (52%), Gaps = 12/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDA 62
           ++ FAKM G+GN  +V+D+     +++++ I  L  D NT   FDQ++L+   Q   VD 
Sbjct: 2   LLRFAKMHGLGNDFMVVDLISQRVHLSAEQIRCLG-DRNTGVGFDQLLLVETPQSPDVDF 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DG+EV+ CGNG RC  RF+  +    ++    +T  G +  K  +D  + VDM
Sbjct: 61  RYRIFNSDGTEVEHCGNGARCFARFVHDQRLTGKRDIAVQTSNGRMGLKMLKDHWVEVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEP+L   L+P             H G    +      VVSMGNPHA+  V DD+    +
Sbjct: 121 GEPVLLPSLVPFDAPAQAPSYRLEHNGQSYTIG-----VVSMGNPHAVIVV-DDVASAPV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  L +HP F    N+   ++ +  ++ LR +ERGVG T ACG+ ACA+VVA     
Sbjct: 175 VELGTKLEQHPRFPNKANIGFMQIINRNTIKLRVFERGVGETKACGTGACAAVVAGQQQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                V+ ++ GG L I+W    +H+ M G     +EG++ +
Sbjct: 235 LLGTNVTAQLTGGDLTIDWQGPGHHLLMNGPTTHVYEGQIKL 276


>gi|332977414|gb|EGK14191.1| diaminopimelate epimerase [Psychrobacter sp. 1501(2011)]
          Length = 293

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 143/282 (50%), Gaps = 16/282 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+       FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLELTEELIALLADRHMGIGFDQLLVVEPPMRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ +R    ++    ET  GIL    +  G + VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVQARKLSFKQRIRVETKSGILTLTTDNYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI---GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +P  +   IP         ++ +H+   G    L++ N     MGNPHA+  V DD+   
Sbjct: 122 KPRFEPAEIPFTPKAITKIQNAYHLDVEGTPVQLYVAN-----MGNPHAVIKV-DDILTA 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VA 235
           D+   G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V   + 
Sbjct: 176 DVEKLGGAIESHPAFPEKVNVGFVQVMNQRHIRLRVYERGVGETQACGTGACAAVATGIR 235

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
            G L +    +  ++ GG LLI W     V MTG     +EG
Sbjct: 236 EGWLDE-GEEIRAQLYGGSLLIRWSPGYSVMMTGPTAFVYEG 276


>gi|325266086|ref|ZP_08132772.1| diaminopimelate epimerase [Kingella denitrificans ATCC 33394]
 gi|324982724|gb|EGC18350.1| diaminopimelate epimerase [Kingella denitrificans ATCC 33394]
          Length = 283

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 147/285 (51%), Gaps = 15/285 (5%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASV 60
           + + F+KM G+GN  +VID  G       DA    +  D      FDQ++L+       V
Sbjct: 2   TTLKFSKMHGLGNDFMVID--GTRQTFRPDAAQIQAWADRHTGIGFDQLLLVEKTDTPDV 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI N DG EV+ CGNG RC V+F++      +++   ET RGI+    N +G I+V
Sbjct: 60  DFRYRIFNADGGEVEQCGNGARCFVKFVSEHGLTDKRTIRVETARGIIEPSLNDNGLITV 119

Query: 119 DMGEPILDWKLIPLA-RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           +MG+P    + +P   RS ++     + +  VN L      ++SMGNPHA+  VED    
Sbjct: 120 NMGQPQFAPQDVPFVLRSGEQAGEKSYIV--VNELDSAQMSLLSMGNPHAVMLVEDTA-S 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +A +G  L  HP F   VN+   +V     + LR +ERG G T ACG+ ACA+VV SG
Sbjct: 177 APVAEWGAALQNHPRFPARVNVGFMQVVDAHHIRLRVFERGSGETQACGTGACAAVV-SG 235

Query: 238 C---LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
               L      V V + GG L I W +   V+MTG A   +EG+L
Sbjct: 236 VRWGLLAAGEDVRVSLPGGDLYIRWAEGEPVWMTGPAVTVFEGEL 280


>gi|71064780|ref|YP_263507.1| diaminopimelate epimerase [Psychrobacter arcticus 273-4]
 gi|123649755|sp|Q4FV85|DAPF_PSYA2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71037765|gb|AAZ18073.1| diaminopimelate epimerase [Psychrobacter arcticus 273-4]
          Length = 295

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 147/279 (52%), Gaps = 10/279 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+     ++T D +  L        FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLDLTKDLVQLLGDRHLGIGFDQLLVVEPPMRPDVDFS 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+ +R    ++    ET  GI+    +  G + VDMG
Sbjct: 62  YRIFNTDGTEVEQCGNGARCFARFVQARKLSFKQRLRVETASGIISLTTDHYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP         ++ +H+  VN   ++  +V +MGNPHA+  V DD+   D+ 
Sbjct: 122 KPKFEPSEIPFTPRATTKIQNAYHLD-VNGTPVQL-YVANMGNPHAVIKV-DDVLDADVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VASGC 238
           S G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V   +  G 
Sbjct: 179 SLGRAIESHPAFPERVNVGFMQVMNQRHIRLRVYERGVGETQACGTGACAAVAIGIREGW 238

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           L +    V  ++ GG ++I+W     V MTG     +EG
Sbjct: 239 LDE-GEDVRAQLYGGSMVIKWQPGYSVMMTGPTAFVYEG 276


>gi|99082649|ref|YP_614803.1| diaminopimelate epimerase [Ruegeria sp. TM1040]
 gi|99038929|gb|ABF65541.1| diaminopimelate epimerase [Ruegeria sp. TM1040]
          Length = 275

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 139/268 (51%), Gaps = 16/268 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASV--D 61
           M+ F KM G+GN  +VID R     IT      ++       FDQ+ +I    DAS   D
Sbjct: 1   MLPFMKMHGLGNDFVVIDARESDIEITPAMAKGIAHRQMGLGFDQLAVIAT-ADASTEAD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A +   N DGS   +CGN  RC+ R+L  +  + S    T RG+L+A +  +G  SV+MG
Sbjct: 60  AHLVFYNADGSTSGACGNATRCIARYLMDQSNKPSLRLTTDRGVLIATDAGEGLTSVNMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L W  IPLA   + ++       P+       P    MGNPH  FFVED      LA
Sbjct: 120 APQLSWDEIPLAEELETLEL------PIEGA----PSATGMGNPHCTFFVEDAEV-IPLA 168

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
            FG     HP++ E  N+ IA V     L +R WERGVG+T A GS++CA+ VA+     
Sbjct: 169 EFGPRYEHHPLYPERTNVQIAHVVGPNHLRMRVWERGVGITLASGSSSCATAVAAARKGL 228

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTG 269
           T R V + + GG L I+W D+  V+MTG
Sbjct: 229 TGRKVQIDLDGGTLWIDWRDDG-VWMTG 255


>gi|93005051|ref|YP_579488.1| diaminopimelate epimerase [Psychrobacter cryohalolentis K5]
 gi|122416051|sp|Q1QE99|DAPF_PSYCK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|92392729|gb|ABE74004.1| diaminopimelate epimerase [Psychrobacter cryohalolentis K5]
          Length = 295

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 152/280 (54%), Gaps = 12/280 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+     ++T D +  L        FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLDLTKDLVQLLGDRHLGIGFDQLLVVEPPMRPDVDFS 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+ +R    ++    ET  GI+    +R G + VDMG
Sbjct: 62  YRIFNTDGTEVEQCGNGARCFARFVQARKLSFKQRLRVETASGIISLTTDRYGWVEVDMG 121

Query: 122 EPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           +P  +   IP   R+  K+ ++ +H+  VN   ++  +V +MGNPHA+  V DD+   D+
Sbjct: 122 KPKFEPSEIPFTPRAITKI-QNAYHLD-VNGTPVQL-YVANMGNPHAVIKV-DDVLDADV 177

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VASG 237
            + G  +  HP F E VN+   ++ +   + LR +ERGVG T ACG+ ACA+V   +  G
Sbjct: 178 ETLGKAIESHPAFPERVNVGFMQIMNQRHIRLRVFERGVGETQACGTGACAAVAIGIREG 237

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
            L +    V  ++ GG ++I+W     V MTG     +EG
Sbjct: 238 WLDE-GEDVRAQLYGGSMVIKWQPGYSVMMTGPTAFVYEG 276


>gi|163737876|ref|ZP_02145292.1| Diaminopimelate epimerase [Phaeobacter gallaeciensis BS107]
 gi|161388492|gb|EDQ12845.1| Diaminopimelate epimerase [Phaeobacter gallaeciensis BS107]
          Length = 267

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 137/261 (52%), Gaps = 16/261 (6%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRIIN 68
           KM G+GN  +V+D R    +IT      ++       FDQ+ +I        DA +   N
Sbjct: 2   KMHGLGNDFVVVDARDQTWDITPAMAEGIAHRQMGIGFDQLTVI---TKGDEDAHLTFYN 58

Query: 69  CDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWK 128
            DGS   +CGN  RC+ R L     +      T RG+L+A++  +G  SV+MGEP LDW+
Sbjct: 59  ADGSTSAACGNATRCIARHLLDESGKTHLRLTTDRGLLLAEDAGNGLTSVNMGEPQLDWQ 118

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLA   D ++       P+       P    MGNPH  FFV D+     LA FG    
Sbjct: 119 DIPLAEDVDTLEL------PIE----GAPTATGMGNPHCTFFV-DNAEVIPLAEFGARYE 167

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
            HP++ E  N+ +A V + + L +R WERGVG+T A GS++CA+ VA+     T+R V +
Sbjct: 168 HHPLYPERTNVQVAHVVAPDHLRMRVWERGVGITLASGSSSCATAVAAARRGLTSRKVQI 227

Query: 249 KMLGGGLLIEWHDNNHVFMTG 269
            + GG L I+W  +  V+MTG
Sbjct: 228 DLDGGTLWIDWRKDG-VWMTG 247


>gi|16332245|ref|NP_442973.1| diaminopimelate epimerase [Synechocystis sp. PCC 6803]
 gi|2494041|sp|P74667|DAPF_SYNY3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|1653875|dbj|BAA18785.1| diaminopimelate epimerase [Synechocystis sp. PCC 6803]
          Length = 279

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 155/286 (54%), Gaps = 19/286 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F+K  G+GN  +++D R   +  +T D    L    + HF    D ++     Q  + 
Sbjct: 3   LSFSKYHGLGNDFILVDNRQSTEPCLTPDQAQQLC---DRHFGIGADGVIFALPGQGGT- 58

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETIRGILVAKENRDGSISV 118
           D  +RI N DGSE + CGNG+RC+ +FL     ++ K++   T+ G++  +   DG + V
Sbjct: 59  DYTMRIFNSDGSEPEMCGNGIRCLAKFLADLEGVEEKTYRIHTLAGVITPQLLADGQVKV 118

Query: 119 DMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMGEP L  +LIP  LA + +K+      +             VSMGNPH + FV DD+ 
Sbjct: 119 DMGEPQLLAELIPTTLAPAGEKVVDLPLAVAGQTWAVT----CVSMGNPHCLTFV-DDVD 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             +L   G L   HP FS+  N    +V   + L +R WERG G+T ACG+ ACA+VVA+
Sbjct: 174 SLNLTEIGPLFEHHPQFSQRTNTEFIQVLGSDRLKMRVWERGAGITLACGTGACATVVAA 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
               + +R  +V++ GG L IEW   +N ++MTG A++ + G+ +I
Sbjct: 234 VLTGRGDRRCTVELPGGNLEIEWSAQDNRLYMTGPAQRVFSGQAEI 279


>gi|332976391|gb|EGK13241.1| diaminopimelate epimerase [Desmospora sp. 8437]
          Length = 280

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 148/287 (51%), Gaps = 14/287 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           M+ F KM G+GN  +V+            A            D ++ +      + D  +
Sbjct: 1   MMRFTKMHGLGNDFIVVTADTWPQEAPELARRLCDRRFGVGADGLVFL--LPSRAGDVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGS----ISV 118
           RI+N DGSE + CGN +RCV ++   R+   +K    ET  G+   +   DGS    I V
Sbjct: 59  RILNADGSEAEQCGNAVRCVAKYYYERISGAKKEIIVETGAGLQSVRLETDGSQVESICV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PIL+   +P+A   +++      IG  +  F      VSMGNPHA+ FV DD   +
Sbjct: 119 DMGRPILEADRVPVALEGERVVAHPVKIGEESFRFT----AVSMGNPHAVIFV-DDAAAF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            + ++G  L  HP+F    N+    V S   L++R WERGVG T ACG+ ACAS+VA+  
Sbjct: 174 PVETWGPRLETHPLFPNKTNVEFVTVHSPRELEMRVWERGVGPTLACGTGACASLVAAVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
               +R   V++ GG L IEW + ++ V+MTG A+  +EG+ +  +G
Sbjct: 234 NGTADRRARVRLKGGDLEIEWREGDDRVYMTGPARTVFEGEWNEGSG 280


>gi|83953199|ref|ZP_00961921.1| diaminopimelate epimerase [Sulfitobacter sp. NAS-14.1]
 gi|83842167|gb|EAP81335.1| diaminopimelate epimerase [Sulfitobacter sp. NAS-14.1]
          Length = 302

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 147/300 (49%), Gaps = 41/300 (13%)

Query: 6   VDFAKMEGIGNKILVIDMR--------------GCHDNITSDAINALST----------- 40
           + F KM G+GN  +V+D R                  +  +DA  AL             
Sbjct: 9   LPFMKMHGLGNDFVVLDARQKDVLDAREKVVLDARQTDARADAPPALPKVTPALAQAIGH 68

Query: 41  -DDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF 99
                 FDQ+ +I    + + DA +   N DGS   +CGN  RC+ RFL     +     
Sbjct: 69  RQFGVGFDQLAVI---TNGAADAHLTFFNADGSTSAACGNATRCIARFLMEETGKTQLHL 125

Query: 100 ETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV 159
            T RG L A++  +G  SV+MG P L W  IPLAR  D ++       P++      P  
Sbjct: 126 TTDRGDLAARDAGNGLTSVNMGHPQLGWDEIPLARQMDTLEL------PIDGA----PTA 175

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
             MGNPH  FFV DD+   DLA FG  +  H ++ E  N+ IA++   + + +R WERGV
Sbjct: 176 TGMGNPHCTFFV-DDVDAIDLAGFGPGIEHHALYPERTNVQIAQIIGPDHIRMRVWERGV 234

Query: 220 GLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           G+T A GS++CA+ VA+     T RAV + + GG L I+W ++  V+MTG +   + G L
Sbjct: 235 GITLASGSSSCATAVAAARRGLTGRAVRIDLDGGTLHIDWREDG-VWMTGPSAHVFSGVL 293


>gi|83942144|ref|ZP_00954606.1| diaminopimelate epimerase [Sulfitobacter sp. EE-36]
 gi|83847964|gb|EAP85839.1| diaminopimelate epimerase [Sulfitobacter sp. EE-36]
          Length = 302

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 147/300 (49%), Gaps = 41/300 (13%)

Query: 6   VDFAKMEGIGNKILVIDMR-----GCHDNITSDAINALSTDDNTH--------------- 45
           + F KM G+GN  +V+D R             DA +     D T                
Sbjct: 9   LPFMKMHGLGNDFVVLDAREKVVLDARQKEMLDARDGAVRADGTPALPKVTPALAQAIGH 68

Query: 46  ------FDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF 99
                 FDQ+ +I    + + DA +   N DGS   +CGN  RC+ RFL     +     
Sbjct: 69  RQFGVGFDQLAVI---TNGAADAHLTFFNADGSTSAACGNATRCIARFLMEETGKTQLHL 125

Query: 100 ETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV 159
            T RG L A++  +G  SV+MG P L+W  IPLAR  D ++       P++      P  
Sbjct: 126 TTDRGDLAARDAGNGLTSVNMGHPQLEWDEIPLARQMDTLEL------PIDGA----PTA 175

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
             MGNPH  FFV DD+   DLA FG  +  H ++ E  N+ IA++   + + +R WERGV
Sbjct: 176 TGMGNPHCTFFV-DDVDAIDLAGFGPGIEHHALYPERTNVQIAQIIGPDHIRMRVWERGV 234

Query: 220 GLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           G+T A GS++CA+ VA+     T RAV + + GG L I+W ++  V+MTG +   + G L
Sbjct: 235 GITLASGSSSCATAVAAARRGLTGRAVRIDLDGGTLHIDWREDG-VWMTGPSAHVFSGVL 293


>gi|254492257|ref|ZP_05105431.1| diaminopimelate epimerase [Methylophaga thiooxidans DMS010]
 gi|224462582|gb|EEF78857.1| diaminopimelate epimerase [Methylophaga thiooxydans DMS010]
          Length = 281

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 146/279 (52%), Gaps = 10/279 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +VID       +TS  I  LS        DQ++L+   Q A  D  
Sbjct: 1   MLKFSKMHGLGNDFVVIDAIEQTVELTSAQIQFLSDRRFGVGCDQLLLVEKPQTAEADFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV  CGNG RC  RF+  +    + +   ET  G++      DGS++VDMG
Sbjct: 61  YRIFNADGGEVAQCGNGARCFARFVRDKGLTTKDTIAVETASGLIYPTLQADGSVTVDMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +PI +   IP      + +    ++  ++    +    +SMGNPHA+  V DD+    + 
Sbjct: 121 KPIFEPAKIPF-----QAEEATTYMLTIDEHGKKEIAALSMGNPHAVMLV-DDVTVASVL 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  H  F E VN    ++   +S+ LR +ERG G T+ACG+ ACA+VV+      
Sbjct: 175 ELGPLIESHERFPERVNAGFMQIVDSDSIRLRVFERGAGETSACGTGACAAVVSGIKRGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
            N  V+V + GG L I W D +  V+MTG A+  ++G++
Sbjct: 235 LNTMVTVSLPGGDLQISWPDQDASVWMTGPAQHVFDGEI 273


>gi|145634839|ref|ZP_01790547.1| diaminopimelate epimerase [Haemophilus influenzae PittAA]
 gi|145268005|gb|EDK08001.1| diaminopimelate epimerase [Haemophilus influenzae PittAA]
          Length = 274

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 IANVEQLGPLLENHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V +LGG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLLGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|159045768|ref|YP_001534562.1| diaminopimelate epimerase [Dinoroseobacter shibae DFL 12]
 gi|157913528|gb|ABV94961.1| diaminopimelate epimerase [Dinoroseobacter shibae DFL 12]
          Length = 282

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 142/275 (51%), Gaps = 15/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R     ++   + AL+       FDQ+ +I    +A  DA +
Sbjct: 12  LPFFKMHGLGNDFVVIDARAAPRPVSDRLVAALADRHRGVGFDQLAVIAPAPEA--DAHL 69

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R +       +    T RG+L+A++  DG   V+MG+P 
Sbjct: 70  TFYNADGSTSAACGNATRCIARMILDETGATALRLSTDRGLLLAEDAGDGLTRVNMGQPQ 129

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             W  +PLA + D ++       P+       P    MGNPH  FFV D      L +FG
Sbjct: 130 TLWSEVPLAEAMDTLEL------PIEG----TPTATGMGNPHCTFFVAD-AEAIPLDTFG 178

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  N+ +A++   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 179 PRYEHHPLYPQRTNVQVAQIVGPDHIRMRVWERGVGVTLASGSSSCATGVAAARRGLTGR 238

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              + + GG L I+W ++  V+MTG     +EG+L
Sbjct: 239 KTRIDLDGGTLWIDWREDG-VWMTGPNMTVFEGRL 272


>gi|238022271|ref|ZP_04602697.1| hypothetical protein GCWU000324_02178 [Kingella oralis ATCC 51147]
 gi|237866885|gb|EEP67927.1| hypothetical protein GCWU000324_02178 [Kingella oralis ATCC 51147]
          Length = 314

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 150/290 (51%), Gaps = 25/290 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F+KM G+GN  +VID  G +   T ++ + ++   N HF    DQ++L+   Q  + D
Sbjct: 32  LKFSKMHGLGNDFMVID--GINQVFTPNSAH-IAAWANRHFGIGFDQLLLVERAQTPAAD 88

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EVQ CGNG RC  +F+  +    +     ET  GI+  +   +G ++VD
Sbjct: 89  FRYRIFNADGGEVQQCGNGARCFAKFVYDKGLTDKTHIAVETAAGIIKPQIQPNGLVTVD 148

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFL---RNPFV----VSMGNPHAIFFVE 172
           MG P +    IP     D  +      G + H  +   R P +    VSMGNPHA+  V 
Sbjct: 149 MGAPRVLPDDIPFRLPADGSET----AGALTHQIVWDNRQPAIAVSLVSMGNPHAVLRV- 203

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DD     +A  G  L +HP F E VN+   ++     + LR +ERG G T ACG+ ACA+
Sbjct: 204 DDTKTAPVAEIGAALQQHPQFPERVNVGFMQLLDPTHIALRVFERGAGETLACGTGACAA 263

Query: 233 VVA---SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           VVA    G L      V V + GG L ++WH  +HV MTGEA   ++G+L
Sbjct: 264 VVAGMRQGWL-AAGETVQVSLRGGDLFVQWHSGSHVMMTGEAVWVFDGEL 312


>gi|253575768|ref|ZP_04853103.1| diaminopimelate epimerase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251844811|gb|EES72824.1| diaminopimelate epimerase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 278

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 155/285 (54%), Gaps = 16/285 (5%)

Query: 6   VDFAKMEGIGNKILVI-DMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  LV    +   DN++  AI           D ++ I     A  D  +
Sbjct: 1   MEFTKMHGLGNDFLVFYGEQQLPDNVSELAIRWCDRYFGVGGDGLVFILPSDKA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL--VAKENRDG---SIS 117
           RIIN DG+E + CGN +RCV +++     + + S T ET+   +  V  +  DG   ++ 
Sbjct: 59  RIINSDGTEAEQCGNAIRCVAKYVYDNRLVDKDSVTIETLGAGVQQVTLQVEDGVVKTVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPILD   IP   + + +             F      VSMGNPH + +V DD  +
Sbjct: 119 VDMGEPILDGLTIPTTLNQNPVVSQPIETNGQEFKFT----AVSMGNPHCVIYV-DDAPN 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           +D+ ++G  L  HP F   +N+  A VT+ + +++R WERG G T ACG+ ACA++V+S 
Sbjct: 174 FDVTTWGPKLEVHPYFPRKINVEFATVTNRQRVEMRVWERGAGPTLACGTGACATLVSSV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               T+RA  + + GG L IEW + +NHV+MTG A+  ++G ++I
Sbjct: 234 LNGLTDRAAWIGLKGGDLFIEWDERDNHVYMTGPAEAVYKGSVEI 278


>gi|254488147|ref|ZP_05101352.1| diaminopimelate epimerase [Roseobacter sp. GAI101]
 gi|214045016|gb|EEB85654.1| diaminopimelate epimerase [Roseobacter sp. GAI101]
          Length = 298

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 145/283 (51%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMR--------GCHDNITSDAINALSTDD-NTHFDQIMLIHDFQ 56
           + F KM G+GN  +V+D R        G    +T     A+        FDQ+ +I    
Sbjct: 22  LPFMKMHGLGNDFVVLDARDSALLGKDGDSLQVTPALAQAVGHRHFGVGFDQLAVI---T 78

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSI 116
             + DA +   N DGS   +CGN  RC+ RFL     + S    T RG L A++  D   
Sbjct: 79  TGTGDAHLTFYNSDGSLSAACGNATRCIARFLMDETGKSSLHLTTDRGDLAAQDMGDRLT 138

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           +V+MG+P LDW+ IPLA + + ++       P++      P    MGNPH  FFV D L 
Sbjct: 139 AVNMGQPQLDWQDIPLAHAMETLEL------PID----GAPTATGMGNPHCTFFVAD-LA 187

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             DL  FG  +  HP++ E  N+ IA++   + + +R WERGVG+T A GS++CA+ VA+
Sbjct: 188 AIDLERFGPGIEHHPLYPERTNVQIAQIIGPDHIRMRVWERGVGITLASGSSSCATAVAA 247

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                T R V + + GG L I+W ++  V+MTG     + G L
Sbjct: 248 ARRGLTGRKVRIDLDGGTLHIDWREDG-VWMTGPTAHVFSGTL 289


>gi|126740999|ref|ZP_01756682.1| diaminopimelate epimerase [Roseobacter sp. SK209-2-6]
 gi|126717925|gb|EBA14644.1| diaminopimelate epimerase [Roseobacter sp. SK209-2-6]
          Length = 284

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/267 (35%), Positives = 140/267 (52%), Gaps = 16/267 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQ-DASVDAF 63
           + F KM G+GN  +V+D R    ++T      ++       FDQ+ LI   + ++  DA 
Sbjct: 12  LPFMKMHGLGNDFVVVDARHLKLDVTPALAKGIAHRRFGIGFDQLTLIESPKANSPADAH 71

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +   N DGS   +CGN  RCV R L +   +      T RG L+A ++ DG  SV+MG+P
Sbjct: 72  LLFYNADGSTSAACGNATRCVARHLMAESGKSELHLTTDRGDLLAHDSGDGLTSVNMGQP 131

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED-DLYHYDLAS 182
            L W  +PLA   D ++       P+       P    MGNPH  FFVE+ DL    L  
Sbjct: 132 QLLWDQVPLAEEVDTLEL------PIE----GGPTATGMGNPHCTFFVENADLI--PLEE 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG     HP++ E  N+ +A +   + + +R WERGVG+T A GS++CA+ VA+     T
Sbjct: 180 FGPRYEHHPLYPERTNVQVAHIVGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLT 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTG 269
            R V V + GG L I+W ++  V+MTG
Sbjct: 240 GRKVQVDLDGGTLWIDWREDG-VWMTG 265


>gi|323143040|ref|ZP_08077745.1| diaminopimelate epimerase [Succinatimonas hippei YIT 12066]
 gi|322417181|gb|EFY07810.1| diaminopimelate epimerase [Succinatimonas hippei YIT 12066]
          Length = 277

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 151/288 (52%), Gaps = 23/288 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F+KM G+GN  +V+D        + + I  LS       FDQ++L+    D  VD  
Sbjct: 2   ILKFSKMHGLGNDFMVVDGVTQKIFFSPELIKRLSDRHFGVGFDQLLLVEPPYDPEVDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEVQ CGNG RC VRF+       ++     T+ G+L  K N D S++V+MG
Sbjct: 62  YRIFNADGSEVQMCGNGARCFVRFVVDHGLTNKRDIKVSTVSGVLRLKLNNDDSVTVNMG 121

Query: 122 EPILDWKLIPL-----ARSFDKMDR--DRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            P LD + +P      + S++   +  D   IG            VSMGNPHA+  V+D 
Sbjct: 122 VPQLDPEKLPFKAEAQSESYELCVKGFDAVTIG-----------AVSMGNPHAVINVKD- 169

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    +   G+L+ KH  F E VN+  ++  +   ++LR +ERG G T ACG+ ACA+VV
Sbjct: 170 VKTAPVHELGSLVEKHERFPEKVNVGFSQKVNDHEINLRVFERGCGETLACGTGACAAVV 229

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           A    H+    V V + GG L I W   N+ V M+G A   +EG++ I
Sbjct: 230 AGIVQHRLVSPVKVNLPGGSLNISWDGKNSPVMMSGPAVLVYEGQIVI 277


>gi|294678992|ref|YP_003579607.1| diaminopimelate epimerase [Rhodobacter capsulatus SB 1003]
 gi|294477812|gb|ADE87200.1| diaminopimelate epimerase [Rhodobacter capsulatus SB 1003]
          Length = 277

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 137/273 (50%), Gaps = 17/273 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +VID R   + +T     AL        FDQ+ +I   + A  D  +  
Sbjct: 13  FLKMHGLGNDFVVIDARSGENPVTPALARALGDRHRGVGFDQLAVILPAEGA--DFTLEF 70

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS+  +CGN  RCV   +   + +   T  T RG L A+   DG +SV+MG PILD
Sbjct: 71  WNSDGSKAGACGNATRCVSDLMMRDLGKDRVTLTTARGRLSAERRADGLVSVNMGAPILD 130

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
              IP+A              P+      +P  V MGNPH +FFVED     D++  G  
Sbjct: 131 PAAIPVAAD------------PLALPLTGDPVAVGMGNPHCVFFVED-AETADVSGLGPK 177

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           +  HP+F E  N+  A +   + L +R WERG G+T ACGS  CA+ VA+     T R V
Sbjct: 178 IEHHPLFPERTNVEFASLIGPDHLRMRVWERGAGITLACGSGTCATAVAAHLRGLTGRRV 237

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + GG L I+W ++  V+MTG     +  +L
Sbjct: 238 IVDVDGGRLEIDWREDG-VWMTGPTALVFAAEL 269


>gi|302392607|ref|YP_003828427.1| diaminopimelate epimerase [Acetohalobium arabaticum DSM 5501]
 gi|302204684|gb|ADL13362.1| diaminopimelate epimerase [Acetohalobium arabaticum DSM 5501]
          Length = 279

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 159/294 (54%), Gaps = 26/294 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F KM G+GN  ++++  G +++I      A +  D  HF    D ++LI   +    D
Sbjct: 1   MEFTKMHGLGNDFVMVN--GFNEDIADPNQLAEAICDR-HFGVGADGLVLILPSKQEEAD 57

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGS 115
             +RI N DGSE + CGN +RC  ++L  R   ++     ET+ GI+V +    +++  +
Sbjct: 58  FRMRIFNPDGSEPEMCGNAIRCFGKYLYDRDLTEKTKIRVETLAGIIVPELIIEKDQVEA 117

Query: 116 ISVDMGEPILDWKLIPLAR-SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           + VDMG+P L    IP+   + DK+ +++  +    +        VSMGNPH + FV DD
Sbjct: 118 VQVDMGQPGLGSTDIPITGVNKDKVIKEKLEVENEEYEIT----AVSMGNPHTVIFV-DD 172

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
              + +   G  + +HP F E  N+    V +   + +R WERG G+T ACG+ AC S V
Sbjct: 173 ADDFPVTEVGPKIEEHPRFPEKTNVEFIEVMNRSEIKMRVWERGAGVTLACGTGACGSTV 232

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           AS     TN+ V V +LGG L IEW +++HV+MTG A+       ++  G+WIK
Sbjct: 233 ASILNDYTNQKVEVHLLGGDLTIEWTEDSHVYMTGPAE-------EVFVGEWIK 279


>gi|67920563|ref|ZP_00514083.1| Diaminopimelate epimerase [Crocosphaera watsonii WH 8501]
 gi|67858047|gb|EAM53286.1| Diaminopimelate epimerase [Crocosphaera watsonii WH 8501]
          Length = 278

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 148/286 (51%), Gaps = 19/286 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K +G+GN  +++D R  H    S +        + HF    D ++      D + D
Sbjct: 1   MEFTKYQGLGNDFILVDNR--HSTTPSLSPEEAVKLCDRHFGIGADGVIFALP-GDENSD 57

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR----MKRKSFTFETIRGILVAKENRDGSIS 117
             +RI N DGSE Q CGNG+RC+ RFL          KS+  +T+ GI++     +G + 
Sbjct: 58  YTMRIFNSDGSEPQMCGNGIRCLARFLAKLEGIDTTEKSYRIQTLAGIIIPNLEAEGQVK 117

Query: 118 VDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P L  K IP  L ++ +K+      +G  + L       VSMGNPH I FVED +
Sbjct: 118 VDMGTPFLLAKEIPTTLTKAEEKVIDQSLEVGDQSWLVT----CVSMGNPHCITFVED-V 172

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L + G     H +F E  N     V   + L +R WERG G+T ACG+ ACASVVA
Sbjct: 173 AKIPLETIGPKFEHHAVFPERTNTEFIEVVRRDYLKMRVWERGAGITLACGTGACASVVA 232

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLD 280
                  +R  +V++ GG L IEW   +N ++MTG A++ + G +D
Sbjct: 233 GVLTGHCDRLCTVELPGGCLTIEWSKKDNRLYMTGPAEEVFTGVID 278


>gi|254476623|ref|ZP_05090009.1| diaminopimelate epimerase [Ruegeria sp. R11]
 gi|214030866|gb|EEB71701.1| diaminopimelate epimerase [Ruegeria sp. R11]
          Length = 281

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 95/267 (35%), Positives = 138/267 (51%), Gaps = 16/267 (5%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +V+D R    +IT      ++       FDQ+ +I        DA
Sbjct: 10  TRLPFMKMHGLGNDFVVVDARDQSWDITPAMAEGIAHRQMGIGFDQLTVI---TKGDEDA 66

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +   N DGS   +CGN  RC+ R+L            T RG+L+A++  +G  SV+MG+
Sbjct: 67  HLTFYNADGSTSGACGNATRCIARYLLDESGTSKLRLTTDRGLLLAEDVGNGLTSVNMGQ 126

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P LDW+ IPLA   D ++       P+       P    MGNPH  FFVE+      LA 
Sbjct: 127 PQLDWQDIPLAEDVDTLEL------PIEG----TPTATGMGNPHCTFFVENAEV-IPLAE 175

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG     HP++ E  N+ +A V   + L +R WERGVG+T A GS++CA+ VA+     T
Sbjct: 176 FGARYEHHPLYPERTNVQVAHVVGPDHLRMRVWERGVGITLASGSSSCATAVAAVRRGLT 235

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTG 269
              V + + GG L ++W D+  V+MTG
Sbjct: 236 GHKVRIDLDGGTLWVDWRDDG-VWMTG 261


>gi|89052809|ref|YP_508260.1| diaminopimelate epimerase [Jannaschia sp. CCS1]
 gi|88862358|gb|ABD53235.1| diaminopimelate epimerase [Jannaschia sp. CCS1]
          Length = 281

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 141/275 (51%), Gaps = 15/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID RG    +T     AL        FDQ+ +I    D+ V+  +
Sbjct: 13  LPFLKMHGLGNDFVVIDARGVARAMTPALARALGDRHRGVGFDQLAVIETGTDSDVE--L 70

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R       +   T  T RG+L A +  DG  SV+MGEP+
Sbjct: 71  TFWNADGSTAGACGNATRCIARREMELTGKHRITLRTERGLLEAIDVGDGLTSVNMGEPV 130

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           + W+ IPL  + D ++       P++      P    MGNPH  FFVED     DL + G
Sbjct: 131 MGWRDIPLKGACDTLNL------PIDG----TPVATGMGNPHCTFFVED-ADAIDLETLG 179

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
               +HP+F +  N+  A V   + L +R WERGVG+T A GS++CA  V++     T R
Sbjct: 180 AKYERHPLFPQRTNVQFAHVVGPDHLRMRVWERGVGVTLASGSSSCAVAVSAARRGLTGR 239

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG + ++W  +  V+MTG     + G+L
Sbjct: 240 KVRLTLDGGEISVDWRSDG-VWMTGPTAHVFSGEL 273


>gi|304404135|ref|ZP_07385797.1| diaminopimelate epimerase [Paenibacillus curdlanolyticus YK9]
 gi|304347113|gb|EFM12945.1| diaminopimelate epimerase [Paenibacillus curdlanolyticus YK9]
          Length = 276

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 149/285 (52%), Gaps = 20/285 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIM---LIHDFQDASVDA 62
           ++F KM G+GN  +V      H  +  + ++ L+ D    F  I    L++     + D 
Sbjct: 1   MEFTKMHGLGNDFIVF---AGHQQLPEN-VSQLAIDLCNRFFGIGADGLVYILPSENADF 56

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETI-RGI----LVAKENRDGS 115
            +RIIN DGSE + CGN +RCV +++           T ETI  G+    L  K+ +  +
Sbjct: 57  KMRIINSDGSEAEQCGNAIRCVAKYVYDNGLTTNTDITIETIGAGVQQVQLNVKDGKVAT 116

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEPIL+   +P     D++      +      F      VSMGNPH + +V DD 
Sbjct: 117 VRVDMGEPILEGLKVPTTVDADRVIAHAIEVDGREFSFT----AVSMGNPHCVIYV-DDA 171

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
            ++DL ++G  L  HPMF   +N+    V S    D+R WERG G T ACG+ ACA+VV+
Sbjct: 172 ANFDLLTWGPKLETHPMFPRKINVEFVTVNSRSHTDMRVWERGAGPTLACGTGACATVVS 231

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           S     T+R  +V + GG L IEW + +NHV+MTG A + + G  
Sbjct: 232 SVLNGFTDRTATVSLKGGDLQIEWSEADNHVYMTGPAAEAFRGTF 276


>gi|308069686|ref|YP_003871291.1| diaminopimelate epimerase [Paenibacillus polymyxa E681]
 gi|305858965|gb|ADM70753.1| Diaminopimelate epimerase 2 (DAP epimerase 2) [Paenibacillus
           polymyxa E681]
          Length = 277

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 150/284 (52%), Gaps = 18/284 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIM--LIHDFQDASVDAF 63
           ++F KM G+GN  +V      H ++ S A        + HF      L++       D  
Sbjct: 1   MEFTKMNGLGNDFIVWFG---HQDLPSGASELAVRLCDRHFGVGADGLVYILPSEKADFC 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETI-RGI----LVAKENRDGSI 116
           +RIIN DGSE + CGN +RC  +++  R  + R+  T ET+  G+    L  +      +
Sbjct: 58  MRIINSDGSEAEQCGNAIRCAAKYVYDRKHINREQITIETLGAGVQQVELTVENGLVRRV 117

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEPIL+   IP      ++  +    G     F      VSMGNPH + +VED   
Sbjct: 118 KVDMGEPILEGLKIPTTLERTRVINEPIEAGGSGFCFT----AVSMGNPHCVIYVED-AP 172

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            +DL ++G  L  HP+F +  N+  A V S + +D+R WERG G T ACG+ ACA++VAS
Sbjct: 173 SFDLEAWGPKLECHPLFPKKTNVEFATVRSRKHIDMRVWERGAGPTLACGTGACATLVAS 232

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
                ++R   V + GG L IEW  D+NH++MTG A+  +EG+L
Sbjct: 233 VLNGYSDRHAIVSLKGGDLDIEWSEDDNHIYMTGPAEIVYEGRL 276


>gi|68171560|ref|ZP_00544937.1| Diaminopimelate epimerase [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999026|gb|EAM85700.1| Diaminopimelate epimerase [Ehrlichia chaffeensis str. Sapulpa]
          Length = 267

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 143/274 (52%), Gaps = 12/274 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M+DF KM G  N  ++ID R   + NI   AI    T      DQI++I + + A  D F
Sbjct: 1   MIDFIKMHGTSNDFVIIDCRKKSYSNINYKAIANRKT--GIGCDQIIIITESEKA--DCF 56

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           + I N DGS+V+ CGN  RCV   L++  +  + T E    IL      +  + V++G  
Sbjct: 57  MHIYNADGSKVEMCGNAARCVGYLLSNEKQDNNITIELSDRILSCLRTSENRVQVNIGVA 116

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              W  IP ++  D +     H+ P+    L +P  +++GNPHAIFFV D +    L   
Sbjct: 117 KFHWTDIPTSQECDTL-----HL-PIELEMLSDPVGINVGNPHAIFFV-DSIETIPLDKL 169

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  H +F +  N+SIA + S + + LR WERG G TA+CGS ACA++VA+     TN
Sbjct: 170 GPKLENHHLFPKRANISIAEIVSRDKIKLRVWERGTGETASCGSGACAALVAAIRRQYTN 229

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           +   V + GG LLI +  +N + M G     + G
Sbjct: 230 KTAVVCLQGGDLLISYQHDNTILMEGMVSYTFNG 263


>gi|254454521|ref|ZP_05067958.1| diaminopimelate epimerase [Octadecabacter antarcticus 238]
 gi|198268927|gb|EDY93197.1| diaminopimelate epimerase [Octadecabacter antarcticus 238]
          Length = 260

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 142/269 (52%), Gaps = 15/269 (5%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIIN 68
           KM G+GN  +VID R     +T   + A++       FDQ+ +I    DA  DA +   N
Sbjct: 2   KMHGLGNDFVVIDARDGVVRVTDAIVMAMADRHRGIGFDQLAVITKRDDA--DAHLTFYN 59

Query: 69  CDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWK 128
            DGS   +CGN  RC+ R++     +   T  T+RGIL+A +   G  S++MG+P L W+
Sbjct: 60  SDGSIAGACGNATRCIARYIMDETTKTDLTLTTVRGILLAHDAGGGMTSINMGQPQLTWQ 119

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLAR  D          P++      P    MGNPH  FFVED     DLA+ G L+ 
Sbjct: 120 EIPLARDVD------LDALPID----GAPMATGMGNPHCTFFVED-AEEVDLAAMGALIE 168

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
            HP++    N+  A +   + L +R WERGVG+T A GS++CA+ VA+     T R V +
Sbjct: 169 HHPLYPARTNVQFAHLVGPDHLRMRVWERGVGVTLASGSSSCATAVAAHRRGLTGRRVRI 228

Query: 249 KMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
            + GG + I+W  N+ V+MTG     + G
Sbjct: 229 DLDGGTIHIDWR-NDGVWMTGPTAHVFSG 256


>gi|254438027|ref|ZP_05051521.1| diaminopimelate epimerase [Octadecabacter antarcticus 307]
 gi|198253473|gb|EDY77787.1| diaminopimelate epimerase [Octadecabacter antarcticus 307]
          Length = 271

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 144/276 (52%), Gaps = 15/276 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
            S V F KM G+GN  +VID R     +T   + A++       FDQ+ ++    DA  D
Sbjct: 6   PSGVPFMKMHGLGNDFVVIDARDGVLRVTDAIVMAMADRHRGVGFDQLAVMKKRADA--D 63

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
             +   N DG+   +CGN  RC+ R +     +   T  T RGIL+A++   G  S++MG
Sbjct: 64  VHLTFYNADGTTAGACGNATRCIARHIMDETTKTDVTLTTDRGILLAQDAGGGMTSINMG 123

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L W+ IPLAR  D          P+N      P    MGNPH  FFVED     DLA
Sbjct: 124 LPQLTWQEIPLARDVD------LDALPIN----GAPMATGMGNPHCTFFVED-AEAIDLA 172

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G L+  HP++ +  N+  A +   + L +R WERGVG+T A GS++CA+ VA+     
Sbjct: 173 AMGALIEHHPIYPQRTNVQFAHLVGPDHLRMRVWERGVGVTLASGSSSCATAVAAHRKGL 232

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           T R+V + + GG + I+W D+  V+MTG     + G
Sbjct: 233 TGRSVRIDLDGGTIHIDWRDDG-VWMTGPTAHVFSG 267


>gi|254362348|ref|ZP_04978459.1| diaminopimelate epimerase [Mannheimia haemolytica PHL213]
 gi|261491829|ref|ZP_05988408.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261494700|ref|ZP_05991180.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153093932|gb|EDN74855.1| diaminopimelate epimerase [Mannheimia haemolytica PHL213]
 gi|261309665|gb|EEY10888.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261312484|gb|EEY13608.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 274

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 141/283 (49%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +  +T + I  LS       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGVTQNVYLTEEMIRTLSDRHRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIHVSTAKGKMVLSLQEDGKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  V DD+
Sbjct: 121 PIWEPSQVPFTANKFEK------------NYILRTELQTVLCGVVSMGNPHCVLQV-DDV 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+S  +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 KTAPVNELGPLLESHERFPERANISFMQVVNRNHVKLRVYERGAGETQACGSGACGTVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L+IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGLLDNKVQVDLPGGTLIIEWQGVGHPLYMTGDATHIYDG 270


>gi|310642749|ref|YP_003947507.1| diaminopimelate epimerase [Paenibacillus polymyxa SC2]
 gi|309247699|gb|ADO57266.1| Diaminopimelate epimerase [Paenibacillus polymyxa SC2]
          Length = 276

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 149/284 (52%), Gaps = 18/284 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFD--QIMLIHDFQDASVDAF 63
           ++F KM G+GN  +V      H  + SDA        + HF      L++       D  
Sbjct: 1   MEFTKMNGLGNDFIVWY---GHQELPSDASELAVRLCDRHFGIGADGLVYILPSDKADFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETI-RGI----LVAKENRDGSI 116
           +RIIN DGSE + CGN +RC  +++  R  + R+  T ET+  G+    L  +      +
Sbjct: 58  MRIINSDGSEAEQCGNAIRCAAKYVYDRKHINREQITIETLGAGVQQVELTVENGAVRMV 117

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEPIL+   IP       +  +    G     F      VSMGNPH + +VED   
Sbjct: 118 KVDMGEPILEGLKIPTTLDLTNVIDEPIEAGGSGFRFT----AVSMGNPHCVIYVED-AP 172

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            +DL ++G  L  HP+F +  N+  A V S + +D+R WERG G T ACG+ ACA++VAS
Sbjct: 173 SFDLEAWGPKLECHPLFPKKTNVEFATVRSRKHIDMRVWERGAGPTLACGTGACATLVAS 232

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
                ++R   V + GG L IEW  D+NH++MTG A+  +EG++
Sbjct: 233 VLNGYSDRRAMVSLKGGDLDIEWSEDDNHIYMTGPAEIVFEGRI 276


>gi|301169469|emb|CBW29069.1| diaminopimelate epimerase [Haemophilus influenzae 10810]
          Length = 274

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +   +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKNDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V +LGG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLLGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|226940775|ref|YP_002795849.1| DapF [Laribacter hongkongensis HLHK9]
 gi|254767108|sp|C1D8Q0|DAPF_LARHH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226715702|gb|ACO74840.1| DapF [Laribacter hongkongensis HLHK9]
          Length = 278

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 146/280 (52%), Gaps = 12/280 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KM+G+GN   V+D       +T + I  L        FDQ++L+   QDA  D   RI
Sbjct: 5   FTKMQGLGNDFAVLDGVRQTIRLTPEQIRKLGDRRFGIGFDQLLLVEPPQDAGNDFSYRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            NCDG EV+ CGNG RC  RF+       R+    ET RG++V +   DG ++VDMG P 
Sbjct: 65  FNCDGGEVEQCGNGARCFARFVFDHGLTDRREIRVETARGVIVPRLADDGLVTVDMGPPR 124

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
                IP   + D +  +    G +  +      VVSMGNPHA+  V DD+    + +FG
Sbjct: 125 FRPADIPFVAAEDAVIHELEVAGQILGV-----TVVSMGNPHAVQVV-DDVDTAPVTAFG 178

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS--GCLHKT 242
            L+  H  F   VN    ++ S  ++ LR +ERG G T ACG+ ACA+VVA     L   
Sbjct: 179 PLIENHLRFPARVNAGFMQIESRTAICLRVFERGSGETLACGTGACAAVVAGIRRGLLDA 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V+V+  GG L I W  + H V+MTG A   +EG++ +
Sbjct: 239 DTPVTVQTRGGELRIRWAGDGHPVWMTGPAVTVFEGEITL 278


>gi|89895489|ref|YP_518976.1| hypothetical protein DSY2743 [Desulfitobacterium hafniense Y51]
 gi|89334937|dbj|BAE84532.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 287

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 144/284 (50%), Gaps = 17/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++  KM G+GN  + ID          D         +  F    D ++++     A  D
Sbjct: 5   MEIVKMHGLGNDFVFIDHFQGAPAELPDYPELARKLCHRQFGVGGDGLIMVLPSDKA--D 62

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----S 115
           A +RI+N DGSE + CGNG+RC  R++  +  + +     ET+ GIL  + +  G     
Sbjct: 63  ARMRILNSDGSEPEMCGNGIRCFARYIYDQGYVSKNPLQVETLAGILTLQLSITGDQVTG 122

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEPIL  + +P+    D +   R  +      F      VSMGNPH + FVED  
Sbjct: 123 VRVDMGEPILKSEQVPVLIQGDPVVGARLDVDGQEFEFT----AVSMGNPHCVLFVED-Y 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              D    G  + KHP+F    N+    V S   L ++ WERG G T ACG+ ACASVVA
Sbjct: 178 ETLDFERIGPAIEKHPLFPRKTNVEFIIVNSPRELTMKVWERGAGPTLACGTGACASVVA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +    +T R V+V + GG LLIEW ++N V+MTG A   ++G L
Sbjct: 238 AVLNGRTERKVTVHLPGGDLLIEWGEDNRVYMTGPAAYVFKGVL 281


>gi|125975578|ref|YP_001039488.1| diaminopimelate epimerase [Clostridium thermocellum ATCC 27405]
 gi|256005917|ref|ZP_05430862.1| diaminopimelate epimerase [Clostridium thermocellum DSM 2360]
 gi|281416590|ref|ZP_06247610.1| diaminopimelate epimerase [Clostridium thermocellum JW20]
 gi|254767097|sp|A3DK16|DAPF_CLOTH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|125715803|gb|ABN54295.1| diaminopimelate epimerase [Clostridium thermocellum ATCC 27405]
 gi|255990121|gb|EEU00258.1| diaminopimelate epimerase [Clostridium thermocellum DSM 2360]
 gi|281407992|gb|EFB38250.1| diaminopimelate epimerase [Clostridium thermocellum JW20]
 gi|316939697|gb|ADU73731.1| diaminopimelate epimerase [Clostridium thermocellum DSM 1313]
          Length = 280

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 154/288 (53%), Gaps = 27/288 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  + ++   C +    +         + HF    D ++LI   + A  D  
Sbjct: 3   FTKMHGLGNDYIYVN---CFEETVENPSEVAKKVSDRHFGIGSDGLVLIMPSERA--DFK 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +R+ N DGSE + CGN +RCV +++  R    +     ET+ GI    L  ++ +   + 
Sbjct: 58  MRMFNSDGSEAEMCGNAIRCVGKYVFDRGMTNKNVIRVETLAGIKVLELTVQDGKAKLVK 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVEDD 174
           VDMGEPIL  + IP+       D++ F   PV      F      VSMGNPHA+ +V++ 
Sbjct: 118 VDMGEPILKPENIPV-----NSDKEIFRTEPVEIDGKEFKVT--CVSMGNPHAVSYVKN- 169

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +  + L   G  +  HP+F + +N     V    +L +R WERG G T ACG+ ACA +V
Sbjct: 170 VDIFPLEKIGPKMEHHPLFPKRINAEFVEVIDRTTLKMRVWERGAGETLACGTGACAVLV 229

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           AS     + R  +VK+LGG L+IEW++ NNHV+MTG A K +EG++D+
Sbjct: 230 ASVLNGVSERKATVKLLGGDLIIEWNENNNHVYMTGPAVKVFEGEVDL 277


>gi|23099809|ref|NP_693275.1| diaminopimelate epimerase [Oceanobacillus iheyensis HTE831]
 gi|29839324|sp|Q8ENX2|DAPF_OCEIH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|22778040|dbj|BAC14310.1| diaminopimelate epimerase [Oceanobacillus iheyensis HTE831]
          Length = 286

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 147/279 (52%), Gaps = 19/279 (6%)

Query: 6   VDFAKMEGIGNKILVIDM--RGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDA 62
           + F KM G+GN  + ID+      + +  D AI           D ++LIH   DA  D 
Sbjct: 3   IPFTKMHGLGNNYVYIDLFDYAIDEKLYHDLAIQISDVYTGIGSDGMILIHPTTDA--DV 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGSI 116
            +RI N DGSE +SCGNG+RC  ++      +  K F  +T   I+ A+     N+   +
Sbjct: 61  GMRIFNKDGSEGKSCGNGLRCTAKYAYENGIVTNKKFHIQTKANIVEAEVSVDNNKVNQV 120

Query: 117 SVDMGEPILDWKLIPLARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           ++DMGEPIL    IP+  + D K+  + F +             VSMGNPH +FFV DD+
Sbjct: 121 TIDMGEPILARNEIPMMGNNDVKVVNEPFVVAGETQYIT----AVSMGNPHGVFFV-DDI 175

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L + G  + K   F E +N+    V S   L+ R WERG G+T ACG+ ACA+VVA
Sbjct: 176 EKAPLETLGPTIEKDMRFPESINVEFIEVVSPTELNFRVWERGSGITQACGTGACAAVVA 235

Query: 236 SGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAK 272
           +    K  ++  + V + GG L IEW ++NHV+MTG A+
Sbjct: 236 ATLNEKVTKSHPIVVHLAGGDLNIEWKEDNHVWMTGPAE 274


>gi|163743348|ref|ZP_02150728.1| diaminopimelate epimerase [Phaeobacter gallaeciensis 2.10]
 gi|161383342|gb|EDQ07731.1| diaminopimelate epimerase [Phaeobacter gallaeciensis 2.10]
          Length = 281

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 95/267 (35%), Positives = 139/267 (52%), Gaps = 16/267 (5%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +V+D R    +IT      ++       FDQ+ +I        DA
Sbjct: 10  TRLPFMKMHGLGNDFVVVDARDQTWDITPAMAAGIAHRQMGIGFDQLTVI---TKGDEDA 66

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +   N DGS   +CGN  RC+ R L     +      T RG+L+A++  +G  SV+MG+
Sbjct: 67  HLTFYNADGSTSAACGNATRCIARHLLDESGKTHLRLTTDRGLLLAEDAGNGLTSVNMGQ 126

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P LDW+ IPLA   D ++       P+       P    MGNPH  FFV +      LA 
Sbjct: 127 PQLDWQDIPLAEDVDTLEL------PIEGA----PTATGMGNPHCTFFVGNAEV-IPLAE 175

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG     HP++ E  N+ +A V + + L +R WERGVG+T A GS++CA+ VA+     T
Sbjct: 176 FGARYEHHPLYPERTNVQVAHVVAPDHLRMRVWERGVGITLASGSSSCATAVAAARRGLT 235

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTG 269
            R V + + GG L I+W ++  V+MTG
Sbjct: 236 GRKVQIDLDGGTLWIDWREDG-VWMTG 261


>gi|145628368|ref|ZP_01784169.1| diaminopimelate epimerase [Haemophilus influenzae 22.1-21]
 gi|144980143|gb|EDJ89802.1| diaminopimelate epimerase [Haemophilus influenzae 22.1-21]
          Length = 274

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIQRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G ++     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMILTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GTVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHVYDG 270


>gi|309973754|gb|ADO96955.1| Diaminopimelate epimerase [Haemophilus influenzae R2846]
          Length = 274

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G+LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGSLLENHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|325288871|ref|YP_004265052.1| diaminopimelate epimerase [Syntrophobotulus glycolicus DSM 8271]
 gi|324964272|gb|ADY55051.1| diaminopimelate epimerase [Syntrophobotulus glycolicus DSM 8271]
          Length = 282

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 148/293 (50%), Gaps = 32/293 (10%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIH------------ 53
           +DF KM G+GN  +      C D     A N  +  D +   Q  L H            
Sbjct: 1   MDFIKMHGLGNDFV------CLDRFLDPAENNPAETDYSELAQ-RLCHRQLGIGGDGLLL 53

Query: 54  DFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LV 107
                  DA +RI N DGSE + CGNG+RC  R++  +  +++   T ET+ GI    L 
Sbjct: 54  ILPSEKADARMRIFNADGSEPEMCGNGIRCFARYIYEQGYVQKDQLTVETLAGIKPIRLQ 113

Query: 108 AKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPH 166
            K+ R   ++VDMG+P L  K IP+    D++   R  + G    +       VS+GNPH
Sbjct: 114 MKDGRVYGVTVDMGKPRLSAKEIPVNDHSDRVVNKRLEVLGKEIGIT-----AVSVGNPH 168

Query: 167 AIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
            + F+ DD    D+ + G  L KHP F    N+   RV S E + ++ WERGVG T ACG
Sbjct: 169 CVLFL-DDFAETDVLAVGAALEKHPFFPAKTNVEFVRVDSGEEITVKVWERGVGPTLACG 227

Query: 227 SAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           + ACASVVA+    +T R ++V + GG L IE+ +   + MTG A+  + G+L
Sbjct: 228 TGACASVVAAVLNGRTGRRLTVHLPGGDLQIEYAEEGRILMTGPAQYVFRGQL 280


>gi|85708150|ref|ZP_01039216.1| diaminopimelate epimerase [Erythrobacter sp. NAP1]
 gi|85689684|gb|EAQ29687.1| diaminopimelate epimerase [Erythrobacter sp. NAP1]
          Length = 269

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 141/282 (50%), Gaps = 27/282 (9%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLI-----HDFQDA 58
           VDF KM G+GN  +V+D R       S+A  +   D NT    DQ++++     HDF+  
Sbjct: 3   VDFTKMHGLGNDFVVLDARETPLPAISNATASALADRNTGVGCDQLIVLEPSDDHDFR-- 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISV 118
                +RI N DG EV++CGN  R V     + +     T ET  G  +  E   G  SV
Sbjct: 61  -----MRIYNSDGGEVEACGNASRAV-----AMLHGSPATVETAGGA-IRLEPAQGGASV 109

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEP  +W  IPLA + D  +       PV    L     V++GNPH IFFV+D     
Sbjct: 110 DMGEPRFEWDAIPLAYAMDTANM------PVGWGELEAGIAVNVGNPHVIFFVQD-ADAV 162

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DLA  G  +    +F E +N+++A   S   L LR WERG GLT ACG+ ACA+ VA+  
Sbjct: 163 DLAELGPQIETDALFPERINVNVASRLSDNHLKLRVWERGAGLTRACGTGACATAVAAIS 222

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
                  V+V + GG L I W     + MTG A + + G  +
Sbjct: 223 RLHMKSPVTVSLPGGDLEIAWERGESIVMTGPATESFRGSFE 264


>gi|303242859|ref|ZP_07329323.1| diaminopimelate epimerase [Acetivibrio cellulolyticus CD2]
 gi|302589605|gb|EFL59389.1| diaminopimelate epimerase [Acetivibrio cellulolyticus CD2]
          Length = 277

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/295 (34%), Positives = 156/295 (52%), Gaps = 41/295 (13%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+G+GN  + ++   C      +         + HF    D ++LI   Q    D  
Sbjct: 3   FTKMQGLGNDYIYVN---CFTEKVDNPSEVAKFVSDRHFGVGSDGLVLIMPSQ--MCDFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR-MKRKS-FTFETIRGI----LVAKENRDGSIS 117
           +R+ N DGSE + CGN +RCV +F+    M +KS    ET+ GI    +  K+N+   + 
Sbjct: 58  MRMFNSDGSEAEMCGNAIRCVGKFVYDNGMTQKSVIKVETLAGIKVLDMTVKDNKVELVK 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----------VSMGNPHA 167
           VDMGEPIL+   IP+  +                LF+  P V          VSMGNPHA
Sbjct: 118 VDMGEPILEPAKIPVDSN--------------KELFVSQPVVIDGREFKVTCVSMGNPHA 163

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           + +V DD+  + L   G  +  + ++ + +N    +V   ++L +R WERG G T ACG+
Sbjct: 164 VTYV-DDVEKFPLEVVGPKMENNSLYPKRINAEFVQVIDRDTLKMRVWERGAGETLACGT 222

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
            ACA +V+S     +NR V VK+LGG L+IEW++ +NHV+MTG A K ++G +D+
Sbjct: 223 GACAVLVSSVLNDISNRKVVVKLLGGDLIIEWNEKDNHVYMTGPATKVFDGDIDV 277


>gi|183220003|ref|YP_001837999.1| diaminopimelate epimerase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|167778425|gb|ABZ96723.1| Diaminopimelate epimerase (DAP epimerase) [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 286

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 149/284 (52%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           ++F KMEGIGN  + ID       ++ + I  LS D N       +I      S +  + 
Sbjct: 9   INFTKMEGIGNDYVYIDATKNDIRLSPEQIQKLS-DRNFGIGGDGVIFIRNSNSGEFQMD 67

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA--KENRDGSI---SV 118
           + N DGS  + CGNG+RCV +F+      K +  T ET +G+L    K   +G +   +V
Sbjct: 68  MYNSDGSSSEMCGNGVRCVGKFVYDHGLTKNQKPTIETGKGVLTLDLKTGTNGKVEMVTV 127

Query: 119 DMGEPILDWKLIPLARSFDKMDRDR-FHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           DMGEPIL   L+P+    D+   ++   +    + F      VSMGNPH + +V DD   
Sbjct: 128 DMGEPILKPSLVPIVWKGDEPVINQVIEVQGKQYHFT----AVSMGNPHCVIYV-DDADD 182

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++  HP F   VN+    +   + L  RTWERG G T ACG+ ACA  VAS 
Sbjct: 183 FPVREIGPIIENHPFFPRRVNVEFVSIKGKDHLYQRTWERGTGETLACGTGACAVTVASI 242

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              KT R+V + + GG L IEW +N  VFMTG AK+ + G+++I
Sbjct: 243 LNGKTGRSVRIDLRGGTLHIEWQENGSVFMTGPAKEVFSGEVEI 286


>gi|126176183|ref|YP_001052332.1| diaminopimelate epimerase [Shewanella baltica OS155]
 gi|153002476|ref|YP_001368157.1| diaminopimelate epimerase [Shewanella baltica OS185]
 gi|160877193|ref|YP_001556509.1| diaminopimelate epimerase [Shewanella baltica OS195]
 gi|217975043|ref|YP_002359794.1| diaminopimelate epimerase [Shewanella baltica OS223]
 gi|304412535|ref|ZP_07394141.1| diaminopimelate epimerase [Shewanella baltica OS183]
 gi|307307194|ref|ZP_07586932.1| diaminopimelate epimerase [Shewanella baltica BA175]
 gi|166225754|sp|A3D9Q0|DAPF_SHEB5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166225755|sp|A6WTF5|DAPF_SHEB8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082840|sp|A9L5F5|DAPF_SHEB9 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767120|sp|B8E690|DAPF_SHEB2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|125999388|gb|ABN63463.1| diaminopimelate epimerase [Shewanella baltica OS155]
 gi|151367094|gb|ABS10094.1| Diaminopimelate epimerase [Shewanella baltica OS185]
 gi|160862715|gb|ABX51249.1| Diaminopimelate epimerase [Shewanella baltica OS195]
 gi|217500178|gb|ACK48371.1| Diaminopimelate epimerase [Shewanella baltica OS223]
 gi|304349177|gb|EFM13589.1| diaminopimelate epimerase [Shewanella baltica OS183]
 gi|306910433|gb|EFN40864.1| diaminopimelate epimerase [Shewanella baltica BA175]
 gi|315269397|gb|ADT96250.1| diaminopimelate epimerase [Shewanella baltica OS678]
          Length = 275

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 145/283 (51%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIQFTKMHGLGNDFMVVD--GVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG+EV+ CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+
Sbjct: 59  FHYRIFNADGTEVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVN 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG PIL+   IP      K ++      P+           SMGNPH +  VED +    
Sbjct: 119 MGVPILEPSQIPFKAK--KPEKTYLLQTPMQTFLCG---AASMGNPHCVLDVED-VASAS 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G +L KH  F  GVN+   +V     + LR +ERG   T ACG+ ACA+VV     
Sbjct: 173 VAEIGAMLTKHERFPRGVNVGFMQVVDSGHIKLRVYERGAAETLACGTGACAAVVVGQVQ 232

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K  + V V + GG L I W  +   ++MTG A+  ++G++ +
Sbjct: 233 GKLGQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|16272691|ref|NP_438909.1| diaminopimelate epimerase [Haemophilus influenzae Rd KW20]
 gi|68249347|ref|YP_248459.1| diaminopimelate epimerase [Haemophilus influenzae 86-028NP]
 gi|145632103|ref|ZP_01787838.1| diaminopimelate epimerase [Haemophilus influenzae 3655]
 gi|145638454|ref|ZP_01794064.1| diaminopimelate epimerase [Haemophilus influenzae PittII]
 gi|145640834|ref|ZP_01796416.1| diaminopimelate epimerase [Haemophilus influenzae R3021]
 gi|260579841|ref|ZP_05847671.1| diaminopimelate epimerase [Haemophilus influenzae RdAW]
 gi|260583154|ref|ZP_05850934.1| diaminopimelate epimerase [Haemophilus influenzae NT127]
 gi|319775309|ref|YP_004137797.1| diaminopimelate epimerase [Haemophilus influenzae F3047]
 gi|329122695|ref|ZP_08251273.1| diaminopimelate epimerase [Haemophilus aegyptius ATCC 11116]
 gi|1169225|sp|P44859|DAPF_HAEIN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|81336228|sp|Q4QME8|DAPF_HAEI8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33356940|pdb|1GQZ|A Chain A, Refinement Of Haemophilus Influenzae Diaminopimelate
           Epimerase At 1.7a
 gi|109157880|pdb|2GKE|A Chain A, Crystal Structure Of Diaminopimelate Epimerase In Complex
           With An Irreversible Inhibitor Ll-Azidap
 gi|109157881|pdb|2GKJ|A Chain A, Crystal Structure Of Diaminopimelate Epimerase In Complex
           With An Irreversible Inhibitor Dl-Azidap
 gi|1573758|gb|AAC22409.1| diaminopimelate epimerase (dapF) [Haemophilus influenzae Rd KW20]
 gi|68057546|gb|AAX87799.1| diaminopimelate epimerase [Haemophilus influenzae 86-028NP]
 gi|144987010|gb|EDJ93540.1| diaminopimelate epimerase [Haemophilus influenzae 3655]
 gi|145272783|gb|EDK12690.1| diaminopimelate epimerase [Haemophilus influenzae PittII]
 gi|145274348|gb|EDK14212.1| diaminopimelate epimerase [Haemophilus influenzae 22.4-21]
 gi|260093125|gb|EEW77058.1| diaminopimelate epimerase [Haemophilus influenzae RdAW]
 gi|260093772|gb|EEW77680.1| diaminopimelate epimerase [Haemophilus influenzae NT127]
 gi|309751589|gb|ADO81573.1| Diaminopimelate epimerase [Haemophilus influenzae R2866]
 gi|317449900|emb|CBY86112.1| diaminopimelate epimerase [Haemophilus influenzae F3047]
 gi|327472569|gb|EGF17999.1| diaminopimelate epimerase [Haemophilus aegyptius ATCC 11116]
          Length = 274

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|219669923|ref|YP_002460358.1| diaminopimelate epimerase [Desulfitobacterium hafniense DCB-2]
 gi|254767101|sp|B8FSD4|DAPF_DESHD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219540183|gb|ACL21922.1| Diaminopimelate epimerase [Desulfitobacterium hafniense DCB-2]
          Length = 283

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 143/284 (50%), Gaps = 17/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++  KM G+GN  + ID          D         +  F    D ++++        D
Sbjct: 1   MEIVKMHGLGNDFVFIDHFQGAPAELPDYPELARKLCHRQFGVGGDGLIMV--LPSDKAD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----S 115
           A +RI+N DGSE + CGNG+RC  R++  +  + +     ET+ GIL  + +  G     
Sbjct: 59  ARMRILNSDGSEPEMCGNGIRCFARYIYDQGYVSQNPLQVETLAGILTLQLSITGDQVTG 118

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEPIL  + +P+    D +   R  +      F      VSMGNPH + FVED  
Sbjct: 119 VRVDMGEPILKSEQVPVLIQGDPVVGARLDVDGQEFEFT----AVSMGNPHCVLFVED-Y 173

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              D    G  + KHP+F    N+    V S   L ++ WERG G T ACG+ ACASVVA
Sbjct: 174 ETLDFERIGPAIEKHPLFPRKTNVEFIIVNSPRELTMKVWERGAGPTLACGTGACASVVA 233

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +    +T R V+V + GG LLIEW ++N V+MTG A   ++G L
Sbjct: 234 AVLNGRTERKVTVHLPGGDLLIEWGEDNRVYMTGPAAYVFKGVL 277


>gi|73666659|ref|YP_302675.1| diaminopimelate epimerase [Ehrlichia canis str. Jake]
 gi|72393800|gb|AAZ68077.1| diaminopimelate epimerase [Ehrlichia canis str. Jake]
          Length = 267

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 146/274 (53%), Gaps = 12/274 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M+DF KM G  N  ++ID R   ++NI   AI    T      DQI++I   + A  D F
Sbjct: 1   MIDFIKMHGTLNDFVIIDCRSKFYNNIDYKAIANRKT--GIGCDQIIVITKSEKA--DCF 56

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           + I N DGS+V+ CGN  RCV   L++  ++ + T E    IL      + ++ V+MG  
Sbjct: 57  MHIYNADGSKVEMCGNAARCVAYLLSNEKQKNNVTIELADRILSCLRISENTVQVNMGIA 116

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              W  IP+++  D +     H+ P+    L +P  +++GNPHAIFFV + +    L   
Sbjct: 117 KFHWTDIPISQECDTL-----HL-PITLEMLSDPVGINVGNPHAIFFV-NSIETIPLDKL 169

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  H +F +  N+SIA + S   + LR WERG G TA+CGS ACA++VA+     T+
Sbjct: 170 GPKLENHNLFPKRANISIAEILSRNKIKLRVWERGTGETASCGSGACAALVAAVRRQYTD 229

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
              ++ + GG LLI + ++N + M G     + G
Sbjct: 230 TTATICLQGGNLLISYQNDNTILMEGMVSYTFHG 263


>gi|189910124|ref|YP_001961679.1| diaminopimelate epimerase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|226724214|sp|B0SC36|DAPF_LEPBA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167774800|gb|ABZ93101.1| Diaminopimelate epimerase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
          Length = 280

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 149/284 (52%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           ++F KMEGIGN  + ID       ++ + I  LS D N       +I      S +  + 
Sbjct: 3   INFTKMEGIGNDYVYIDATKNDIRLSPEQIQKLS-DRNFGIGGDGVIFIRNSNSGEFQMD 61

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA--KENRDGSI---SV 118
           + N DGS  + CGNG+RCV +F+      K +  T ET +G+L    K   +G +   +V
Sbjct: 62  MYNSDGSSSEMCGNGVRCVGKFVYDHGLTKNQKPTIETGKGVLTLDLKTGTNGKVEMVTV 121

Query: 119 DMGEPILDWKLIPLARSFDKMDRDR-FHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           DMGEPIL   L+P+    D+   ++   +    + F      VSMGNPH + +V DD   
Sbjct: 122 DMGEPILKPSLVPIVWKGDEPVINQVIEVQGKQYHFT----AVSMGNPHCVIYV-DDADD 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++  HP F   VN+    +   + L  RTWERG G T ACG+ ACA  VAS 
Sbjct: 177 FPVREIGPIIENHPFFPRRVNVEFVSIKGKDHLYQRTWERGTGETLACGTGACAVTVASI 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              KT R+V + + GG L IEW +N  VFMTG AK+ + G+++I
Sbjct: 237 LNGKTGRSVRIDLRGGTLHIEWQENGSVFMTGPAKEVFSGEVEI 280


>gi|148827940|ref|YP_001292693.1| diaminopimelate epimerase [Haemophilus influenzae PittGG]
 gi|166224260|sp|A5UHQ4|DAPF_HAEIG RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148719182|gb|ABR00310.1| diaminopimelate epimerase [Haemophilus influenzae PittGG]
          Length = 274

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLSGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|88658257|ref|YP_506881.1| diaminopimelate epimerase [Ehrlichia chaffeensis str. Arkansas]
 gi|88599714|gb|ABD45183.1| diaminopimelate epimerase [Ehrlichia chaffeensis str. Arkansas]
          Length = 267

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 143/274 (52%), Gaps = 12/274 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M+DF KM G  N  ++ID R   + NI   AI    T      DQI++I + + A  D F
Sbjct: 1   MIDFIKMHGTSNDFVIIDCRKKSYSNINYKAIANRKT--GIGCDQIIIITESEKA--DCF 56

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           + I N DGS+V+ CGN  RCV   L++  +  + T E    IL      +  + V++G  
Sbjct: 57  MHIYNADGSKVEMCGNAARCVGYLLSNEKQDNNITIELSDRILSCLRTSENRVQVNIGVA 116

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              W  IP ++  D +     H+ P+    L +P  +++GNPHAIFFV D +    L   
Sbjct: 117 KFHWTDIPTSQECDTL-----HL-PIELEMLSDPVGINVGNPHAIFFV-DSIETIPLDKL 169

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  H +F +  N+SIA + S + + LR WERG G TA+CGS ACA++VA+     TN
Sbjct: 170 GPKLENHHLFPKRANISIAEIVSRDKIKLRVWERGTGETASCGSGACAALVAAIRRQYTN 229

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           +   V + GG LLI +  +N + M G     + G
Sbjct: 230 KTAVVCLQGGDLLISYQHDNTILMEGMVSYIFNG 263


>gi|229845797|ref|ZP_04465909.1| diaminopimelate epimerase [Haemophilus influenzae 7P49H1]
 gi|229810801|gb|EEP46518.1| diaminopimelate epimerase [Haemophilus influenzae 7P49H1]
          Length = 274

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 145/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNTGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|120553432|ref|YP_957783.1| diaminopimelate epimerase [Marinobacter aquaeolei VT8]
 gi|120323281|gb|ABM17596.1| diaminopimelate epimerase [Marinobacter aquaeolei VT8]
          Length = 308

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 149/286 (52%), Gaps = 12/286 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASV 60
           Q  ++ F KM G+GN  +V+D       +  D I  L+  +    FDQ++++       V
Sbjct: 8   QGPVLRFTKMHGLGNDFMVVDAISQPFRLAPDTIRELADRNFGIGFDQLLVVEPPGLPDV 67

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI N DGSEV+ CGNG RC  RF+  +    ++    +T +G++  K  RDG ++V
Sbjct: 68  DFRYRIFNADGSEVEQCGNGARCFARFVRDQRLTNKRVIRVQTAKGVIELKVGRDGLVAV 127

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG P L+   IP A    K   D + +  VN   +     +SMGNPH +  V D++   
Sbjct: 128 NMGVPELNPPAIPFAADQRK---DVYTVD-VNGQTVEL-SAISMGNPHGVLVV-DNVDTA 181

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            + S G  L KHP F    N+   +V       LR +ERG G T ACGS ACA+VVA GC
Sbjct: 182 PVESLGPQLEKHPRFPARANIGFLQVIDRRHARLRVFERGSGETLACGSGACAAVVA-GC 240

Query: 239 LHK-TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
           L    +  V V++ GG L+IEW  ++  V M G A   +EG+L + 
Sbjct: 241 LRGLLDSRVEVELRGGRLVIEWQGEDTPVMMEGPATTVFEGQLRLP 286


>gi|255065307|ref|ZP_05317162.1| diaminopimelate epimerase [Neisseria sicca ATCC 29256]
 gi|255050728|gb|EET46192.1| diaminopimelate epimerase [Neisseria sicca ATCC 29256]
          Length = 283

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 143/277 (51%), Gaps = 7/277 (2%)

Query: 8   FAKMEGIGNKILVIDMRGC-HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V++  G   D +T+             FDQ++L+      +VD   RI
Sbjct: 6   FTKMHGLGNDFMVVNGIGQDFDPLTAPLAEWSDRFRGVGFDQLLLVEKPSSDAVDFRYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSEV+ CGNG RC  RF+  +    +K    ET +G+++ K   +G ++V+MG+P 
Sbjct: 66  FNADGSEVEQCGNGARCFARFVADKGLTDKKEILVETAKGVIIPKLLDNGLVTVNMGKPR 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
                IP     D+ D    H+  V  L       V+MGNPHA+  VED +    +A +G
Sbjct: 126 FTSSEIPFVPVPDEADDALTHMVMVG-LETVQVSCVNMGNPHAVIVVED-VQTAPVAHWG 183

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +  H  F E VN+   ++   ES+ LR +ERGVG T ACG+ ACA+VV+   L     
Sbjct: 184 EAIESHEQFPERVNVGFMQIVDRESIRLRVFERGVGETQACGTGACAAVVSGVRLGLLAE 243

Query: 245 AVSVK--MLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V VK  + GG L I W     V MTG  +  +EG+L
Sbjct: 244 GVPVKVSLPGGDLFITWSHGEDVLMTGPVQTVFEGEL 280


>gi|254467049|ref|ZP_05080460.1| diaminopimelate epimerase [Rhodobacterales bacterium Y4I]
 gi|206687957|gb|EDZ48439.1| diaminopimelate epimerase [Rhodobacterales bacterium Y4I]
          Length = 266

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 138/271 (50%), Gaps = 16/271 (5%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRIIN 68
           KM G+GN  +V+D R     +T      ++       FDQ+ ++    +   DA +   N
Sbjct: 2   KMHGLGNDFVVLDARAQDIAVTPAMARGIAHRQFGVGFDQLAVL---TNGKGDAHLTFYN 58

Query: 69  CDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWK 128
            DGS   +CGN  RC+ R L     +      T RG L A++  +G  SV+MG P LDW+
Sbjct: 59  ADGSTSGACGNATRCIARHLILETGKPELHLTTDRGDLYARDAGNGLTSVNMGAPQLDWQ 118

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLA   D ++       P+       P    MGNPH  FFVED      L  FG    
Sbjct: 119 DIPLAEEADTLEL------PIEG----GPTATGMGNPHCTFFVEDAEV-IPLEEFGQRYE 167

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
            HP++ +  N+ +A+VT  + + +R WERGVG+T A GS++CA+ VA+     T R V +
Sbjct: 168 HHPLYPQRTNVQVAQVTGPDRIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGRKVQI 227

Query: 249 KMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            + GG L I+W ++  V+MTG     ++G L
Sbjct: 228 DLDGGTLWIDWAEDG-VWMTGPTMHVFDGTL 257


>gi|126657883|ref|ZP_01729036.1| diaminopimelate epimerase [Cyanothece sp. CCY0110]
 gi|126620823|gb|EAZ91539.1| diaminopimelate epimerase [Cyanothece sp. CCY0110]
          Length = 286

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 150/288 (52%), Gaps = 29/288 (10%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-----NTHF----DQIMLIHDFQ 56
           ++F K +G+GN  +++D R        +AI  LS+ +     + HF    D ++      
Sbjct: 1   MEFTKYQGLGNDFILVDNR-------HNAIPLLSSKEAIKLCDRHFGIGADGVIFALP-G 52

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENR 112
           D + D  +RI N DGSE Q CGNG+RC+ RFL          KS+  +T+ GI++ +   
Sbjct: 53  DENTDYTMRIFNSDGSEPQMCGNGIRCLARFLAKLEGIETVGKSYRIQTLAGIMIPRLEE 112

Query: 113 DGSISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           DG + VDMG P L  K IP  L +  +K+      +G  +         VSMGNPH I F
Sbjct: 113 DGQVKVDMGNPFLLAKEIPTTLTKGEEKVVNQFLEVGGQSWSVT----CVSMGNPHCITF 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V D++    L + G +   H +F E  N     V   + L +R WERG G+T ACG+ AC
Sbjct: 169 V-DNVATIPLETIGPMFEHHAVFPERTNTEFIEVVRSDYLKMRVWERGAGITLACGTGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           ASVVA       +R  +V++ GG L IEW + +N ++MTG A+  + G
Sbjct: 228 ASVVAGVLTGNCDRLCTVELPGGCLTIEWSEQDNRLYMTGPAEAVFTG 275


>gi|332969969|gb|EGK08969.1| diaminopimelate epimerase [Kingella kingae ATCC 23330]
          Length = 282

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 144/280 (51%), Gaps = 9/280 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +VID         ++ I   +       FDQ++++   Q   VD   RI
Sbjct: 6   FSKMHGLGNDFMVIDAINQTFEPRAEQIAQWANRYTGIGFDQLLVVEKAQSDDVDFRYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG EV+ CGNG RC V+F+T +    +     ET RGI+  + N DG ++V+MG+P 
Sbjct: 66  FNADGGEVEQCGNGARCFVKFVTEQGLTDKPEIVVETARGIIKPRLNDDGLVTVNMGQPR 125

Query: 125 LDWKLIPLA-RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                +P   RS +K D   F +  VN +      +VSMGNPHA+  V  D+    + ++
Sbjct: 126 FAPDDVPFVLRSGEKADDKTFIV--VNGIDSAEMSLVSMGNPHAVMLV-GDVATAPVENW 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG--CLHK 241
           GN L  H  F   VN+   ++   + + LR +ERG G T ACG+ ACA+VV+     L  
Sbjct: 183 GNALQNHARFPARVNVGFMQIVDAQHIKLRVFERGSGETQACGTGACAAVVSGVRLSLLT 242

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               + V + GG L I W D   V MTG A   + G++ +
Sbjct: 243 AGEPIRVSLPGGDLYISWQDGGDVMMTGPAVTVFTGEIAV 282


>gi|261364272|ref|ZP_05977155.1| diaminopimelate epimerase [Neisseria mucosa ATCC 25996]
 gi|288567517|gb|EFC89077.1| diaminopimelate epimerase [Neisseria mucosa ATCC 25996]
          Length = 283

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 144/277 (51%), Gaps = 7/277 (2%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V++ +    D +T+             FDQ++L+      +VD   RI
Sbjct: 6   FTKMHGLGNDFMVVNGIAQDFDPLTAPLAEWSDRFRGVGFDQLLLVEKPSSDAVDFRYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSEV+ CGNG RC  RF+  +    +K    ET +G+++ K   +G ++V+MG+P 
Sbjct: 66  FNADGSEVEQCGNGARCFARFVADKGLTDKKEILVETAKGVIIPKLLDNGLVTVNMGKPR 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
                IP     D+++    H+  V  L       V+MGNPHA+  VED +    +A +G
Sbjct: 126 FTSSEIPFVPVPDEVEDALTHMVMVG-LETVQVSCVNMGNPHAVIVVED-VQTAPVAHWG 183

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +  H  F E VN+   ++   ES+ LR +ERGVG T ACG+ ACA+VVA   L     
Sbjct: 184 EAIESHEQFPERVNVGFMQIVDRESIRLRVFERGVGETQACGTGACAAVVAGVRLGLLAE 243

Query: 245 AVSVK--MLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V VK  + GG L I W     V MTG  +  +EG+L
Sbjct: 244 GVPVKVSLPGGDLFITWSHGEDVLMTGPVQTVFEGEL 280


>gi|192360012|ref|YP_001983744.1| diaminopimelate epimerase [Cellvibrio japonicus Ueda107]
 gi|229807488|sp|B3PEI8|DAPF_CELJU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|190686177|gb|ACE83855.1| diaminopimelate epimerase [Cellvibrio japonicus Ueda107]
          Length = 276

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 142/283 (50%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F+KM G+GN  +VID       +T + I  L+   + HF    DQ++L+   +  +VD
Sbjct: 3   IRFSKMHGLGNDFVVIDGISQTVRLTPEKIRKLA---DRHFGVGCDQVLLVEIPEQPNVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI NCDGSEV++CGNG RC   F+  R    ++    ET  GI+  +   D  +SVD
Sbjct: 60  FRYRIFNCDGSEVENCGNGARCFAVFVRERRLTGKRVIRVETAGGIIELRVQDDEQVSVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L  + IP       +       G V  +       VSMGNPHA+  V DD+    
Sbjct: 120 MGVPRLLPEKIPFVADQQAVTYPLDVAGQVCSIS-----AVSMGNPHAVMLV-DDVKSAP 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+  HP F   VN    +V S + ++LR +ERG G T ACG+ ACA+VV     
Sbjct: 174 VGQLGPLVENHPRFPARVNAGFLQVVSRDEINLRVYERGAGETLACGTGACAAVVTGRLR 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              N  V V + GG L I W    H V MTG A   + G++ +
Sbjct: 234 GLLNDTVKVNLPGGSLRISWPGEGHSVIMTGPAVTVFHGQIKL 276


>gi|251797753|ref|YP_003012484.1| diaminopimelate epimerase [Paenibacillus sp. JDR-2]
 gi|247545379|gb|ACT02398.1| diaminopimelate epimerase [Paenibacillus sp. JDR-2]
          Length = 278

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 148/286 (51%), Gaps = 22/286 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIM---LIHDFQDASVD 61
           M+ F KM G+GN  +VI      +      +  L+ +    F  I    L++       D
Sbjct: 1   MMKFTKMHGLGNDFIVI----AGEQQLPGNVAELAKNQCNRFFGIGADGLVYILPSEVAD 56

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRG--ILVAKENRDGSIS 117
             +RIIN DGSE + CGN +RC  +++       ++  T ET+      V  E  DG + 
Sbjct: 57  FRMRIINSDGSEAEQCGNAIRCAAKYIYDNGLTDKEELTIETLGAGAQTVQLEVADGKVQ 116

Query: 118 ---VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV-VSMGNPHAIFFVED 173
              VDMG PIL+   +P       +D DR    P+        F  VSMGNPH + +V D
Sbjct: 117 QVRVDMGAPILNGLQVPTT-----VDEDRVIEHPIEVDGREFRFTAVSMGNPHCVIYV-D 170

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D  ++DLA++G  L  HPMF   +N+    V S E  ++R WERG G T ACG+ ACA+V
Sbjct: 171 DAANFDLATWGPKLETHPMFPRKINVEFVTVISREHAEMRVWERGAGPTLACGTGACATV 230

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGK 278
           V+S     T+R   V + GG L IEW++ +NHV+MTG A + + G+
Sbjct: 231 VSSVLNGLTDRTAVVTLKGGDLTIEWNEADNHVYMTGPAAEVYRGE 276


>gi|145630493|ref|ZP_01786273.1| diaminopimelate epimerase [Haemophilus influenzae R3021]
 gi|144983883|gb|EDJ91325.1| diaminopimelate epimerase [Haemophilus influenzae R3021]
          Length = 274

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 146/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGLLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|71892348|ref|YP_278082.1| diaminopimelate epimerase [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|123640808|sp|Q491Z7|DAPF_BLOPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71796454|gb|AAZ41205.1| diaminopimelate epimerase [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
          Length = 274

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 152/281 (54%), Gaps = 16/281 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  ++ID    + ++TS+ I  LS       FDQ++++    D ++D   RI
Sbjct: 3   FTKMNGLGNDFVIIDAVTQNIHLTSENIRYLSDRFYGVGFDQLLIVEPPYDPAIDFHCRI 62

Query: 67  INCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG+EV  CGNGMRCV +F  L     +++    T    ++     D  +SV+MG PI
Sbjct: 63  YNSDGTEVNQCGNGMRCVAQFVCLKKLTNKRNIHISTRANHIILSIMNDNRVSVNMGAPI 122

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
            D KLIP   S  +  +      P   +      VVSMGNPH I  VE  + +  + S G
Sbjct: 123 FDPKLIPFYIS--QYQKTYILFLPTQIILCG---VVSMGNPHCIILVEK-IENIQVTSLG 176

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VASGCLHK 241
           + L  H  F E VN+S  ++ +  ++ LR +ERGVG T ACG+AACA+V   +  G L++
Sbjct: 177 SALEDHHCFPERVNVSFMQIINCNNIRLRVYERGVGETQACGTAACAAVAVGIQQGLLYE 236

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +   V+V + GG + + W   +N ++MTG     ++G +++
Sbjct: 237 S---VNVNLPGGTISVNWKGASNALYMTGSTSYVYDGYINL 274


>gi|315633489|ref|ZP_07888779.1| diaminopimelate epimerase [Aggregatibacter segnis ATCC 33393]
 gi|315477531|gb|EFU68273.1| diaminopimelate epimerase [Aggregatibacter segnis ATCC 33393]
          Length = 274

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/277 (36%), Positives = 140/277 (50%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    +D I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFPADTIKRLADRHRGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T  G +V     D ++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQNGKMVLTVKEDDNVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD++  ++A
Sbjct: 121 PIWEPNKIPFTANKFEKNYILRTEIQTVLC------GAVSMGNPHCVVQV-DDIHTANVA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F E VN    +V + + + LR  ERG G T ACGS ACA+V        
Sbjct: 174 QLGPLLENHERFPERVNAGFMQVVNRKHIKLRVHERGAGETQACGSGACAAVAVGIMQGV 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +  V V + GG LLIEW    H ++MTG A   ++G
Sbjct: 234 LDNEVQVDLPGGSLLIEWQGEGHPLYMTGSATHVYDG 270


>gi|86136888|ref|ZP_01055466.1| diaminopimelate epimerase [Roseobacter sp. MED193]
 gi|85826212|gb|EAQ46409.1| diaminopimelate epimerase [Roseobacter sp. MED193]
          Length = 292

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 133/273 (48%), Gaps = 16/273 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V+D R     IT      ++       FDQ+ LI   +    DA +  
Sbjct: 27  FMKMHGLGNDFVVVDARSHPLEITPALARGIAHRQFGVGFDQLALI---EQGKGDAHLTF 83

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS   +CGN  RC+ R L     +      T RG L A +  +G  SV+MG P LD
Sbjct: 84  FNADGSTSAACGNATRCIARHLMDESGKSELHLTTDRGDLFACDAGNGLTSVNMGHPQLD 143

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPL    D ++       P+       P    MGNPH  FFVED      L  FG  
Sbjct: 144 WRDIPLREETDTLEL------PIE----GGPTATGMGNPHCTFFVEDAGL-IPLTDFGPR 192

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
              HP++ E  N+ +A +   + + +R WERGVG+T A GS++CA+ VA+     T R V
Sbjct: 193 YEHHPLYPERTNVQVAHLVGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGRRV 252

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            + + GG L I+W D+  V+MTG     + G  
Sbjct: 253 QIDLDGGTLWIDWRDDG-VWMTGPTMHVFSGTF 284


>gi|163734416|ref|ZP_02141856.1| diaminopimelate epimerase [Roseobacter litoralis Och 149]
 gi|161392424|gb|EDQ16753.1| diaminopimelate epimerase [Roseobacter litoralis Och 149]
          Length = 277

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 101/281 (35%), Positives = 143/281 (50%), Gaps = 24/281 (8%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           S + F KM G+GN  +V+D R     +T     AL+   N H    FDQ+ LI + +   
Sbjct: 7   SGLPFMKMHGLGNDFVVLDARVRSIGVTPLFAQALA---NRHTGVGFDQLALITNTKTGV 63

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
             AF    N DGS   +CGN  RC+  ++ ++      T  T RG+L A    +G  SV+
Sbjct: 64  HLAFF---NADGSVSSACGNATRCIADYIMAQTGASDVTLSTDRGVLAACRAANGQTSVN 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRN-PFVVSMGNPHAIFFVEDDLYHY 178
           MG P LDW  +PLAR  D ++           L ++  P    MGNPH  FFV DD    
Sbjct: 121 MGAPQLDWAEVPLAREMDTLE-----------LPMKGAPTATGMGNPHCTFFV-DDAMQI 168

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+A  G     H +F +  N+  A +T  + + +R WERGVG+T A GS++CA  VA+  
Sbjct: 169 DVAKLGAEFEHHELFPQRTNVQFASITGPDQIRMRVWERGVGITLASGSSSCAVAVAAAR 228

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              T R V + + GG L I+W D+  V+MTG  +  + G L
Sbjct: 229 RGLTGRKVQIDLDGGRLEIDWRDDG-VWMTGPTQHVFSGTL 268


>gi|332139611|ref|YP_004425349.1| diaminopimelate epimerase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549633|gb|AEA96351.1| diaminopimelate epimerase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 276

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 151/280 (53%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I  L+  +    FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFMVIDNVTQNVFFSKEKIQQLADRNFGIGFDQLLMVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +  + R      T  G +V    +DG ++V+MG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIVVSTKAGKMVLYLEKDGQVTVNMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL ++  + +     +G  + LF+      SMGNPH +  V DD+   ++A 
Sbjct: 123 PEFEPANIPL-KANKQENTYILRVGE-STLFIG---AASMGNPHCVMEV-DDVDTANVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ KH  FSEGVN+   ++ +   + LR +ERG G T ACGS ACA+V       K 
Sbjct: 177 IGPLVEKHERFSEGVNVGFMQIINDSHIKLRVFERGSGETLACGSGACAAVAIGQIQGKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           ++ V V + GG L I W   ++V  MTG A+  ++G +++
Sbjct: 237 SKDVRVDLPGGSLRIRWPGPDNVLKMTGPAEHVYDGHINL 276


>gi|251793384|ref|YP_003008112.1| diaminopimelate epimerase [Aggregatibacter aphrophilus NJ8700]
 gi|247534779|gb|ACS98025.1| diaminopimelate epimerase [Aggregatibacter aphrophilus NJ8700]
          Length = 274

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 141/283 (49%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFPTETIKRLADRHRGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQKGKMVLSVKEDGNVRVNMGE 120

Query: 123 PILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           P+ +   IP +A  F+K            +  LR          VSMGNPH +  VED +
Sbjct: 121 PVWEPNKIPFIANKFEK------------NYILRTTVQTVLCGAVSMGNPHCVVQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              ++   G LL  H  F E VN    +V + + + LR +ERG G T ACGS ACA+V  
Sbjct: 168 QTANVEQLGPLLENHERFPERVNAGFMQVVNRKHIKLRVYERGAGETQACGSGACAAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++MTG A   ++G
Sbjct: 228 GIMQGVLDNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDG 270


>gi|148826606|ref|YP_001291359.1| diaminopimelate epimerase [Haemophilus influenzae PittEE]
 gi|166224259|sp|A5UDX5|DAPF_HAEIE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148716766|gb|ABQ98976.1| diaminopimelate epimerase [Haemophilus influenzae PittEE]
          Length = 274

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 145/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VS+GNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSIGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLENHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|149376982|ref|ZP_01894736.1| diaminopimelate epimerase [Marinobacter algicola DG893]
 gi|149358759|gb|EDM47229.1| diaminopimelate epimerase [Marinobacter algicola DG893]
          Length = 327

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 151/299 (50%), Gaps = 20/299 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASV 60
           Q  M++F KM G+GN  +V+D       +  + I  L+  +    FDQ++++       V
Sbjct: 14  QGPMLNFTKMHGLGNDFMVVDAISQPFRLRPEMIRELADRNFGIGFDQLLVVEPPGLPDV 73

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI N DGSEV+ CGNG RC  RF+  +    +K    +T +G++  +  R G ++V
Sbjct: 74  DFRYRIFNSDGSEVEQCGNGARCFARFVRDQRLTNKKVIRVQTAKGVIELRVGRAGMVTV 133

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHI---GPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           DMG P L+   IP A    K   D + +   G    L       VSMGNPH +  V DD+
Sbjct: 134 DMGVPELNPPAIPFAADRRK---DVYTVELGGDTVELS-----AVSMGNPHGVLLV-DDV 184

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +  +G  L  HP F    N+   ++     + LR +ERG G T ACGS ACA+VVA
Sbjct: 185 DTAPVGEYGPRLENHPRFPARANIGFLQIVDRTHVRLRVFERGSGETMACGSGACAAVVA 244

Query: 236 SGCLHKT--NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            GCL     NR V V++ GG L+IEW  +   V M G     +EG+L +   +  ++ +
Sbjct: 245 -GCLRGLLDNR-VDVELKGGRLVIEWQGEGAPVMMEGPTASVFEGQLRLPADQPPRRRK 301


>gi|172039059|ref|YP_001805560.1| diaminopimelate epimerase [Cyanothece sp. ATCC 51142]
 gi|171700513|gb|ACB53494.1| diaminopimelate epimerase [Cyanothece sp. ATCC 51142]
          Length = 290

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 147/282 (52%), Gaps = 15/282 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITS--DAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +++F K +G+GN  +++D R     + S  +A+           D ++      D S D 
Sbjct: 12  IMEFTKYQGLGNDFILVDNRHSSTPLLSPDEAVKLCDRHFGIGADGVIFALPGDDQS-DY 70

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISV 118
            +RI N DGSE Q CGNG+RC+ RFL          KS+  +T+ GI++ +   +G + V
Sbjct: 71  TMRIFNSDGSEPQMCGNGIRCLARFLAKLEGVETVGKSYRIQTLAGIIIPRLEEEGQVKV 130

Query: 119 DMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P L  K IP  L +  +K+      +G  +     +   VSMGNPH I FVE+ + 
Sbjct: 131 DMGNPFLLAKEIPTTLTKGEEKVINQFLEVGGQSW----SVTCVSMGNPHCITFVEN-VA 185

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L + G +   H +F E  N     V   + L +R WERG G+T ACG+ ACASVVA 
Sbjct: 186 TIPLETIGPMFEHHSVFPERTNTEFIEVVRSDYLKMRVWERGAGITLACGTGACASVVAG 245

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
                 +R  +V++ GG L IEW + +N ++MTG A+  + G
Sbjct: 246 VLTGNCDRLCTVELPGGCLTIEWSEQDNRLYMTGPAEAVFTG 287


>gi|56695194|ref|YP_165542.1| diaminopimelate epimerase [Ruegeria pomeroyi DSS-3]
 gi|56676931|gb|AAV93597.1| diaminopimelate epimerase [Ruegeria pomeroyi DSS-3]
          Length = 269

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 94/263 (35%), Positives = 133/263 (50%), Gaps = 16/263 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V+D R     IT      ++       FDQ+ +I   +    DA +  
Sbjct: 3   FMKMHGLGNDFVVVDARLHPVRITGALARGIAHRHLGVGFDQLAVI---EPGKGDAHLVF 59

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGS   +CGN  RC+ R L     +      T RG L A++  DG  SV+MG P L 
Sbjct: 60  YNADGSTSAACGNATRCIARHLMDETGKTELHLTTDRGDLYARDAGDGLTSVNMGAPQLL 119

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W  IPLA   D ++       P+       P    MGNPH  FFV D      LA FG  
Sbjct: 120 WHEIPLAEEMDTLEL------PIE----GGPTATGMGNPHCTFFVAD-AEAIPLAEFGAR 168

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
              HP++ +  NL +A++T  + + +R WERGVG+T A GS++CA+ VA+     T R V
Sbjct: 169 YEHHPLYPQRTNLQVAQITGPDRIRMRVWERGVGITLASGSSSCATAVAAARRGLTGRKV 228

Query: 247 SVKMLGGGLLIEWHDNNHVFMTG 269
            + + GG + I+W ++  V+MTG
Sbjct: 229 QIDLDGGTIWIDWREDG-VWMTG 250


>gi|239993650|ref|ZP_04714174.1| diaminopimelate epimerase [Alteromonas macleodii ATCC 27126]
          Length = 276

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 150/280 (53%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I  L+  +    FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFMVIDNVTQNVFFSKEKIQQLANRNFGIGFDQLLMVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +  + R      T  G +V    +DG ++V+MG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIVVSTKAGKMVLYLEKDGQVTVNMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL ++  + +     +G  + LF+ +    SMGNPH +  V DD+   ++A 
Sbjct: 123 PEFEPANIPL-KANKQENTYILRVGE-STLFIGS---ASMGNPHCVMEV-DDVDTANVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ KH  F EGVN+   ++ +   + LR +ERG G T ACGS ACA+V       K 
Sbjct: 177 IGPLVEKHERFPEGVNVGFMQIINESHIKLRVFERGSGETLACGSGACAAVAIGQIQGKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
            + V V + GG L I W   ++V  MTG A+  ++G +++
Sbjct: 237 GKDVRVDLPGGSLRIRWPGPDNVLKMTGPAEHVYDGHINL 276


>gi|147678135|ref|YP_001212350.1| diaminopimelate epimerase [Pelotomaculum thermopropionicum SI]
 gi|229813238|sp|A5D193|DAPF_PELTS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146274232|dbj|BAF59981.1| diaminopimelate epimerase [Pelotomaculum thermopropionicum SI]
          Length = 280

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 147/288 (51%), Gaps = 22/288 (7%)

Query: 8   FAKMEGIGNKILVIDMRGC-HDNITSDAINALSTDD-NTHF----DQIMLIHDFQDASVD 61
           F K  G+GN  +++D   C  + +  +    L+    + HF    D ++L+      S D
Sbjct: 3   FTKAHGLGNDFILVD---CFKEKVNPEDFPGLAVKMCDRHFGVGADGLVLL--LPSPSAD 57

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGS 115
             +RI N DGSE + CGN +RCV ++L  R  +K      ET+ G+++ +    E R   
Sbjct: 58  VSMRIFNPDGSEAEMCGNAIRCVAKYLYERGMVKADRIRVETLAGVMIPELLVEEGRVRL 117

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEP L+   IP+     ++  +    G   +        VSMGNPH + FV+D L
Sbjct: 118 VRVDMGEPRLERSEIPMEGPPGRVLGEPLETGGAVYRIT----AVSMGNPHCVIFVQD-L 172

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 + G L+  HP F    N+   +V + E + +R WERG G T ACG+ ACA+VVA
Sbjct: 173 DAVPFQTAGPLIETHPAFPRRTNVEFIQVLTPEEIKMRVWERGAGETMACGTGACAAVVA 232

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKT 283
                 T R V+V +  G L IEW +  HV+M+G A++ + G+   +T
Sbjct: 233 GVLNGYTGRRVTVHLKAGDLFIEWPEGKHVYMSGPAEEVFSGEYPYRT 280


>gi|126463355|ref|YP_001044469.1| diaminopimelate epimerase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105019|gb|ABN77697.1| diaminopimelate epimerase [Rhodobacter sphaeroides ATCC 17029]
          Length = 278

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 146/279 (52%), Gaps = 16/279 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN--THFDQIMLIHDFQDASV 60
           SS + F KM G GN  +VID RG    + +  +     D +    FDQ+  I D + A  
Sbjct: 6   SSGLGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQEGA-- 63

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D  +   N DGS   +CGN  RCV  +L   + R   T  T RG L A+   DG ++V+M
Sbjct: 64  DCALDFWNSDGSRSGTCGNATRCVSDYLMRDLGRDEVTLVTARGHLHARRREDGLVAVNM 123

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L W  IPLAR+   M+ D     P+       P  V MGNPH +FFVED +   DL
Sbjct: 124 GAPQLLWSEIPLARA---METDSL---PLEG----GPAAVGMGNPHCVFFVED-VEAVDL 172

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G  +   P+F E  N+  A +   + L LR WERG G+T ACGS ACA+ VA+    
Sbjct: 173 AGRGASVETDPLFPERTNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRG 232

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            T R V ++M GG L ++W D   V+++G   + +EG L
Sbjct: 233 LTGRQVRLEMDGGVLEVDWRDEG-VWLSGPVARVFEGHL 270


>gi|258515536|ref|YP_003191758.1| diaminopimelate epimerase [Desulfotomaculum acetoxidans DSM 771]
 gi|257779241|gb|ACV63135.1| diaminopimelate epimerase [Desulfotomaculum acetoxidans DSM 771]
          Length = 277

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 154/284 (54%), Gaps = 19/284 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F K+ G+GN  +V++     + + +D         + +F    D ++L+H   DA+ D  
Sbjct: 3   FVKVHGLGNDFVVVN--AMTETLPADLPELARRVCHRYFGIGADGLVLLHK-SDAA-DLR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           ++IIN DGSE + CGN +RCV ++   +  +K+     ET+ GI    L+ +      I 
Sbjct: 59  MQIINSDGSEPEMCGNAIRCVAKYAYEQNLVKKTKIQVETLAGIKIPELILENGAVKFIR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL+   IP+  S  ++  +  ++G  N  F      VSMGNPH + FV D+   
Sbjct: 119 VDMGEPILERAEIPMRGSAGRVLAEDLNVG--NETF--KVTAVSMGNPHCLIFV-DEAVS 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + ++  G  +  H +F    N+    V +   + ++ WERG G T ACG+ ACA+VVA+ 
Sbjct: 174 FPVSLIGPQIEIHEVFPRKTNVEFIEVLNRREVKMKVWERGAGETMACGTGACATVVAAV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               T R V+V + GG LLIEW DNNHV+MTG A++ + G   +
Sbjct: 234 LNGLTERQVTVHLTGGDLLIEWADNNHVYMTGPAEEVFAGSYKL 277


>gi|187251423|ref|YP_001875905.1| diaminopimelate epimerase [Elusimicrobium minutum Pei191]
 gi|229807517|sp|B2KDH2|DAPF_ELUMP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|186971583|gb|ACC98568.1| Diaminopimelate epimerase [Elusimicrobium minutum Pei191]
          Length = 274

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 151/282 (53%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST---DDNTHFDQIMLIHDFQDASVDA 62
           ++F K +G+GN  ++ID       I  D +NAL     D +       LI  F  AS D 
Sbjct: 1   MEFVKYQGLGNDFILIDCV----KIKIDGLNALGKKLCDRHFGIGADGLIAVFPSASADY 56

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMK-RKSFTFETIRGILVAKENRDGSISVDMG 121
            IRIIN DG+E + CGNG+RC +RF+   +K ++  TFET+ G +  +   +  + VDMG
Sbjct: 57  KIRIINSDGTEPEMCGNGIRCAMRFVFDYIKPQRKLTFETLAGPIKTELLAENLVKVDMG 116

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIG-PVNHLFLRNPFV----VSMGNPHAIFFVEDDLY 176
            P L    IPL  S    D D   +  PV    L    +    VSMGNPH + FVED + 
Sbjct: 117 APKLTAAQIPLNIS----DSDGRAVDIPVK---LEGGKIKGTGVSMGNPHFVIFVED-IK 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             D+A  G  +  +  F +  N+   +V +   L ++ WERGVG+T ACG+ ACAS+VA 
Sbjct: 169 KTDVAKTGKEVENNTAFPQKTNVEFVQVITPSRLCMKVWERGVGITLACGTGACASLVAG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEG 277
              +KT R   V++ GG L +EW D+   VFMTG A + + G
Sbjct: 229 VLNNKTERLALVELDGGQLTVEWPDDGASVFMTGPATEVFSG 270


>gi|293391245|ref|ZP_06635579.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951779|gb|EFE01898.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 274

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 139/277 (50%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAMTQNIYFPTETIKRLADRHRGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K+    T  G ++     DG++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKNIAVSTQNGKMLLTVKEDGNVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   IP  A  F+K    R  I  V          VSMGNPH +  VED +   ++ 
Sbjct: 121 PIWEPNKIPFTANKFEKNYILRTEIQTVLC------SAVSMGNPHCVVQVED-IQTANVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+V        
Sbjct: 174 QLGPLLENHERFPERVNAGFMQVVNRHHIKLRVYERGTGETQACGSGACAAVAVGIMQGV 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +  V V + GG L IEW    H ++MTG A   ++G
Sbjct: 234 LDNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDG 270


>gi|88813058|ref|ZP_01128300.1| Diaminopimelate epimerase [Nitrococcus mobilis Nb-231]
 gi|88789691|gb|EAR20816.1| Diaminopimelate epimerase [Nitrococcus mobilis Nb-231]
          Length = 277

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 148/284 (52%), Gaps = 22/284 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KM+ +GN  +VID       ++SD I  LS        DQ++L    Q    D   R+
Sbjct: 6   FTKMQALGNDFIVIDAMSQTVALSSDQIRQLSNRRLGIGCDQVLLAERPQRPDTDIRYRV 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG EV+ CGNG+RC+ RFL  +  +++     ET  G+ +     DG+I+V+MG P+
Sbjct: 66  FNADGGEVEHCGNGVRCLARFLHEKALLEQHELRVETRNGLTLVHLCDDGAIAVNMGPPV 125

Query: 125 LDWKLIPLARSFDK------MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           L+ + IP   +         ++  R  IG            VSMGNPHA+  V DD+   
Sbjct: 126 LEPERIPFRPTKQASEYALALEDKRIMIG-----------AVSMGNPHAVLQV-DDIDSA 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            + +FG L+ +H  F + VN+   +V S + + LR +ERG G T ACG+ ACA+VV+   
Sbjct: 174 PIDTFGPLIMEHADFPQRVNVGFMQVISRDRIRLRVYERGAGETPACGTGACAAVVSGRL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
               +  V V + GG L+I W   +  V+MTG A   +EG++ +
Sbjct: 234 RGLLDARVKVNLPGGELMIYWDGGDTSVWMTGPALTVYEGEIRL 277


>gi|261378786|ref|ZP_05983359.1| diaminopimelate epimerase [Neisseria cinerea ATCC 14685]
 gi|269144763|gb|EEZ71181.1| diaminopimelate epimerase [Neisseria cinerea ATCC 14685]
          Length = 283

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 148/286 (51%), Gaps = 25/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D I   A  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFIPEHAPIAAWADRFRGIGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +    +K    ET +GI+  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVEQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFH-------IGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
                 IP     D+ D    +       I PV+         V++GNPHA+  V DD+ 
Sbjct: 125 KFMPSEIPFVPVSDEGDDACIYGVHLESGIQPVS--------CVNIGNPHAVIVV-DDVE 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA 
Sbjct: 176 CAPVRETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAG 235

Query: 237 ---GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              G L +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 236 IRLGLLDE-GKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|332980959|ref|YP_004462400.1| diaminopimelate epimerase [Mahella australiensis 50-1 BON]
 gi|332698637|gb|AEE95578.1| diaminopimelate epimerase [Mahella australiensis 50-1 BON]
          Length = 277

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 151/286 (52%), Gaps = 25/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +V+D      +   + +  +  D   HF    D I+++        DA 
Sbjct: 3   FVKMHGLGNDFIVVDEFNAQSDRDYNKLAPMLCD--RHFGIGADGIIIV--LPSDIADAR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDG----SIS 117
           +RI+N DGSE + CGNG+RC  +++  +  +K++  + ET+ GI+  +   +G     + 
Sbjct: 59  MRIVNADGSEAEMCGNGIRCFAKYVYESGIIKKQVLSVETLAGIMKPELFVEGDEVQKVK 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVV---SMGNPHAIFFVEDD 174
           VDMG+P  +   IP      ++      +          P+ +   SMG PH + FV DD
Sbjct: 119 VDMGKPDFEPGAIPAFMPGTRIVERPLEVD-------SQPYAITSMSMGVPHTVIFV-DD 170

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +   D+   G  + KHP+F +  N++   V +   + +RTWERG G T ACG+ +CAS V
Sbjct: 171 VDEVDIIGLGPKIEKHPIFPKKTNVNFVEVLNDHEIKVRTWERGAGATLACGTGSCASAV 230

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           A+    +T RAV+V ++ G L I W +++ VFMTG A K ++G ++
Sbjct: 231 AAAITGRTGRAVTVHLIAGQLEIRWAEDDTVFMTGPAAKVFQGDIE 276


>gi|6729756|pdb|1BWZ|A Chain A, Diaminopimelate Epimerase From Hemophilus Influenzae
          Length = 274

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 145/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V        I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDMNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|255020693|ref|ZP_05292755.1| Diaminopimelate epimerase [Acidithiobacillus caldus ATCC 51756]
 gi|254969929|gb|EET27429.1| Diaminopimelate epimerase [Acidithiobacillus caldus ATCC 51756]
          Length = 290

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 139/277 (50%), Gaps = 16/277 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KMEG+GN  +V+D  G   N   D         + H+    DQI+L+        D  
Sbjct: 15  FTKMEGLGNDFVVLD--GVRRNFLLDP-ETCQRIAHRHYGIGCDQILLVEPASSPDCDFR 71

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV  CGNG RC   F+       ++S   ET  G L  + + DG+++VDMG
Sbjct: 72  YRIFNADGGEVGQCGNGARCFALFVRRAGLTDKRSIRVETASGPLELQVHDDGTVTVDMG 131

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P LD   IP  R+    +  R  +G  +H+ L     V MGNPHA+  VED +    +A
Sbjct: 132 VPRLDPADIPF-RAPAAANNYRLDLG-QDHIEL---AAVGMGNPHALLRVED-VRGAPVA 185

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  HP F E  N+    + S  +L LRTWERG G T ACGS ACA+VVA      
Sbjct: 186 EIGPLLEHHPAFPERTNVGFMEIVSPHALRLRTWERGAGETLACGSNACAAVVAGRGWGA 245

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
               V V++ GG L I W     H+ MTG A+  ++G
Sbjct: 246 LRERVRVELPGGSLEIHWPGPGQHLRMTGPARVVFDG 282


>gi|319897750|ref|YP_004135947.1| diaminopimelate epimerase [Haemophilus influenzae F3031]
 gi|317433256|emb|CBY81631.1| diaminopimelate epimerase [Haemophilus influenzae F3031]
          Length = 274

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 145/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  +F+T +    +K  +    +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFAQFVTLKGLTNKKDISVSAQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|257453687|ref|ZP_05618974.1| diaminopimelate epimerase [Enhydrobacter aerosaccus SK60]
 gi|257448921|gb|EEV23877.1| diaminopimelate epimerase [Enhydrobacter aerosaccus SK60]
          Length = 310

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 144/283 (50%), Gaps = 18/283 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+     ++T + +  L        FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLHLTKELVALLGDRHLGIGFDQLLIVEPPSRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEVQ CGNG RC  RF+ +R    ++    ET  GI+    +  G + VDMG
Sbjct: 62  YRIFNKDGSEVQQCGNGARCFARFVQARKLSFKQRIRVETASGIITLSTDDYGWVKVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIG----PVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           +P  +   IP         ++ + +     PV        +V +MGNPHA+  V DD+  
Sbjct: 122 KPKFEPDEIPFTPKTITKVQNSYRLNVDGTPVTL------YVANMGNPHAVIKV-DDVLT 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---V 234
            ++   G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V   V
Sbjct: 175 AEVEKLGKAIESHPAFPERVNVGFMQVMNNRHIRLRVYERGVGETQACGTGACAAVATGV 234

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             G L +    +  ++ GG L I W +   V+MTG A   +EG
Sbjct: 235 REGWLDE-GVDIRAQLYGGSLAIRWQEGYPVYMTGPATFVYEG 276


>gi|307546849|ref|YP_003899328.1| diaminopimelate epimerase [Halomonas elongata DSM 2581]
 gi|307218873|emb|CBV44143.1| diaminopimelate epimerase [Halomonas elongata DSM 2581]
          Length = 277

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 147/287 (51%), Gaps = 22/287 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+      +  + I  L+       FDQ++++   +D  +D  
Sbjct: 2   LLQFTKMHGLGNDFMVVDLVTQRARLRDEQIRDLADRRFGIGFDQLLVVEPPRDPDMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF-LTSRMK-RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV++CGNG RC  RF L  R+  ++    ET  G L      DG +SVDMG
Sbjct: 62  YRIYNADGSEVENCGNGARCFARFVLDQRLTHKREIHVETAGGPLTLVVGDDGRVSVDMG 121

Query: 122 EPILDWKLIPLARSFDK------MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           +P    + +P     D+      +D  +  IG           V S+GNPHA+  V DD+
Sbjct: 122 KPRFAPQDLPFEADGDRPLHDLEVDGQQISIG-----------VASLGNPHAVLRV-DDV 169

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +A+ G  +  HP F   VN    +V S   + LR +ERGVG T ACG+ ACA+V  
Sbjct: 170 TTAPVATLGPAIEGHPRFPRRVNAGFMQVVSAHEIRLRVYERGVGETLACGTGACAAVAC 229

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                     V+V + GG L I+W D   ++ MTG A++ +EG++ I
Sbjct: 230 GIRQGLLESPVTVHLPGGELRIDWPDIEANLIMTGPAERVFEGRVAI 276


>gi|221134093|ref|ZP_03560398.1| diaminopimelate epimerase [Glaciecola sp. HTCC2999]
          Length = 276

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 143/279 (51%), Gaps = 10/279 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F KM G+GN  +V+D    +   + + I  L+  +    FDQ++L+    D   D  
Sbjct: 2   LVEFTKMHGLGNDFMVVDCITQNIYFSPERIQQLADRNFGVGFDQLLLVEPPYDPDQDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +   +  T  G ++    +DG ++V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVKYKNLTHKTKISVSTKAGKIMLYLEKDGQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      +P+     +   + + I   +  F      VS+GNPH +  V DD+  YD+ 
Sbjct: 122 RPRFAPDDVPMKA---QKQENTYIIREADQTFFCG--AVSLGNPHCVMVV-DDIDTYDVL 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F + VN+   ++    ++ LR +ERGVG T ACGS ACA+V       K
Sbjct: 176 GVGALLESHERFPQKVNVGFMQIIDENNIKLRVFERGVGETLACGSGACAAVAIGQQQGK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKL 279
               V+V + GG L I W  ++H   MTG A+  ++GK+
Sbjct: 236 LGTEVNVTLPGGPLTIRWQGDDHTIKMTGPAEHVFDGKI 274


>gi|261867253|ref|YP_003255175.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412585|gb|ACX81956.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 274

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 138/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNIYFPTETIKRLADRHRGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T  G ++     DG++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQNGKMLLTVKEDGNVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   IP  A  F+K    R  I  V          VSMGNPH +  VED +   ++ 
Sbjct: 121 PIWEPNKIPFTANKFEKNYILRTEIQTVLC------SAVSMGNPHCVVQVED-IQTANVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+V        
Sbjct: 174 QLGPLLENHERFPERVNAGFMQVVNRHHIKLRVYERGTGETQACGSGACAAVAVGIMQGV 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +  V V + GG L IEW    H ++MTG A   ++G
Sbjct: 234 LDNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDG 270


>gi|113461746|ref|YP_719815.1| diaminopimelate epimerase [Haemophilus somnus 129PT]
 gi|122945419|sp|Q0I572|DAPF_HAES1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|112823789|gb|ABI25878.1| diaminopimelate epimerase [Haemophilus somnus 129PT]
          Length = 274

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 142/276 (51%), Gaps = 10/276 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+  +    FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAVTQNVYFPTEVIKRLADRNRGIGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     +K     T +G ++ +   D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVVLKGLTDKKEIAVSTAKGKMMLRVKDDDMVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   + +K +++      +  L      VVSMGNPH +  VED + H ++  
Sbjct: 121 PIWEPNKIPF--NANKFEKNYIIRTDIQTLLCG---VVSMGNPHCVTQVED-IQHANIEI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINRNHIKLRVYERGAGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
           +  V V + GG L+IEW    H ++MTGEA   ++G
Sbjct: 235 DNNVQVDLPGGRLMIEWQGKGHPLYMTGEATHIYDG 270


>gi|116329548|ref|YP_799268.1| diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116329863|ref|YP_799581.1| diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122282362|sp|Q04W97|DAPF_LEPBJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|122282673|sp|Q04X60|DAPF_LEPBL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|116122292|gb|ABJ80335.1| Diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123552|gb|ABJ74823.1| Diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 281

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 22/290 (7%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + + F KMEGIGN  + ID    +  +T + I  +S   N +F    D ++ I + +   
Sbjct: 2   AALKFTKMEGIGNDYIYIDSTQANIRLTPEQIQKIS---NRNFGIGSDGVIFIRNSKQG- 57

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL-----VAKENR 112
            D  + + N DGS  + CGNG+RCV +++        K+   ET  G+L     +   N+
Sbjct: 58  -DFMMDMYNSDGSSSEMCGNGIRCVAKYIYDHGLTNSKNPKIETGAGVLEVDLKIGSGNK 116

Query: 113 DGSISVDMGEPILDWKLIPLARSFDKMDRDR-FHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
              +SV+MG+PIL    IP+    ++   D+ F I   N  F      VSMGNPH + FV
Sbjct: 117 VDFVSVNMGKPILVPSKIPVNWKDEEAIIDQTFEIAGKNLKFT----AVSMGNPHCVIFV 172

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD   + +   G L+ +HP+F + +N+    V   +    RTWERG G T ACG+ ACA
Sbjct: 173 -DDCDQFPVTGIGPLIERHPIFPKRINVEFVTVRGKDHFYQRTWERGAGETLACGTGACA 231

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             VA     K+ + V + + GG L I+W ++ +V MTG AK+ + G++++
Sbjct: 232 VTVAGNLTGKSGKEVKIDLRGGTLRIQWQESGNVLMTGPAKEIFSGEIEV 281


>gi|322384337|ref|ZP_08058035.1| diaminopimelate epimerase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321150839|gb|EFX44276.1| diaminopimelate epimerase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 280

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 155/289 (53%), Gaps = 24/289 (8%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           M++  KM G+GN  +V+          SD    L    N HF    D ++ I   ++A  
Sbjct: 1   MMNITKMNGLGNDFIVVSGEKQLPAGVSDLAIRLC---NRHFGIGADGLVYILPSKEA-- 55

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETI-----RGILVAKEN 111
           D  +RIIN DGSE + CGN +RCV +++        +    T +TI     R  +  K+ 
Sbjct: 56  DFMMRIINSDGSEAEQCGNAIRCVAKYVVDHGLVEHQNDEITIQTIGAGIQRVFVHKKDG 115

Query: 112 RDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           +  ++ VDMGEPIL+   IP   + + + +    +      F      VSMGNPH + +V
Sbjct: 116 KVDTVRVDMGEPILNGLDIPTTVNANPVVKYPVEVNGRRFQFT----AVSMGNPHCVIYV 171

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD    +L  +G LL  HP+F + +N+  A V S + + +  WERG G T ACG+ ACA
Sbjct: 172 -DDAVTMNLHEWGPLLEVHPLFPKKINVEFATVQSRDRVIMHVWERGAGPTLACGTGACA 230

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           ++VAS   + T+R  ++ + GG L IEW++ +NHV+MTG A + ++G+L
Sbjct: 231 TLVASVLNNLTDRRATISLKGGDLFIEWNEADNHVYMTGPAAEVFQGRL 279


>gi|159795185|pdb|2Q9H|A Chain A, Crystal Structure Of The C73s Mutant Of Diaminopimelate
           Epimerase
          Length = 274

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 145/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV   GNG RC  RF+T +    +K  +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQSGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|56752176|ref|YP_172877.1| diaminopimelate epimerase [Synechococcus elongatus PCC 6301]
 gi|81300736|ref|YP_400944.1| diaminopimelate epimerase [Synechococcus elongatus PCC 7942]
 gi|81561459|sp|Q5N013|DAPF_SYNP6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123556543|sp|Q31LW2|DAPF_SYNE7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56687135|dbj|BAD80357.1| diaminopimelate epimerase [Synechococcus elongatus PCC 6301]
 gi|81169617|gb|ABB57957.1| diaminopimelate epimerase [Synechococcus elongatus PCC 7942]
          Length = 280

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 144/285 (50%), Gaps = 18/285 (6%)

Query: 6   VDFAKMEGIGNKILVIDMR--GCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + FAK  G+GN  +++D R  G        A+     +     D ++        S D  
Sbjct: 3   LQFAKYHGLGNDFILVDNRESGEPRLTPEQAVQVCDRNFGVGADGVIFALPGSGDS-DYV 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           +RI N DGSE + CGNG+RC+ +FL+      +  +   T  G++V      G ++VDMG
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAKFLSELDGGAQSRYRIATGAGLIVPTLTETGLVTVDMG 121

Query: 122 EPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPF---VVSMGNPHAIFFVEDDLY 176
              L    IP  L  + D++      +G         P+    VSMGNPH I FVED + 
Sbjct: 122 PAYLKPVEIPTTLTGTGDRVVEADLEVG-------DRPWKVTTVSMGNPHCITFVED-VA 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              LA  G L   HP+F +  N     V   + L +R WERG G T ACG+ ACA++VA+
Sbjct: 174 AVPLAEIGPLFEHHPVFPQRTNTEFVEVVRPDYLKMRVWERGAGATLACGTGACATLVAA 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               +++R  +V++ GG L IEW ++ H+FMTG A K + G +++
Sbjct: 234 VLTGRSDRQATVELPGGPLQIEWREDGHLFMTGPAVKVFSGSMEL 278


>gi|332559405|ref|ZP_08413727.1| diaminopimelate epimerase [Rhodobacter sphaeroides WS8N]
 gi|332277117|gb|EGJ22432.1| diaminopimelate epimerase [Rhodobacter sphaeroides WS8N]
          Length = 279

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 145/279 (51%), Gaps = 16/279 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN--THFDQIMLIHDFQDASV 60
           SS + F KM G GN  +VID RG    + +  +     D +    FDQ+  I D + A  
Sbjct: 7   SSGLGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQEGA-- 64

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D  +   N DGS   +CGN  RCV  +L   + R   T  T RG L A+   DG ++V+M
Sbjct: 65  DCALDFWNSDGSRSGACGNATRCVSDYLMRDLGRDEVTLVTARGHLHARRREDGLVAVNM 124

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L W  IPLAR+   M+ D     P+       P  V MGNPH +FFVED     DL
Sbjct: 125 GAPQLLWSEIPLARA---METDSL---PLEG----GPAAVGMGNPHCVFFVED-AEAVDL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G  +   P+F E  N+  A +   + L LR WERG G+T ACGS ACA+ VA+    
Sbjct: 174 AGRGASVETDPLFPERTNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRG 233

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            T R V ++M GG L ++W D   V+++G   + +EG L
Sbjct: 234 LTGRQVRLEMDGGVLEVDWRDEG-VWLSGPVARVFEGHL 271


>gi|221640409|ref|YP_002526671.1| diaminopimelate epimerase [Rhodobacter sphaeroides KD131]
 gi|221161190|gb|ACM02170.1| Diaminopimelate epimerase [Rhodobacter sphaeroides KD131]
          Length = 279

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 145/279 (51%), Gaps = 16/279 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN--THFDQIMLIHDFQDASV 60
           SS + F KM G GN  +VID RG    + +  +     D +    FDQ+  I D + A  
Sbjct: 7   SSGLGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQEGA-- 64

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D  +   N DGS   +CGN  RCV  +L   + R   T  T RG L A+   DG ++V+M
Sbjct: 65  DCALDFWNSDGSRSGTCGNATRCVSDYLMRDLGRDEVTLVTARGHLHARRREDGLVAVNM 124

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L W  IPLAR+   M+ D     P+       P  V MGNPH +FFVED     DL
Sbjct: 125 GAPQLLWSEIPLARA---METDSL---PLEG----GPAAVGMGNPHCVFFVED-AEAVDL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G  +   P+F E  N+  A +   + L LR WERG G+T ACGS ACA+ VA+    
Sbjct: 174 AGRGASVETDPLFPECTNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRG 233

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            T R V ++M GG L ++W D   V+++G   + +EG L
Sbjct: 234 LTGRQVRLEMDGGVLEVDWRDEG-VWLSGPVARVFEGHL 271


>gi|288553989|ref|YP_003425924.1| diaminopimelate epimerase [Bacillus pseudofirmus OF4]
 gi|288545149|gb|ADC49032.1| diaminopimelate epimerase [Bacillus pseudofirmus OF4]
          Length = 282

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 158/289 (54%), Gaps = 23/289 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALST---DDNTHF--DQIMLIHDFQDASVDA 62
           F KM G+GN  + +D+    + +  + + AL+    D N     D ++L+     A V  
Sbjct: 3   FTKMHGLGNSYIYVDL--FKETLEEEQLAALAVEVADKNKGIGSDGMILVCPSDVAPVK- 59

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SI 116
            +R+ N DGSE ++CGNG+RCV +F      +K ++F  ET+ G++ A  + +G    ++
Sbjct: 60  -MRVFNNDGSEAKNCGNGLRCVAKFAYEHGYVKDQTFQIETLGGLVTATVHIEGERVHTV 118

Query: 117 SVDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           +V+MG+P L  + +P L  S +K+  + F +             VSMGNPH +FFVED +
Sbjct: 119 TVNMGKPRLTRESLPMLGSSTEKIVAEPFEVAETKLELT----AVSMGNPHGVFFVED-I 173

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G ++ K   F E +N+    V S   L  R WERG G+T ACG+ ACA+VVA
Sbjct: 174 NQAPVDTLGPIIEKDERFPEWINVEFVEVVSESELHFRVWERGSGITQACGTGACAAVVA 233

Query: 236 SGCLHKTNR--AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           S     +N+  +V+V +LGG L IEW ++  V MTG A+   EG  + K
Sbjct: 234 SILNGHSNKGESVTVHLLGGDLEIEWTESGDVLMTGAAEVICEGVFERK 282


>gi|330892011|gb|EGH24672.1| diaminopimelate epimerase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 276

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 140/282 (49%), Gaps = 12/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDA 62
           ++ F KM G+GN  +V+D+   H +I          D +T   FDQ++L+    +  VD 
Sbjct: 2   LLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWG-DPHTGIGFDQLLLVEAPNNPDVDF 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC  RF+  +    +K    ET  GI+      DG ISVDM
Sbjct: 61  RYRIFNSDGSEVEQCGNGARCFARFVLDKRLTAKKQIRVETKSGIIELDIRSDGQISVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P    + IP   + ++  R    +   N         VSMGNPHA+  V DD+ +  +
Sbjct: 121 GPPRFVPEEIPF-EAAEQATRYNVEVDGQNIELA----AVSMGNPHAVLRV-DDINNAPV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  +  HP F   VN+    V   +   LR WERG G T ACG+ ACA  VA+    
Sbjct: 175 HELGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWERGAGETQACGTGACAGAVAAISQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             +  + + + GG L IEW    H V MTG A + +EG++ +
Sbjct: 235 WMDSPLLIDLPGGRLSIEWAGPGHSVMMTGPAVRVYEGQVRL 276


>gi|300087803|ref|YP_003758325.1| diaminopimelate epimerase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527536|gb|ADJ26004.1| diaminopimelate epimerase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 291

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 141/276 (51%), Gaps = 12/276 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           +DF K+  +GN  ++I+    +      A+ A         D ++++   Q A  D  +R
Sbjct: 1   MDFTKLHSLGNDFILIEGDLDNSEWPETAVWACDRHFGIGGDGLLVLMPSQKA--DYRMR 58

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGI---LVAKENRDGSISVDM 120
           I N DGSE ++CGNG+RC+V+++       ++  T ET  G+    ++    D  I   M
Sbjct: 59  IFNNDGSEAEACGNGLRCLVKYILEFKEQDKQELTIETAAGVRKATISGNTSDPDIKTGM 118

Query: 121 GEPILDWKLIPL----ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           GEPIL+   IP+     +  +       +   VN       F VSMGNPHAI F+E DL 
Sbjct: 119 GEPILETIRIPVEIEDGKGHELCGMTSGYPLSVNGQEHTLAF-VSMGNPHAIEFIESDLE 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + L   G  + KH MF    N  IARV     +++R WERGVG T ACGS ACA VVAS
Sbjct: 178 AFPLGDVGPSIEKHSMFPSHTNYEIARVIDNSHIEMRVWERGVGETLACGSGACAVVVAS 237

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
             +  T   V +K+ GG L  EW +   V++TG A+
Sbjct: 238 WIMGLTEGQVDIKLPGGELKAEWAETGEVYLTGRAQ 273


>gi|229844619|ref|ZP_04464758.1| diaminopimelate epimerase [Haemophilus influenzae 6P18H1]
 gi|229812333|gb|EEP48023.1| diaminopimelate epimerase [Haemophilus influenzae 6P18H1]
          Length = 274

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 145/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T ACGS A A+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGAGAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|311693139|gb|ADP96012.1| diaminopimelate epimerase [marine bacterium HP15]
          Length = 304

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 146/289 (50%), Gaps = 18/289 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASV 60
           Q  M+ F KM G+GN  +V+D       +  + I  L+  +    FDQ++++       V
Sbjct: 8   QGPMLRFTKMHGLGNDFMVVDAISQPFRLRPEMIRELANRNFGIGFDQLLVVEPPGLPDV 67

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI N DGSEV+ CGNG RC  RF+  +    +K    +T +G++  +  R+G + V
Sbjct: 68  DFRYRIFNADGSEVEQCGNGARCFARFVRDQRLTNKKVIRVQTAKGVIELRVGREGMVMV 127

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHI---GPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           +MG P  +   IP A    K   D + +   G    L       +SMGNPH +  VED +
Sbjct: 128 NMGVPEFNPPAIPFAADRRK---DVYTVDVDGQTVELS-----ALSMGNPHGVLLVED-V 178

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G  L +HP F    N+   ++     + LR +ERG G T ACGS ACA+VVA
Sbjct: 179 DQAPVETLGPKLERHPRFPARANIGFLQILDRTHVRLRVFERGSGETLACGSGACAAVVA 238

Query: 236 SGCLHKTNRA-VSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
            GCL     A V V++ GG L+IEW  +   V M G A   +EG+L + 
Sbjct: 239 -GCLRGLLDARVEVELRGGPLVIEWQGEGTPVMMEGPATSVFEGQLRLP 286


>gi|325129925|gb|EGC52726.1| diaminopimelate epimerase [Neisseria meningitidis OX99.30304]
 gi|325136015|gb|EGC58625.1| diaminopimelate epimerase [Neisseria meningitidis M0579]
 gi|325202442|gb|ADY97896.1| diaminopimelate epimerase [Neisseria meningitidis M01-240149]
 gi|325207806|gb|ADZ03258.1| diaminopimelate epimerase [Neisseria meningitidis NZ-05/33]
          Length = 283

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 145/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVEQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 RFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|311031748|ref|ZP_07709838.1| diaminopimelate epimerase [Bacillus sp. m3-13]
          Length = 284

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 151/278 (54%), Gaps = 19/278 (6%)

Query: 7   DFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
            F KM G+GN  + ++M   +   + +++ A+   +       D ++LI   + A V   
Sbjct: 5   QFTKMHGLGNNYIYVNMFEEKLKEEELSNLAVKVANIHTGIGSDGMILICPSEVAPVK-- 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SIS 117
           +RI N DGSE ++CGNG+RCV ++      ++RK+F  ET+ G++ A+   +     S++
Sbjct: 63  MRIFNNDGSEGKNCGNGLRCVAKYAYEHGIVQRKTFKIETLSGLVEAEMELEAGKVTSVT 122

Query: 118 VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           VDMGEP L  K IP L    + +  + F +    +        VSMGNPH IF++ DD+ 
Sbjct: 123 VDMGEPRLSTKEIPILVEEKEALVAEPFTVDGETYEIT----TVSMGNPHVIFYL-DDIK 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L + G ++ K P F EGVN+    V + + L  R WERG G+T ACG+ ACA+VVAS
Sbjct: 178 DAPLTTLGPVVEKDPRFPEGVNVEFVEVVAEDELHFRVWERGSGITQACGTGACAAVVAS 237

Query: 237 GCLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
              +KT  N+   V + GG L I W  +  V M G A+
Sbjct: 238 VLNNKTARNKETVVHLAGGDLFITWTKDGSVKMRGPAE 275


>gi|121634557|ref|YP_974802.1| diaminopimelate epimerase [Neisseria meningitidis FAM18]
 gi|120866263|emb|CAM10004.1| putative diaminopimelate epimerase [Neisseria meningitidis FAM18]
 gi|308388948|gb|ADO31268.1| putative diaminopimelate epimerase [Neisseria meningitidis
           alpha710]
 gi|325132004|gb|EGC54703.1| diaminopimelate epimerase [Neisseria meningitidis M6190]
 gi|325137835|gb|EGC60410.1| diaminopimelate epimerase [Neisseria meningitidis ES14902]
          Length = 283

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 144/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 RFMPSEIPFVPELGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|157960207|ref|YP_001500241.1| diaminopimelate epimerase [Shewanella pealeana ATCC 700345]
 gi|157845207|gb|ABV85706.1| Diaminopimelate epimerase [Shewanella pealeana ATCC 700345]
          Length = 278

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 148/283 (52%), Gaps = 14/283 (4%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDAS 59
           S ++ F KM G+GN  +V+D  G   N+  + D I  L+  +    FDQ++L+    D  
Sbjct: 2   SILIQFTKMHGLGNDFMVVD--GVTQNVFFSPDQIKRLADRNFGVGFDQLLLVEPPYDPD 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV+ CGNG RC  RF+ ++    +      T  G +  +  RDG ++
Sbjct: 60  LDFHYRIFNADGSEVEQCGNGARCFARFVRNKGLTHKHKIRVSTSSGKITLRLERDGKVT 119

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L+   IP   +  K+++    +             VSMGNPH +  VED +  
Sbjct: 120 VNMGIPALEPGKIPF--TAKKVEKTYLLMASSGTYLCG---AVSMGNPHCVIEVED-VAA 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+ + G  L  H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV   
Sbjct: 174 TDVDTIGGELTNHERFPKGVNVGFMQVLNSGHIKLRVYERGAAETLACGTGACAAVVVGI 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              K +R V V + GG L+I W  +   ++MTG A+  ++G++
Sbjct: 234 LQGKLDRNVQVDLPGGSLMINWDGEGKPLWMTGPAEHVYDGQI 276


>gi|119469652|ref|ZP_01612521.1| diaminopimelate epimerase [Alteromonadales bacterium TW-7]
 gi|119446899|gb|EAW28170.1| diaminopimelate epimerase [Alteromonadales bacterium TW-7]
          Length = 276

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 145/283 (51%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIKKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N DG+EV+ CGNG RC  RF+  RMK    +   +  T  G L     +DG ++V+
Sbjct: 62  YRIFNADGTEVEQCGNGARCFARFV--RMKGLTNKHKISVSTKSGNLTLYIEKDGQVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P  +   IPL  S  ++    + I    H        VSMGNPH +  V DD+    
Sbjct: 120 MGHPNFEPSKIPLKASKRELT---YIIRAEEHTVFSG--AVSMGNPHCVIEV-DDITTAQ 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     
Sbjct: 174 VDVLGPLLENHERFPQRANIGFMQVISQEHIKLRVWERGVNETLACGTGACAAMVIGHMQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            K + AV V + GG L I W    H V MTG A+  ++G++ +
Sbjct: 234 SKLSSAVQVDLPGGTLQIRWSGEGHPVRMTGPAEHVFDGQVAL 276


>gi|88861275|ref|ZP_01135907.1| diaminopimelate epimerase [Pseudoalteromonas tunicata D2]
 gi|88816756|gb|EAR26579.1| diaminopimelate epimerase [Pseudoalteromonas tunicata D2]
          Length = 276

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 145/284 (51%), Gaps = 16/284 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  I  D I  L+  +    FDQ++++    D  +D  
Sbjct: 2   LVNFSKMHGLGNDFMVIDNVTQNVFIARDQIIKLADRNFGIGFDQLLMVEAPYDPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N DG+EV+ CGNG RC  RF+  RMK    R      T  G +     +DG +SV+
Sbjct: 62  YRIFNSDGTEVEQCGNGARCFARFV--RMKGLTNRHKILVSTKSGNMTLHIEKDGLVSVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG+P L+   IP    F    R+  +I    +H        VSMGNPH +  V DD+   
Sbjct: 120 MGQPKLEPHTIP----FKAAKRENTYIFRAQDHTVFCG--AVSMGNPHCVVEV-DDITTA 172

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G LL  H  F +  N+   ++ S E + LR WERG G T ACG+ ACA+VV    
Sbjct: 173 PVNVLGPLLENHERFPQRANIGFMQIISPEHIKLRVWERGAGETLACGTGACAAVVVGIL 232

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             K    V V + GG L + W    H V MTG A+  ++G++ +
Sbjct: 233 QKKLAPHVQVDLPGGRLEVRWQGEGHSVRMTGPAEHVFDGQIAL 276


>gi|325142033|gb|EGC64465.1| diaminopimelate epimerase [Neisseria meningitidis 961-5945]
 gi|325197981|gb|ADY93437.1| diaminopimelate epimerase [Neisseria meningitidis G2136]
          Length = 283

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 145/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVEQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 RFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|296313835|ref|ZP_06863776.1| diaminopimelate epimerase [Neisseria polysaccharea ATCC 43768]
 gi|296839564|gb|EFH23502.1| diaminopimelate epimerase [Neisseria polysaccharea ATCC 43768]
          Length = 283

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 145/280 (51%), Gaps = 13/280 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASVDAFI 64
           F KM G+GN  +VID      N T + +      D      FDQ++++   +   VD   
Sbjct: 6   FTKMHGLGNDFMVID--AVSQNFTPEDVPIAEWADRFRGVGFDQLLVVGRSETEGVDFRY 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +K    ET +G++  K + +G ++V+MG+
Sbjct: 64  RIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAKGVIFPKLSDNGMVTVNMGK 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP      + D D    G      ++    V+MGNPHA+  V DD+    +  
Sbjct: 124 PKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVITV-DDVECAPVRE 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCL 239
            G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L
Sbjct: 182 TGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLL 241

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 242 DE-GKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|319760695|ref|YP_004124633.1| diaminopimelate epimerase [Candidatus Blochmannia vafer str. BVAF]
 gi|318039409|gb|ADV33959.1| diaminopimelate epimerase [Candidatus Blochmannia vafer str. BVAF]
          Length = 277

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 143/277 (51%), Gaps = 13/277 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +V+D      ++T + I  LS       F+Q++++    D S+D   RI
Sbjct: 3   FSKMHGLGNDFMVVDSITQKVHVTFEKIQWLSNRYRGIGFNQLLIVEPPYDPSIDFHCRI 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSEV  CGNG+RCV RF+  +    +++    T  G +      D  ISV+MGEPI
Sbjct: 63  YNADGSEVYQCGNGIRCVARFVYIKKLTNKENIRISTRFGNMYVSIIDDDLISVNMGEPI 122

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
            +   IP    F +  ++     P   +      VVS+GNPH I  VE  +    L   G
Sbjct: 123 FEPDKIPFI--FPQYQKNYILFLPTQTILCG---VVSIGNPHCIVLVE-TIESVSLNILG 176

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VASGCLHK 241
             L  H  F +  N+S  R+   E+++LR +ERGVG T ACGSAACA+V   +  G L +
Sbjct: 177 PALEDHHCFPKKSNISFMRIIDSENIELRVYERGVGETQACGSAACAAVAFGIQQGLLIR 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
             R V V +LGG L + W    + ++M G     ++G
Sbjct: 237 EERLVQVHLLGGSLFVSWKGIGYPLYMIGSTSYVYDG 273


>gi|220933237|ref|YP_002512136.1| Diaminopimelate epimerase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254767121|sp|B8GT89|DAPF_THISH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219994547|gb|ACL71149.1| Diaminopimelate epimerase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 278

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 147/288 (51%), Gaps = 24/288 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQD-ASVDAF 63
           + F+KM G+GN  +VID      +++ D +  L+        DQ++L+    D A+ D  
Sbjct: 3   IQFSKMHGLGNDFVVIDAIHQPVDLSPDQVRLLAHRRFGVGCDQVLLVERPSDPAAADFR 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC   F+  R    +     ET  GI+  +   DG ++VDMG
Sbjct: 63  YRIFNADGNEVEQCGNGARCFAVFVRERGLTAKDHIPVETAAGIIHLQVQPDGQVTVDMG 122

Query: 122 EPILDWKLIPLA-----RSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
            P L    IP        S+  +++ + + IG            VSMGNPHA+  V D++
Sbjct: 123 PPRLKPWQIPFEAESAMTSYPLEVEGETYEIG-----------AVSMGNPHAVLRV-DNV 170

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +A  G L+  HP F   VN+   +V S   + LR +ERGVG T ACG+ ACA+VV+
Sbjct: 171 QTAPVARLGPLIEAHPRFPRHVNVGFMQVVSPGEIRLRVYERGVGETLACGTGACAAVVS 230

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW--HDNNHVFMTGEAKKEWEGKLDI 281
                  +  V+V + GG L+I W   +   V MTG A + + G +DI
Sbjct: 231 GRIQGLLDETVAVDLPGGRLVINWAGQEEAPVMMTGPATQVFTGSIDI 278


>gi|238798589|ref|ZP_04642065.1| Diaminopimelate epimerase [Yersinia mollaretii ATCC 43969]
 gi|238717545|gb|EEQ09385.1| Diaminopimelate epimerase [Yersinia mollaretii ATCC 43969]
          Length = 278

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 144/278 (51%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D  +D  
Sbjct: 5   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLA-DRHTGVGFDQMLVVEPPYDPELDFH 63

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MG
Sbjct: 64  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDEEVCVNMG 123

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EP  D + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+   ++
Sbjct: 124 EPNFDPQSVP----FRATKAEKTYIFRAAEHTVLCG--VVSMGNPHCVLQV-DDVSVANV 176

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G +L  H  F E  N+   +V S E++ LR +ERG G T ACGS ACA+V       
Sbjct: 177 ALLGPVLESHERFPERANIGFMQVVSRENIRLRVYERGAGETQACGSGACAAVAVGIQQE 236

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
             +  V+V++ GG LLI W    H ++MTG A   ++G
Sbjct: 237 LLDEEVTVELPGGSLLISWKGPGHPLYMTGPATHVYDG 274


>gi|170718542|ref|YP_001783749.1| diaminopimelate epimerase [Haemophilus somnus 2336]
 gi|189082834|sp|B0UWU6|DAPF_HAES2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|168826671|gb|ACA32042.1| Diaminopimelate epimerase [Haemophilus somnus 2336]
          Length = 274

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 140/276 (50%), Gaps = 10/276 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+  +    FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAVTQNIYFPTEVIKRLADRNRGIGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     +K     T +G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVVLKGLTNKKEIAVSTAKGKMMLCVKDDDMVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   + +K +++      +  L      VVSMGNPH +  VED + H ++  
Sbjct: 121 PIWEPNKIPF--NANKFEKNYIIRTDIQTLLCG---VVSMGNPHCVTQVED-IQHANIEI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINRNHIKLRVYERGAGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
              V V + GG L+IEW    H ++MTGEA   ++G
Sbjct: 235 GSCVQVDLPGGRLMIEWQGKGHPLYMTGEATHIYDG 270


>gi|77464515|ref|YP_354019.1| diaminopimelate epimerase [Rhodobacter sphaeroides 2.4.1]
 gi|123591013|sp|Q3IZB6|DAPF_RHOS4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|77388933|gb|ABA80118.1| diaminopimelate epimerase [Rhodobacter sphaeroides 2.4.1]
          Length = 276

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 144/279 (51%), Gaps = 16/279 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN--THFDQIMLIHDFQDASV 60
           SS + F KM G GN  +VID RG    + +  +     D +    FDQ+  I D + A  
Sbjct: 4   SSGLGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQEGA-- 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D  +   N DGS   +CGN  RCV  +L   + R      T RG L A+   DG ++V+M
Sbjct: 62  DCALDFWNSDGSRSGTCGNATRCVSDYLMRDLGRDEVNLVTARGRLHARRREDGLVAVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L W  IPLAR+   M+ D     P+       P  V MGNPH I+FVED     DL
Sbjct: 122 GAPQLLWSEIPLARA---METDSL---PLEG----TPSAVGMGNPHCIYFVED-AEAVDL 170

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G  +   P+F E  N+  A +   + L LR WERG G+T ACGS ACA+ VA+    
Sbjct: 171 AGRGAAVETDPLFPERTNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRG 230

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            T R V ++M GG L ++W D   V+++G   + +EG L
Sbjct: 231 LTGRQVRLEMDGGVLEVDWRDEG-VWLSGPVARVFEGHL 268


>gi|260888468|ref|ZP_05899731.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
 gi|330838220|ref|YP_004412800.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
 gi|260862004|gb|EEX76504.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
 gi|329745984|gb|AEB99340.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
          Length = 279

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 145/283 (51%), Gaps = 18/283 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F K +G GN  ++++  G  + +  D         + H+    D ++L+   Q A  D  
Sbjct: 5   FTKWQGCGNDFVLVN--GFREQLPDDLAALSRRVCDRHYGIGADGLILVLPSQQA--DFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----IS 117
           +RI N DG+E + CGNG+RC    + +        FT ET  GILV +    GS    + 
Sbjct: 61  MRIFNADGTEAEMCGNGIRCFAGVVHAEGLSGEAEFTVETGAGILVPRLQLAGSRLTGVR 120

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL+ + IP+   F         I      F      VSMGNPH + FVED    
Sbjct: 121 VDMGEPILEGERIPVL-GFGASRVIEQPIEAEGETFSMT--CVSMGNPHCVIFVED-AQD 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +  FG LL +H  F +  N+  A +     + +R WERG  +T ACG+ +CA++VA+ 
Sbjct: 177 VPMEKFGPLLERHEKFPKKTNVEFAEIKDASHIRMRVWERGAAVTLACGTGSCATLVAAA 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              +T R   V++ GG L IEW +N+HV+MTG A+K + G+ +
Sbjct: 237 LTGRTKREAEVQLDGGRLQIEWAENHHVYMTGPAEKVFAGRYE 279


>gi|329117998|ref|ZP_08246711.1| diaminopimelate epimerase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465886|gb|EGF12158.1| diaminopimelate epimerase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 287

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 137/288 (47%), Gaps = 15/288 (5%)

Query: 4   SMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +++ F KM G+GN   VID +    D   +             FDQ++L+        D 
Sbjct: 2   AVLKFTKMHGLGNDFAVIDGISQPFDPAAAPIAAWADRHTGIGFDQLLLVEQPVSPEADF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DG EV+ CGNG RC  RF+  +    ++    ET RGI+V K    G ++VDM
Sbjct: 62  RYRIFNADGGEVEQCGNGARCFARFVADKGLTDKREIVVETARGIIVPKLEEGGLVTVDM 121

Query: 121 GEPILDWKLIPL----ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           G+P L    IP       + D +  D    G    + L     V+MGNPHA+  V DD  
Sbjct: 122 GKPRLRPSEIPFLPAEGAAEDALRHDIAANGAAVSVGL-----VNMGNPHAVLTV-DDTD 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV-- 234
              +A+ G  L  HP F E  N+   +V     + LR +ERGVG T ACG+ ACA+VV  
Sbjct: 176 AAPVATLGAALETHPQFPEKANIGFMQVLDPHRIRLRVFERGVGETQACGTGACAAVVHG 235

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
               L      V V + GG L I W +   V MTG A+  ++G +  +
Sbjct: 236 VRLGLLAAGEPVEVSLPGGRLRISWREGGSVMMTGPAQTVFDGVISYQ 283


>gi|332289910|ref|YP_004420762.1| diaminopimelate epimerase [Gallibacterium anatis UMN179]
 gi|330432806|gb|AEC17865.1| diaminopimelate epimerase [Gallibacterium anatis UMN179]
          Length = 274

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 145/281 (51%), Gaps = 12/281 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D        + D I  L+  +    FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGITQSVYFSEDVIRRLADRNRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF  L     +K     T +G +V   N D ++ V+MGE
Sbjct: 61  RIFNADGSEVEQCGNGARCFARFVRLKGLTNKKEINVSTAKGKIVLIVNDDETVRVNMGE 120

Query: 123 PILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   +P +A  F+K    R  I  V         VVSMGNPH +  VED +   ++ 
Sbjct: 121 PIWEPAKVPFIANKFEKNYILRTDIQTVLC------GVVSMGNPHCVLQVED-VKTANVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F    N+   +V + + + LR +ERG G T ACG+ ACA+V        
Sbjct: 174 QLGPLLEHHERFPARANIGFMQVLNRKQIKLRVFERGAGETQACGTGACAAVAVGIMQGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +  V V++ GG L+IEW    + ++MTG+A   ++G + +
Sbjct: 234 LDNQVEVELPGGKLMIEWQGVGYPLYMTGDATFVYDGNIQL 274


>gi|240950051|ref|ZP_04754357.1| diaminopimelate epimerase [Actinobacillus minor NM305]
 gi|240295469|gb|EER46217.1| diaminopimelate epimerase [Actinobacillus minor NM305]
          Length = 274

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 140/283 (49%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGVTQNVFLTEEIIQKLADRHRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +G + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLSLKENGQVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   IP  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQIPFTANKFEK------------NYILRTSLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 QTAPVNELGPLLENHERFPERANIGFMQVINRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L+IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGLLDSKVQVDLPGGSLMIEWEGVGHSLYMTGDATHIYDG 270


>gi|161869705|ref|YP_001598872.1| diaminopimelate epimerase [Neisseria meningitidis 053442]
 gi|161595258|gb|ABX72918.1| diaminopimelate epimerase [Neisseria meningitidis 053442]
 gi|325127855|gb|EGC50761.1| diaminopimelate epimerase [Neisseria meningitidis N1568]
 gi|325133725|gb|EGC56381.1| diaminopimelate epimerase [Neisseria meningitidis M13399]
          Length = 283

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 144/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|316983746|gb|EFV62727.1| diaminopimelate epimerase [Neisseria meningitidis H44/76]
 gi|325200553|gb|ADY96008.1| diaminopimelate epimerase [Neisseria meningitidis H44/76]
 gi|325203848|gb|ADY99301.1| diaminopimelate epimerase [Neisseria meningitidis M01-240355]
 gi|325206397|gb|ADZ01850.1| diaminopimelate epimerase [Neisseria meningitidis M04-240196]
          Length = 283

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 144/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|113474945|ref|YP_721006.1| diaminopimelate epimerase [Trichodesmium erythraeum IMS101]
 gi|123056925|sp|Q116P1|DAPF_TRIEI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|110165993|gb|ABG50533.1| diaminopimelate epimerase [Trichodesmium erythraeum IMS101]
          Length = 278

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 138/276 (50%), Gaps = 11/276 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDA-SVDAFIRI 66
           F K  G+GN  ++ID R     I +        D N       +I         D  +RI
Sbjct: 5   FTKYHGLGNDFILIDNRHQLQPILTPEQAIELCDRNFGIGADGVIFALPGVKQTDYTMRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSE + CGNG+RC+ +F+       +  +   T  GI+V +   DG ++VDMG+P 
Sbjct: 65  FNSDGSEPEMCGNGIRCLAKFIAELENNNKTKYNIHTGAGIIVPELQGDGQVTVDMGQPR 124

Query: 125 LDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           L    IP  LA + DK+      +G  +         VSMGNPH I FVED +   DLA 
Sbjct: 125 LLASEIPTTLANADDKVVDQLLEVGGKSWFVT----CVSMGNPHCITFVED-VTAIDLAK 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G     +P+F E  N    +V S + + +R WERG G T ACG+ ACASVVA       
Sbjct: 180 IGPKFEHNPVFPERTNTEFIQVISPKYVKMRVWERGAGATLACGTGACASVVAGVLTQNN 239

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
            R V+V++ GG L IEW   +  ++MTG A+K + G
Sbjct: 240 ERLVTVELPGGCLEIEWSTIDQKIYMTGPAEKVFTG 275


>gi|315125205|ref|YP_004067208.1| diaminopimelate epimerase [Pseudoalteromonas sp. SM9913]
 gi|315013718|gb|ADT67056.1| diaminopimelate epimerase [Pseudoalteromonas sp. SM9913]
          Length = 276

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 145/283 (51%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIKKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N DG EV+ CGNG RC  RF+  RMK    +   +  T  G L     +DG ++V+
Sbjct: 62  YRIFNADGHEVEQCGNGARCFARFV--RMKGLTNKHKISVSTKSGNLTLYIEKDGQVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P  +   IPL  +  ++    + I    H        VSMGNPH +  V DD+    
Sbjct: 120 MGHPNFEPSKIPLKATKRELT---YIIRAEEHTVFSG--AVSMGNPHCVMEV-DDIETAQ 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +++ G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     
Sbjct: 174 VSTLGPLLENHERFPQRANIGFMQVISQEHIKLRVWERGVSETLACGTGACAAMVIGFIQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +K    V V + GG L + W    H V MTG A+  ++G++ +
Sbjct: 234 NKLTSTVQVDLPGGSLQVRWSGEGHPVRMTGPAEHVFDGQVAL 276


>gi|218767882|ref|YP_002342394.1| diaminopimelate epimerase [Neisseria meningitidis Z2491]
 gi|21362492|sp|Q9JV69|DAPF_NEIMA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|121051890|emb|CAM08196.1| putative diaminopimelate epimerase [Neisseria meningitidis Z2491]
 gi|319410129|emb|CBY90465.1| diaminopimelate epimerase (DAP epimerase) [Neisseria meningitidis
           WUE 2594]
          Length = 283

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 144/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 RFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAQVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|209526281|ref|ZP_03274810.1| Diaminopimelate epimerase [Arthrospira maxima CS-328]
 gi|209493210|gb|EDZ93536.1| Diaminopimelate epimerase [Arthrospira maxima CS-328]
          Length = 287

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 139/280 (49%), Gaps = 9/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQ-DASVDAFI 64
           ++F K  G+GN  ++ID R   + I +        D +       +I     D + D  +
Sbjct: 3   IEFTKYHGLGNDFILIDNRHQSEPICTQRQAVQMCDRHFGIGADGVIFALPGDGASDYTM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRK----SFTFETIRGILVAKENRDGSISVDM 120
           RI N DGSE + CGNG+RC+ +F+T    +     ++   T  G++  +   DG + VDM
Sbjct: 63  RIFNSDGSEPEMCGNGIRCLAKFITELEGKTGTAIAYKINTAAGVICPELLTDGQVKVDM 122

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L    IP   S + +      +     +       VSMGNPH I FV DD+    L
Sbjct: 123 GLPRLLAAEIPTTLSENNLKVIDVPLEVAGQVLSVT--CVSMGNPHCITFV-DDVASVPL 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L   HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA     
Sbjct: 180 TEIGPLFEHHPAFPERTNTEFIEVVRPDYVKMRVWERGAGITLACGTGACASVVAGVLTQ 239

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           + +R V+V++ GG L IEW   +  ++MTG A+  ++G+L
Sbjct: 240 RCDRQVTVELPGGCLQIEWSATDQRLYMTGPAQAVFQGQL 279


>gi|307153995|ref|YP_003889379.1| diaminopimelate epimerase [Cyanothece sp. PCC 7822]
 gi|306984223|gb|ADN16104.1| diaminopimelate epimerase [Cyanothece sp. PCC 7822]
          Length = 281

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 145/283 (51%), Gaps = 19/283 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K  G+GN  ++ID R   D + S  +     D   HF    D ++ +        D
Sbjct: 3   IEFTKYHGLGNDFILIDNRHSKDPLVSPEMAVQMCDR--HFGIGADGVIFVLP-GTPQTD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENRDGSIS 117
             +RI N DGSE + CGNG+RC+ +F+     +    K++  +T+ G++  +   +  ++
Sbjct: 60  YQMRIFNSDGSEPEMCGNGIRCLAQFIAQLEGTSESGKAYRIDTLAGVITPRLEEEEQVT 119

Query: 118 VDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P L    IP  L  + +K+      +G  + L       VSMGNPH I FVE+ +
Sbjct: 120 VDMGPPQLQAAQIPTTLVTATEKVINQPLSVGGKSWLVT----CVSMGNPHCITFVEN-V 174

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L   G     H  F +  N     V   + L +R WERG G+T ACG+ ACA+VVA
Sbjct: 175 DEIPLEVIGPEFEHHAAFPQRTNTEFIEVVRPDYLKMRVWERGAGITLACGTGACATVVA 234

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEG 277
               H+++R  +V++ GG L I W + + HV+MTG AK+ + G
Sbjct: 235 GLLTHRSDRRCTVELPGGCLRIYWSETDGHVYMTGPAKRVFSG 277


>gi|313668759|ref|YP_004049043.1| diaminopimelate epimerase [Neisseria lactamica ST-640]
 gi|313006221|emb|CBN87683.1| putative diaminopimelate epimerase [Neisseria lactamica 020-06]
          Length = 283

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 145/280 (51%), Gaps = 13/280 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITS-DAINALSTDD--NTHFDQIMLIHDFQDASVDAFI 64
           F KM G+GN  +VID      N T  DA  A   D      FDQ++++   +   VD   
Sbjct: 6   FTKMHGLGNDFMVID--AVSQNFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDFRY 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K    ET +G++  K + +G ++V+MG+
Sbjct: 64  RIFNADGSEVGQCGNGARCFARFVTDKGLTDKKEICVETAKGVIFPKLSDNGMVTVNMGK 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP      + D D    G      ++    V+MGNPHA+  V DD+    +  
Sbjct: 124 PKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRE 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCL 239
            G L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L
Sbjct: 182 TGPLIEAHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLL 241

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 242 DE-GKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|332534420|ref|ZP_08410260.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036154|gb|EGI72629.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 276

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 145/283 (51%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIKKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N DG+EV+ CGNG RC  RF+  RMK    +   +  T  G L     +DG ++V+
Sbjct: 62  YRIFNADGTEVEQCGNGARCFARFV--RMKGLTNKHKISVSTKSGNLTLYIEKDGQVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P  +   IPL  S  ++    + I    H        VSMGNPH +  V DD+    
Sbjct: 120 MGHPNFEPSKIPLKASKRELT---YIIRTQEHTVFSG--AVSMGNPHCVLEV-DDVTTAQ 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     
Sbjct: 174 VDILGPLLENHERFPQKANIGFMQVVSQEHIKLRVWERGVNETLACGTGACAAMVIGHMQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +K +  V V + GG L + W    H V MTG A+  ++G++ +
Sbjct: 234 NKLSTTVQVDLPGGTLQVRWSGEGHPVRMTGPAEHVFDGQVAL 276


>gi|332994943|gb|AEF04998.1| diaminopimelate epimerase [Alteromonas sp. SN2]
          Length = 276

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 147/282 (52%), Gaps = 14/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + D I  L+  +    FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFMVIDNVTQNVFFSKDKIQQLANRNFGIGFDQLLMVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +  + R      T  G +V    +DG ++V+MG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIVVSTKAGKMVLYLEKDGQVTVNMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P  +   IPL  +     ++  +I  VN   LF      VSMGNPH +  VED +    +
Sbjct: 123 PEFEPAKIPLKAN----KQENTYILRVNDKTLFYG---AVSMGNPHCVMEVED-VDTAPV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+ ++  F EGVN+   ++ +   + LR +ERG G T ACGS ACA+V       
Sbjct: 175 KEIGPLVERNERFPEGVNVGFMQIINESHIRLRVFERGSGETLACGSGACAAVAIGQIQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           K ++ V V + GG L I W   ++V  MTG A   ++G +++
Sbjct: 235 KLSKDVRVDLPGGSLRIRWPGPDNVLKMTGPADHVYDGHINL 276


>gi|160892976|ref|ZP_02073764.1| hypothetical protein CLOL250_00513 [Clostridium sp. L2-50]
 gi|156865059|gb|EDO58490.1| hypothetical protein CLOL250_00513 [Clostridium sp. L2-50]
          Length = 278

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 151/286 (52%), Gaps = 25/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIH--DFQDASVD 61
           F KMEG+GN  + I+   C      +         + HF    D ++LI   D  D ++D
Sbjct: 3   FTKMEGLGNDYVYIN---CFSEKVENPEKLAIAMSDRHFGVGSDGVILIKPSDKADFTMD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGS 115
            +    N DGS  + CGNG+RCV +++       + S + ET+ GI     V K+ +   
Sbjct: 60  MY----NADGSRSEMCGNGIRCVGKYVYDYGLTDKTSISVETLAGIKYLDFVIKDGKVDM 115

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           ++VDMG PIL    +P+    +++  ++  +  V++        VSMGNPHA+ FV DD 
Sbjct: 116 VTVDMGAPILKADQVPVRSDKEQVIDEKITVAGVDYHMT----CVSMGNPHAVMFV-DDT 170

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
            H+ L   G L   H +F   VN    +V    ++ +R WERG G T ACG+ ACA+ VA
Sbjct: 171 EHFPLEEAGPLFEHHEVFPNRVNAEFVQVIDRHTVKMRVWERGTGETLACGTGACATAVA 230

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLD 280
                KT+  V+VK+LGG L+I +  +NN V+MTG A+  ++G+ D
Sbjct: 231 CVLNGKTDDEVTVKLLGGDLIIRFDRENNKVYMTGPARVVFDGETD 276


>gi|325144201|gb|EGC66508.1| diaminopimelate epimerase [Neisseria meningitidis M01-240013]
          Length = 301

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 144/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 24  FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 82

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 83  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 142

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 143 RFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 200

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 201 GSLIEPHRQFPERVNVGFMQIISRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 260

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 261 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 298


>gi|261392870|emb|CAX50451.1| diaminopimelate epimerase (DAP epimerase) [Neisseria meningitidis
           8013]
          Length = 283

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 143/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|257465051|ref|ZP_05629422.1| diaminopimelate epimerase [Actinobacillus minor 202]
 gi|257450711|gb|EEV24754.1| diaminopimelate epimerase [Actinobacillus minor 202]
          Length = 274

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 140/283 (49%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGVTQNVFLTQEIIQKLADRHRGIGFDQLLLVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +G + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLSLKENGQVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   IP  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQIPFTANKFEK------------NYILRTSLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 KTAPVNELGPLLENHERFPERANIGFMQVINRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L+IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGLLDSKVQVDLPGGSLMIEWEGVGHPLYMTGDATHIYDG 270


>gi|332711586|ref|ZP_08431517.1| diaminopimelate epimerase [Lyngbya majuscula 3L]
 gi|332349564|gb|EGJ29173.1| diaminopimelate epimerase [Lyngbya majuscula 3L]
          Length = 281

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 146/282 (51%), Gaps = 14/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRG-CHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R      ITS+ A+     +     D ++     Q+ + D  
Sbjct: 1   MEFTKYHGLGNDFILIDNRDDPKPRITSEQALQLCDRNFGIGADGVIFALPGQEGT-DYT 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT---SRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           +RI N DGSE + CGNG+RC+ +FL        +  +   T+ G+++ +   DG + VDM
Sbjct: 60  MRIFNSDGSEPEMCGNGIRCLAKFLADLEGANHKTHYRIHTLAGVIIPELKDDGKVRVDM 119

Query: 121 GEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           G P L    IP  LA +  K+      I       L     VSMGNPH I FVED     
Sbjct: 120 GMPQLSAAQIPTVLAEADQKVINTPIEIADK----LWEVTCVSMGNPHCITFVED-ADAI 174

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L + G L   H +F +  N    +V   + L +R WERG G T ACG+ ACASVVA   
Sbjct: 175 PLETIGPLFEHHSVFPQRTNTEFIQVVRPDYLKMRVWERGAGATLACGTGACASVVAGVL 234

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             K++R  +V++ GG L IEW + +  V+MTG A++ + GKL
Sbjct: 235 TQKSDRICTVELPGGCLDIEWSETDQRVYMTGPAEQVFSGKL 276


>gi|291567988|dbj|BAI90260.1| diaminopimelate epimerase [Arthrospira platensis NIES-39]
          Length = 295

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 140/283 (49%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQ-DASVDAFI 64
           ++F K  G+GN  ++ID R   + I +        D +       +I     D + D  +
Sbjct: 11  IEFTKYHGLGNDFILIDNRHQSEPICTQKQAVQMCDRHFGIGADGVIFALPGDGASDYTM 70

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRK----SFTFETIRGILVAKENRDGSISVDM 120
           RI N DGSE + CGNG+RC+ +F+     +     ++   T  G++  +   DG + VDM
Sbjct: 71  RIFNSDGSEPEMCGNGIRCLAKFIAELEGKTGTAIAYKINTAAGVICPQLLTDGQVKVDM 130

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF---VVSMGNPHAIFFVEDDLYH 177
           G P L    IP   S      +   +  V       P+    VSMGNPH I FV DD+  
Sbjct: 131 GLPRLLAAEIPTTLS-----ENSLKVIDVPLQVAGQPWSVTCVSMGNPHCITFV-DDVAS 184

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G L   HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA  
Sbjct: 185 VPLTEIGPLFEHHPAFPERTNTEFIEVVRPDYVKMRVWERGAGITLACGTGACASVVAGV 244

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
              + +R V+V++ GG L IEW   +  ++MTG A++ ++G+L
Sbjct: 245 LTQRCDRQVTVELPGGCLQIEWSATDQRLYMTGPAQRVFQGQL 287


>gi|15615974|ref|NP_244279.1| diaminopimelate epimerase [Bacillus halodurans C-125]
 gi|20137993|sp|Q9K7F0|DAPF_BACHD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|10176035|dbj|BAB07131.1| diaminopimelate epimerase [Bacillus halodurans C-125]
          Length = 286

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 148/286 (51%), Gaps = 26/286 (9%)

Query: 8   FAKMEGIGNKILVIDMRGC------HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           F KM G+GN  + +D   C       + + + A+     +     D ++LI     A V 
Sbjct: 3   FTKMHGLGNSYIYVD---CFKELLKEEELPALAVAVADKNKGIGSDGMILICPSDRAPVK 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK--ENRDG--- 114
             +R+ N DGSE ++CGNG+RCV +F      +K  SF  ET+ G++ A    N +G   
Sbjct: 60  --MRVFNNDGSEAKNCGNGLRCVAKFAFEHGYVKETSFDVETLGGLVKATVHPNDNGLVD 117

Query: 115 SISVDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           +++V+MGEP L    IP L     ++  + F IG   +        VSMGNPHAI F+ D
Sbjct: 118 TVTVNMGEPRLGRAQIPMLGEEAAEVVAEPFTIGEKEYRLT----AVSMGNPHAIMFI-D 172

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    +   G LL KH  F + VN+   +V S   +  R WERG G+T ACG+ ACA+V
Sbjct: 173 TIEDAPVEQVGPLLEKHEAFPDWVNVEFVQVVSPTEIHFRVWERGSGITQACGTGACAAV 232

Query: 234 VAS--GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           VAS      +  + V+V +LGG L I W +N  V MTG A+   EG
Sbjct: 233 VASVLNGFTQKGQEVTVHLLGGDLTISWLENGDVLMTGAAETICEG 278


>gi|146279011|ref|YP_001169170.1| diaminopimelate epimerase [Rhodobacter sphaeroides ATCC 17025]
 gi|145557252|gb|ABP71865.1| diaminopimelate epimerase [Rhodobacter sphaeroides ATCC 17025]
          Length = 278

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/278 (37%), Positives = 143/278 (51%), Gaps = 15/278 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
           +S + F KM G GN  +VID RG    +++    AL        FDQ+  I D + A  D
Sbjct: 7   TSGLGFMKMHGAGNDFVVIDSRGRGAVMSAGLARALGDRHRGVGFDQLAEIRDHEGA--D 64

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
             +   N DGS   +CGN  RCV  ++   + R +    T RG L A    DG +SV+MG
Sbjct: 65  FALDFWNSDGSRAGACGNATRCVCDYIMRDLGRDAVALVTARGRLHAVRRTDGLVSVNMG 124

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L W  IPLAR           + P +      P  V MGNPH IFFVED     DLA
Sbjct: 125 APQLLWSEIPLARD----------VVPDSLPLAGAPAAVGMGNPHCIFFVED-AEAVDLA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +   P+F E  N+  A + + + L LR WERG G+T ACGS ACA+ VA+     
Sbjct: 174 GQGAAVETDPLFPERTNVEFASLIAPDRLRLRVWERGAGITLACGSGACATAVAAARRGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           T R V ++M GG L ++W ++  V+++G     +EG+L
Sbjct: 234 TGRQVVLEMDGGTLEVDWREDG-VWLSGPVAHVFEGRL 270


>gi|325140085|gb|EGC62614.1| diaminopimelate epimerase [Neisseria meningitidis CU385]
          Length = 301

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 143/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 24  FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDFRYR 82

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 83  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 142

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 143 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 200

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 201 GSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 260

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 261 E-GKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGEL 298


>gi|302389582|ref|YP_003825403.1| diaminopimelate epimerase [Thermosediminibacter oceani DSM 16646]
 gi|302200210|gb|ADL07780.1| diaminopimelate epimerase [Thermosediminibacter oceani DSM 16646]
          Length = 283

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 149/283 (52%), Gaps = 17/283 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASVDAFI 64
           F KM G+GN  +V++  G  +++      A    D       D I+L+        D  +
Sbjct: 6   FTKMHGLGNDFIVVN--GFKEDVRIIFKKAEKICDRHVGIGADGILLV--LPSDKCDLKM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL----VAKENRDGSISV 118
           RIIN DGSE   CGNG+RC  R+  SR  + + S T ET+ G++    + K++R  S+ V
Sbjct: 62  RIINSDGSEADMCGNGIRCFARYAFSRGLVNKTSITVETLAGVIKPEIIIKDDRIESVRV 121

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG   L  K IP+A + ++   D   I   + +F      VSMGNPH + FV DD+  +
Sbjct: 122 DMGCYSLQKKDIPVAGNPNEEAVD-LEISVDDRVFKFTG--VSMGNPHCVIFV-DDVESF 177

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +  FG ++ +HP+F +  N+        + L +R WERG GLT ACG+ ACAS VA+  
Sbjct: 178 PVERFGPVIERHPLFPKKTNVEFVEFKGQDRLKMRVWERGAGLTMACGTGACASAVAAYK 237

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
                  V+V + GG L IE   N  V+MTG A + + G +D+
Sbjct: 238 KGIVGPKVTVSLPGGDLFIEIEKNGRVYMTGPAVEVFSGYIDL 280


>gi|15676658|ref|NP_273802.1| diaminopimelate epimerase [Neisseria meningitidis MC58]
 gi|21362493|sp|Q9K060|DAPF_NEIMB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|7225990|gb|AAF41173.1| diaminopimelate epimerase [Neisseria meningitidis MC58]
          Length = 283

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 143/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|138896544|ref|YP_001126997.1| diaminopimelate epimerase [Geobacillus thermodenitrificans NG80-2]
 gi|196250903|ref|ZP_03149588.1| Diaminopimelate epimerase [Geobacillus sp. G11MC16]
 gi|166224258|sp|A4ISE8|DAPF_GEOTN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|134268057|gb|ABO68252.1| Diaminopimelate epimerase [Geobacillus thermodenitrificans NG80-2]
 gi|196209632|gb|EDY04406.1| Diaminopimelate epimerase [Geobacillus sp. G11MC16]
          Length = 290

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 156/292 (53%), Gaps = 23/292 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS---TDDNTHF--DQIMLIHDFQDASVDA 62
           F KM G+GN  + +D+    + +  + + A++    D +T    D ++LI   + A V  
Sbjct: 6   FTKMHGLGNSYIYVDL--FRETLPEEDLPAIARSVADVHTGIGSDGLILICPSEQAPVK- 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK---ENRD-GSI 116
            +RI N DGSE ++CGNG+RCV ++      ++ +SF  ET+ G++ A+   EN +  S+
Sbjct: 63  -MRIFNSDGSEGKNCGNGLRCVAKYAYEHGIVRDRSFLIETLSGLVEAEVTVENGEVTSV 121

Query: 117 SVDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           ++DMGEP L    IP+     +++  + F I    +        VSMGNPH IF+V DD+
Sbjct: 122 TIDMGEPRLRRSAIPMTGPEAEQVVAESFAIDGREYEIT----AVSMGNPHVIFYV-DDI 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G ++ K   F EGVN+    V S   L  R WERG G+T ACG+ ACA+VVA
Sbjct: 177 EKAPVTTLGPVVEKDARFPEGVNVEFVEVVSERELHFRVWERGSGVTQACGTGACAAVVA 236

Query: 236 SGCLHKTNRAVS--VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGK 285
           S    KT R V   V + GG L I W  +  V MTG A+    G    + G+
Sbjct: 237 SVLNGKTARGVETVVHLAGGDLTITWGHDGKVRMTGPAETVCTGVYYYRGGQ 288


>gi|78484750|ref|YP_390675.1| diaminopimelate epimerase [Thiomicrospira crunogena XCL-2]
 gi|78363036|gb|ABB41001.1| diaminopimelate epimerase [Thiomicrospira crunogena XCL-2]
          Length = 283

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 151/300 (50%), Gaps = 47/300 (15%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---------NTHFDQIMLIH 53
           ++++ F+KM+G+GN  +VID  G  + IT      LST++            FDQ++++ 
Sbjct: 2   TNLLKFSKMQGLGNDFMVID--GTQETIT------LSTEEIRFWANRYFGVGFDQLLMVE 53

Query: 54  DFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN 111
           +     VD   RI N DGSEVQ CGNG RC  +F+  +    +     ET  G++V    
Sbjct: 54  NSAQGDVDFRYRIFNADGSEVQQCGNGARCFAKFVYDKGLTDKTEIRVETASGMIVLYIT 113

Query: 112 RDGSISVDMGEPILDWKLIPLARSFD----------KMDRDRFHIGPVNHLFLRNPFVVS 161
             G + V+MG P      +P A  FD           +D +RF IG            VS
Sbjct: 114 DQGWVRVNMGAP----NFLPEALPFDMPLESEQYELDVDGERFEIG-----------AVS 158

Query: 162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGL 221
           MGNPHA+  V D L    +A  G  +  H +F E VN+  A     + + LR +ERG   
Sbjct: 159 MGNPHAVLRVAD-LGAAPVAEVGEKIESHRLFPERVNVGFAETLDRQHIKLRVYERGAAE 217

Query: 222 TAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWH--DNNHVFMTGEAKKEWEGKL 279
           T ACG+ ACA++V    L + +  V+V + GG L IEW+   ++ V+MTG A   +EG++
Sbjct: 218 TLACGTGACAAMVVLRNLGEVDDVVTVSLPGGDLEIEWNGDKSSPVWMTGPAVHVFEGEI 277


>gi|294788152|ref|ZP_06753395.1| diaminopimelate epimerase [Simonsiella muelleri ATCC 29453]
 gi|294483583|gb|EFG31267.1| diaminopimelate epimerase [Simonsiella muelleri ATCC 29453]
          Length = 282

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 146/282 (51%), Gaps = 17/282 (6%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +VID  R   D   +             FDQ++++   Q   VD   RI
Sbjct: 6   FSKMHGLGNDFMVIDATRQTFDTANAPIREWADRHTGVGFDQLLIVESSQTEGVDFGYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSEV+ CGNG RC V+F+T +    ++    +T +GI+  + N DG ++V+MG+P 
Sbjct: 66  FNADGSEVEQCGNGARCFVKFVTEQGLTDKQEIVVQTAKGIIKPRLNDDGLVTVNMGQPR 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRN-----PFVVSMGNPHAIFFVEDDLYHYD 179
              + +P         R    +G V+++ +++       +V+MGNPHA+ +V  ++    
Sbjct: 126 FAPEDVPFVL------RSGEQVGAVSYIVVKDLDSAEMSLVNMGNPHAVMWV-GNVDDAP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + S+G  L  H  F + VN+   +V     + LR +ERG G T ACG+ ACA+VVA   L
Sbjct: 179 VESWGAALQNHQRFPQKVNVGFMQVVDKNHIKLRVYERGAGETQACGTGACAAVVAGVRL 238

Query: 240 H--KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
               +   V V + GG L I W + + V M G A   + G+L
Sbjct: 239 GAVASGEWVRVVLPGGELQISWEEGSDVMMMGPAVTVFSGEL 280


>gi|83944909|ref|ZP_00957275.1| diaminopimelate epimerase [Oceanicaulis alexandrii HTCC2633]
 gi|83851691|gb|EAP89546.1| diaminopimelate epimerase [Oceanicaulis alexandrii HTCC2633]
          Length = 268

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 139/275 (50%), Gaps = 12/275 (4%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G GN  +V+D R              +  D   FDQ++++    DA  DA +R+ N D
Sbjct: 1   MNGAGNAFIVLDRRDASGPAAYGESGIAALLDVHPFDQLIVLDPSSDA--DADLRVWNRD 58

Query: 71  GSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLI 130
           G EV +CGNG R     L     +   +F +  G + A+   DG+  VD+G   LDW+ I
Sbjct: 59  GGEVGACGNGTRAAAWLLFEDGAKPQLSFTSSGGPMRAQRLSDGAAEVDLGPARLDWRDI 118

Query: 131 PLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKH 190
           PL+   D M  D F +   +   L  P  VSMGNPH +F V DD+    LA  G  +   
Sbjct: 119 PLSLPMDTMRLD-FGVNLPDGGRLEGPGAVSMGNPHVVFAV-DDVLALPLAEIGPCIEHD 176

Query: 191 PMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK---TNRAVS 247
           P+F + VN   A+V   + + L+ +ERG GLT ACG+ ACA++VA   LH+    NR   
Sbjct: 177 PLFPDRVNAGFAQVRDRDDIRLKVFERGAGLTLACGTGACAALVA---LHRQGLVNREAV 233

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           ++  GG L + W    HV ++G    E E  LD++
Sbjct: 234 IEADGGKLPVRWDTEGHVHLSGPVVLERE--LDLR 266


>gi|262273211|ref|ZP_06051027.1| diaminopimelate epimerase [Grimontia hollisae CIP 101886]
 gi|262222789|gb|EEY74098.1| diaminopimelate epimerase [Grimontia hollisae CIP 101886]
          Length = 276

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 146/285 (51%), Gaps = 20/285 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + D I  L+ D NT   FDQ++++    D   D  
Sbjct: 3   IQFSKMHGLGNDFMVVDCVTQNAYFSPDMIRRLA-DRNTGVGFDQLLVVEPPYDPESDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N D SEV  CGNG RC  RF+  RMK    +      T  G +V K + D  ++V+
Sbjct: 62  YRIFNADSSEVAQCGNGARCFARFV--RMKGLTNKNQIQVSTKSGKMVLKMDGDDQVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLYH 177
           MGEPI     IP    F     ++ +I  V    L   FV  VSMGNPH +  V D++  
Sbjct: 120 MGEPIWAPAKIP----FRANAEEKTYILRVEDTTL---FVGAVSMGNPHCVTVV-DNVDT 171

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           +D+   G L+  H  F E VN    ++ S   + LR +ERG G T ACGS ACA+V    
Sbjct: 172 FDVEGLGPLVESHERFPERVNAGFMQIVSRNEIRLRVYERGAGETQACGSGACAAVAVGI 231

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                + +V+V + GG L I W    H ++MTG A   ++G++ +
Sbjct: 232 QQGLLDESVTVHLKGGDLKIRWRGAGHPLYMTGPASHVYDGQITV 276


>gi|119483380|ref|ZP_01618794.1| diaminopimelate epimerase [Lyngbya sp. PCC 8106]
 gi|119458147|gb|EAW39269.1| diaminopimelate epimerase [Lyngbya sp. PCC 8106]
          Length = 284

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 139/284 (48%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-VDAFI 64
           ++F K +G+GN  ++ID R   + + +        D N       +I      S  D  +
Sbjct: 3   IEFTKYQGLGNDFILIDNRHQSEPLITPEQAMQMCDRNFGIGADGVIFALPGTSNTDYTM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRK----------SFTFETIRGILVAKENRDG 114
           RI N D SE Q CGNG+RC+ +F+     R           S+  +T+ G++  +   DG
Sbjct: 63  RIFNSDSSEPQMCGNGIRCLAKFIADLEHRDGKINQIPSSVSYKIDTLAGVITPEILADG 122

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            + VDMG+P L    IP   +  K D    ++             VSMGNPH I FVED 
Sbjct: 123 QVKVDMGQPRLLAVEIP--TTLTKADEKVVNVPLSVAEQSWKVTCVSMGNPHCITFVED- 179

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    LA  G     HP F E  N    +V   + L +R WERG G T ACG+ ACA VV
Sbjct: 180 VAAIPLAEIGPQFEHHPAFPERTNTEFIQVIKPDYLKMRVWERGAGATLACGTGACAVVV 239

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           A       +R+V+V++ GG L+IEW  +  ++M+G A++ + G+
Sbjct: 240 AGVLTGNCDRSVTVELPGGNLMIEWSASERLYMSGPAERVFTGQ 283


>gi|284050332|ref|ZP_06380542.1| diaminopimelate epimerase [Arthrospira platensis str. Paraca]
          Length = 286

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 139/283 (49%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQ-DASVDAFI 64
           ++F K  G+GN  ++ID R   + I +        D +       +I     D + D  +
Sbjct: 3   IEFTKYHGLGNDFILIDNRHQSEPICTQKQAVQMCDRHFGIGADGVIFALPGDGASDYTM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRK----SFTFETIRGILVAKENRDGSISVDM 120
           RI N DGSE + CGNG+RC+ +F+     +     ++   T  G++  +   DG + VDM
Sbjct: 63  RIFNSDGSEPEMCGNGIRCLAKFIAELEGKTGTAIAYKINTAAGVICPQLLTDGQVKVDM 122

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF---VVSMGNPHAIFFVEDDLYH 177
           G P L    IP       +  +   +  V       P+    VSMGNPH I FV DD+  
Sbjct: 123 GLPRLLAAEIP-----TTLSENSLKVIDVPLQVAGQPWSVTCVSMGNPHCITFV-DDVAS 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G L   HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA  
Sbjct: 177 VPLTEIGPLFEHHPAFPERTNTEFIEVVRPDYVKMRVWERGAGITLACGTGACASVVAGV 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
              + +R V+V++ GG L IEW   +  ++MTG A+  ++G+L
Sbjct: 237 LTQRCDRQVTVELPGGCLQIEWSATDQRLYMTGPAQAVFQGQL 279


>gi|261400446|ref|ZP_05986571.1| diaminopimelate epimerase [Neisseria lactamica ATCC 23970]
 gi|269209897|gb|EEZ76352.1| diaminopimelate epimerase [Neisseria lactamica ATCC 23970]
          Length = 283

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 142/279 (50%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAV-SQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+T +    +K    ET +G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVEQCGNGARCFARFVTDKGLTDKKEICVETAKGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G L+  H  F E VN+   +V     + LR +ERGVG T ACG+ ACA+V A    G L 
Sbjct: 183 GPLIEAHRQFPERVNVGFMQVVGRTEIRLRVFERGVGETQACGTGACAAVAAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + +   + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTIEAVLPGGTLYIEWVRGGDVMMTGPAETVFEGEL 280


>gi|159795186|pdb|2Q9J|A Chain A, Crystal Structure Of The C217s Mutant Of Diaminopimelate
           Epimerase
          Length = 274

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 144/282 (51%), Gaps = 22/282 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTH----FDQIMLIHDFQDAS 59
           + F+KM G+GN  +V+D  G   N+  T + I  L+   N H    FDQ++++    D  
Sbjct: 1   MQFSKMHGLGNDFVVVD--GVTQNVFFTPETIRRLA---NRHCGIGFDQLLIVEAPYDPE 55

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV   GNG RC  RF+T +    +K  +  T +G +V     D  I 
Sbjct: 56  LDFHYRIFNADGSEVSQXGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIR 115

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+ 
Sbjct: 116 VNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLC------GAVSMGNPHCVVQV-DDIQ 168

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    ++ + E + LR +ERG G T A GS ACA+V   
Sbjct: 169 TANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQASGSGACAAVAVG 228

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                 N  V V + GG L+IEW+   H ++MTGEA   ++G
Sbjct: 229 IMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 270


>gi|331083711|ref|ZP_08332822.1| diaminopimelate epimerase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330403922|gb|EGG83474.1| diaminopimelate epimerase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 277

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 151/285 (52%), Gaps = 21/285 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+GIGN  + ++    H    S+    +S   + HF    D ++LI   + A  D  
Sbjct: 3   FTKMQGIGNDYVYVNCFQEHIENPSEVSRRIS---DRHFGIGSDGLILIKSSEKA--DFE 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF-----LTSRMKRKSFTFETIRGILVAKENRD-GSIS 117
           + + N DGS+   CGNGMRCV ++     LT + +    T   I+ + +  EN+    + 
Sbjct: 58  MEMYNADGSQGAMCGNGMRCVGKYVYDYGLTDKTRISVDTKSGIKYLDLTVENKKVKQVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MGEP+L+ K IP+    +K+    F++G   +        VSMGNPHA+ +V D++ +
Sbjct: 118 VNMGEPVLETKAIPMIYEGEKVISQPFNVGQDIYEIT----AVSMGNPHAVVYV-DNVKN 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G    KH  F E VN    RV    ++++R WERG G T ACG+ ACA  VAS 
Sbjct: 173 LPLEEIGPKFEKHTAFPESVNTEFVRVIDRRTVEMRVWERGSGETLACGTGACAVAVASV 232

Query: 238 CLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
               T   V+V++LGG L I W    N V+MTG A+  +EG+++I
Sbjct: 233 LNGYTEDEVTVRLLGGDLKIFWDRAENFVYMTGPAEVVFEGEIEI 277


>gi|304387930|ref|ZP_07370103.1| diaminopimelate epimerase [Neisseria meningitidis ATCC 13091]
 gi|304338027|gb|EFM04164.1| diaminopimelate epimerase [Neisseria meningitidis ATCC 13091]
          Length = 301

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 143/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 24  FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 82

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 83  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 142

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 143 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 200

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 201 GSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 260

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 261 E-GKTVEVILPGGTLYIEWACGGDVRMTGPAETVFEGEL 298


>gi|212633302|ref|YP_002309827.1| diaminopimelate epimerase [Shewanella piezotolerans WP3]
 gi|212554786|gb|ACJ27240.1| Diaminopimelate epimerase [Shewanella piezotolerans WP3]
          Length = 269

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 147/275 (53%), Gaps = 14/275 (5%)

Query: 11  MEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  +V+D  G   N+  + D I  L+  +    FDQ++L+    D  +D   RI 
Sbjct: 1   MHGLGNDFMVVD--GVTQNVFFSPDQIKRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           N DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDG ++V+MG P+L
Sbjct: 59  NADGSEVEQCGNGARCFARFVRNKGLTQKHKIRVSTSSGKITLRLERDGKVTVNMGVPML 118

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           +   IP   +  K+++    +             VSMGNPH +  V DD+ + D+ + G+
Sbjct: 119 EPSKIPF--NAKKVEKTYLLMASTGTYLCG---AVSMGNPHCVIDV-DDVANTDVDTIGS 172

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            L +H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K  R 
Sbjct: 173 ELTQHERFPKGVNVGFMQVVNPGYIKLRVYERGAAETLACGTGACAAVVVGILQGKLERN 232

Query: 246 VSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           V V + GG L+I W  +   ++MTG A+  ++G++
Sbjct: 233 VRVDLPGGTLMINWDGEGKPLWMTGPAEHVYDGQI 267


>gi|167465423|ref|ZP_02330512.1| Diaminopimelate epimerase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 249

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 134/239 (56%), Gaps = 15/239 (6%)

Query: 51  LIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETI---- 102
           L++       D  +RIIN DGSE + CGN +RCV +++        +    T +TI    
Sbjct: 15  LVYILPSKESDFMMRIINSDGSEAEQCGNAIRCVAKYVVDHGLVEHQNDEITIQTIGAGI 74

Query: 103 -RGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVS 161
            R  +  K+ +  ++ VDMGEPIL+   IP   + + + +    +      F      VS
Sbjct: 75  QRVFVHKKDGKVDTVRVDMGEPILNGLDIPTTVNANPVVKYPVEVNGRRFQFT----AVS 130

Query: 162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGL 221
           MGNPH + +V DD    +L  +G LL  HP+F + +N+  A V S + + +R WERG G 
Sbjct: 131 MGNPHCVIYV-DDAVTMNLHEWGPLLEVHPLFPKKINVEFATVQSRDRVIMRVWERGAGP 189

Query: 222 TAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           T ACG+ ACA++VAS   + T+R  ++ + GG L IEW++ +NHV+MTG A + ++G+L
Sbjct: 190 TLACGTGACATLVASVLNNLTDRRATISLKGGDLFIEWNEADNHVYMTGPAAEVFQGRL 248


>gi|238760179|ref|ZP_04621326.1| Diaminopimelate epimerase [Yersinia aldovae ATCC 35236]
 gi|238701615|gb|EEP94185.1| Diaminopimelate epimerase [Yersinia aldovae ATCC 35236]
          Length = 274

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 142/278 (51%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D  +D  
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLA-DRHTGVGFDQMLVVEPPYDPELDFH 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MG
Sbjct: 60  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDELVCVNMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EP  D + +P    F  +  +R +I     H  L    VVSMGNPH +  V DD+   ++
Sbjct: 120 EPNFDPQTVP----FKAIKAERTYIFRAAEHTVLCG--VVSMGNPHCVMQV-DDVSVANV 172

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V       
Sbjct: 173 ALLGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQE 232

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
             +  V V++ GG L I W    H ++MTG A   ++G
Sbjct: 233 LLSEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 270


>gi|150402091|ref|YP_001329385.1| diaminopimelate epimerase [Methanococcus maripaludis C7]
 gi|254767113|sp|A6VFK8|DAPF_METM7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|150033121|gb|ABR65234.1| Diaminopimelate epimerase [Methanococcus maripaludis C7]
          Length = 277

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 153/286 (53%), Gaps = 23/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  + +D          + I+   +D   HF    D ++LI   + A  D  
Sbjct: 3   FTKMHGLGNDYIYVDATSQKIE-NPNEISRFVSD--RHFGIGSDGLVLILPSEIA--DFK 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +R+ N DGSE + CGN +RCV +F+  +    + + T ET+ GI    +  + ++   + 
Sbjct: 58  MRMFNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTVENDKVVLVK 117

Query: 118 VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           VDMGEPIL  + IP L+     +D +   I   ++ +  N   VSMGNPHAI ++E+ + 
Sbjct: 118 VDMGEPILKAETIPVLSEKHPVIDEE---ITAKDYCY--NFTCVSMGNPHAITYIEN-VS 171

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + L   G L   H  F    N+    +    ++ +R WERG G T ACG+ ACA +VAS
Sbjct: 172 EFPLEKIGPLFEFHEKFPRKTNVEFVELIDDSTIKMRVWERGAGETLACGTGACAVLVAS 231

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                  R  +VK+LGG L IEW++ +NH++MTG A   +EG++DI
Sbjct: 232 VLKGYVGRKATVKLLGGDLTIEWNESDNHIYMTGPATTVFEGEIDI 277


>gi|240115186|ref|ZP_04729248.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID18]
 gi|260440996|ref|ZP_05794812.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI2]
 gi|268600866|ref|ZP_06135033.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID18]
 gi|291044324|ref|ZP_06570033.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI2]
 gi|268584997|gb|EEZ49673.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID18]
 gi|291011218|gb|EFE03214.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI2]
          Length = 283

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 142/279 (50%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    D   A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDVPIAAWADRFRGVGFDQLLVVGCSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET +GI+  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVYLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+ +  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|224824101|ref|ZP_03697209.1| Diaminopimelate epimerase [Lutiella nitroferrum 2002]
 gi|224603520|gb|EEG09695.1| Diaminopimelate epimerase [Lutiella nitroferrum 2002]
          Length = 276

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    H ++T + I  L        FDQ++L+     +  D   
Sbjct: 3   LKFSKMHGLGNDFMVIDGVRQHVDLTPEKIKELGHRQFGIGFDQLLLVEPSGSSENDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +    + +   ET +G++V +   DG+++VDMG 
Sbjct: 63  RIFNSDGSEVEQCGNGARCFARFVAEQGLSAKVAIRVETAKGVIVPQLLADGTVTVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP   + + +       G    +      VVSMGNPHA+  V D +  + +A 
Sbjct: 123 PRFKPVEIPFVAAEEALTYPLDAAGRQCDIS-----VVSMGNPHAVQVVAD-VDTFPVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F E VN    ++ S E + LR +ERG G T ACG+ ACA+VVA       
Sbjct: 177 LGPAIELHPRFPERVNAGFMQIVSREEIRLRVYERGAGETLACGTGACAAVVAGIRRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V   GG L I W      V MTG A   + G++ +
Sbjct: 237 DHTVKVHTRGGDLSIRWDGVGLPVLMTGPAVTVFTGEISL 276


>gi|77359069|ref|YP_338644.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis TAC125]
 gi|123587542|sp|Q3IEW3|DAPF_PSEHT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|76873980|emb|CAI85201.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis TAC125]
          Length = 276

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 145/283 (51%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIIKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N DG+EV+ CGNG RC  RF+  RMK    +   T  T  G L     +DG ++V+
Sbjct: 62  YRIFNADGTEVEQCGNGARCFARFV--RMKGLTNKHKITVSTKSGNLTLYIEKDGQVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P  +   IPL  +  ++    + I    H        VSMGNPH +  V DD+    
Sbjct: 120 MGHPNFEPSKIPLKATKRELT---YIIRTEEHTVFSG--AVSMGNPHCVLEV-DDITTAQ 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     
Sbjct: 174 VDILGPLLENHERFPQRANIGFMQVISKEHIKLRVWERGVNETLACGTGACAAMVIGFIQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +K    V V + GG L I W+   H V MTG A+  ++G++ +
Sbjct: 234 NKLISTVQVDLPGGSLQIRWNGEGHPVRMTGPAEHVFDGQVAL 276


>gi|224139194|ref|XP_002323003.1| predicted protein [Populus trichocarpa]
 gi|222867633|gb|EEF04764.1| predicted protein [Populus trichocarpa]
          Length = 281

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 140/283 (49%), Gaps = 13/283 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-VDAFIRI 66
           F K  G+GN  +++D R   +   +    A   D N       +I      +  D  +RI
Sbjct: 3   FVKYHGLGNDFILVDNRDSSEPKITPEQAAKLCDRNFGIGADGVIFALPGINGTDYTMRI 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            N DGSE + CGNG+RC  RF+        K+ SF+  T  G++V +   DG + VDMGE
Sbjct: 63  FNSDGSEPEMCGNGVRCFARFIAEIENLHGKKLSFSVHTGAGLIVPEIQEDGKVKVDMGE 122

Query: 123 PILDWKLIPLARSFDKMD---RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           P+L    +P   + +K D   +    +  V      N   VSMGNPH + F +  +   +
Sbjct: 123 PVLKAADVPTKLAANKNDAVVKSELVVDGVTW----NVTCVSMGNPHCVTFGDLQVDSLN 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           LA  G     H +F    N    +V S   L +R WERG G T ACG+ ACA+VVA+   
Sbjct: 179 LAQIGPKFEHHEVFPARTNTEFVQVCSPSHLKMRVWERGAGATLACGTGACATVVAAVLE 238

Query: 240 HKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
               R  +V + GG L IEW  ++NHV+MTG A+  ++G + +
Sbjct: 239 GNAGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 281


>gi|322834931|ref|YP_004214958.1| diaminopimelate epimerase [Rahnella sp. Y9602]
 gi|321170132|gb|ADW75831.1| diaminopimelate epimerase [Rahnella sp. Y9602]
          Length = 274

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 139/278 (50%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHRGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNKRDIRVSTQTGRMVLTVTEDEEVQVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF--VVSMGNPHAIFFVEDDLYHYDL 180
           P+ + + +P    F     ++ +I        R  F  VVSMGNPH +  V DD+   ++
Sbjct: 121 PVFEPQQVP----FRAAKPEKTYILRAEE---RTVFCGVVSMGNPHCVLQV-DDVLTAEV 172

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G +L  H  F E VN+   ++ S ES+ LR +ERG G T ACGS ACA+V       
Sbjct: 173 EVLGPMLESHDRFPERVNVGFMQILSPESVKLRVYERGAGETQACGSGACAAVAVGIQQG 232

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                V V++ GG L I W    H ++MTG A   ++G
Sbjct: 233 LLAEEVQVELPGGSLDIRWKGPGHPLYMTGPATHVYDG 270


>gi|118594102|ref|ZP_01551449.1| diaminopimelate epimerase [Methylophilales bacterium HTCC2181]
 gi|118439880|gb|EAV46507.1| diaminopimelate epimerase [Methylophilales bacterium HTCC2181]
          Length = 286

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 142/285 (49%), Gaps = 24/285 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G GN  +VI+    +  +TS  I  L+  +    FDQ+++I     A  +   
Sbjct: 7   IPFSKMHGSGNDFVVINQIDNNYRLTSSQIKKLADRNFGIGFDQLLIIEKPTQAPAEFKY 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS----FTFETIRGILVAKENRDGSISVDM 120
           RI N DGSEV  CGNG RC   +L  RMK+ S     T ET  G++V    +DG ISVDM
Sbjct: 67  RIFNADGSEVSQCGNGARCFFHYL--RMKKLSSSNEITVETQSGMIVLSYKKDGLISVDM 124

Query: 121 GEPILDWKLIPLARSFDKM-----DRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           G P+ D+K IP   +   +     D   +   P+           SMGNPHA+  +   L
Sbjct: 125 GVPVYDYKQIPFISTNTTLPTVTVDDKSYEFYPI-----------SMGNPHAVIKLAS-L 172

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              DL   G +L K   F + VN+   +V    +L L+ +ERG G+T ACGS ACA+ V 
Sbjct: 173 QGVDLVKIGKVLQKSAAFPDSVNVGFVQVIDKHTLSLKVYERGSGMTLACGSGACAAGVV 232

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           +         VSV + GG L I       V + G A+  ++G+L+
Sbjct: 233 AIQKRWAQNPVSVLVDGGVLTINLTPQGSVELLGPAEWIFDGELN 277


>gi|300113123|ref|YP_003759698.1| diaminopimelate epimerase [Nitrosococcus watsonii C-113]
 gi|299539060|gb|ADJ27377.1| diaminopimelate epimerase [Nitrosococcus watsonii C-113]
          Length = 276

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 22/286 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +VID       +T+  +  ++        DQ++L+      ++D   
Sbjct: 3   IAFTKMQGLGNDFVVIDAFSQPLFLTASQVRWIANRRLGIGCDQVLLVTPASSPAIDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  R    + +   +T  GI+  +   DG I+VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFARFVRERKLTDKNTLRVQTAGGIIQLQLEPDGQITVDMGV 122

Query: 123 PILDWKLIPLARSFD------KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P    + IP     +      ++D  +  IG           VVS+GNPH +  V   + 
Sbjct: 123 PRFAPQQIPFKVDHEADYYSLELDGQQLEIG-----------VVSLGNPHCVLRVPA-VD 170

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A +G LL  HP F + VN+  A++ S   L LR +ERG G T ACG+ ACA+VV  
Sbjct: 171 AAPVAHWGPLLENHPCFPQRVNVGFAQIVSPSHLRLRVYERGAGETPACGTGACAAVVIG 230

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V V + GG L I W  D   V+M+G A+  +EG  D+
Sbjct: 231 KRRGWLSGQVKVDLPGGRLGIRWEGDGQSVWMSGPAETVFEGSFDL 276


>gi|269468224|gb|EEZ79914.1| diaminopimelate epimerase [uncultured SUP05 cluster bacterium]
          Length = 270

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 147/282 (52%), Gaps = 17/282 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +V+D    + + +++ I AL+       FDQ+++I       VD  
Sbjct: 1   MINFTKMHGLGNDFMVVDNSAGNISFSAEQIRALAQRHFGIGFDQLLMIESTNTKDVDFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
             I N DGSEV+ CGNG RC  RF+  +    +   + ET  G++    N D S+ VDMG
Sbjct: 61  YVIYNSDGSEVEQCGNGARCFARFVREKGLSDKNPISVETKSGLISLFINDDHSVRVDMG 120

Query: 122 EPILDWKLIPLARSFDKM--DRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           EP+ +   +PL    + +    + + +G           V S GNPH +  V DD+   D
Sbjct: 121 EPVFNPSDVPLIAPEESLYYSIEGYEVG-----------VFSTGNPHCVMIV-DDVEGVD 168

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + +    + +  +     N+   ++ S   ++LR +ERG G T ACGS ACA+V+    +
Sbjct: 169 VETIALRIQQSNLLPNQANIGFMQIISRNEINLRVYERGSGETLACGSGACAAVIHGVRI 228

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            + +  V+  + GG  LIE++   HVF++G A+  +EG +D+
Sbjct: 229 GQLDHKVTAHLRGGDALIEYNKGEHVFLSGPAQFVFEGWVDV 270


>gi|260587431|ref|ZP_05853344.1| diaminopimelate epimerase [Blautia hansenii DSM 20583]
 gi|260542298|gb|EEX22867.1| diaminopimelate epimerase [Blautia hansenii DSM 20583]
          Length = 277

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 150/285 (52%), Gaps = 21/285 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+GIGN  + ++    H    S+    +S   + HF    D ++LI   + A  D  
Sbjct: 3   FTKMQGIGNDYVYVNCFQEHIENPSEVSRRIS---DRHFGIGSDGLILIKSSEKA--DFE 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF-----LTSRMKRKSFTFETIRGILVAKENRD-GSIS 117
           + + N DGS+   CGNGMRCV ++     LT + +    T   I+ + +  EN+    + 
Sbjct: 58  MEMYNADGSQGAMCGNGMRCVGKYVYDYGLTDKTRISVDTKSGIKYLDLTVENKKVKQVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MGEP+L+ K IP+    +K+    F++G   +        VSMGNPHA+ +V D++  
Sbjct: 118 VNMGEPVLETKAIPMIYDGEKVISQPFNVGQDIYEIT----AVSMGNPHAVVYV-DNVKS 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G    KH  F E VN    RV    ++++R WERG G T ACG+ ACA  VAS 
Sbjct: 173 LPLEEIGPKFEKHTAFPESVNTEFVRVIDRRTVEMRVWERGSGETLACGTGACAVAVASV 232

Query: 238 CLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
               T   V+V++LGG L I W    N V+MTG A+  +EG+++I
Sbjct: 233 LNGYTEDEVTVRLLGGDLKIFWDRAENFVYMTGPAEVVFEGEIEI 277


>gi|154483606|ref|ZP_02026054.1| hypothetical protein EUBVEN_01310 [Eubacterium ventriosum ATCC
           27560]
 gi|149735516|gb|EDM51402.1| hypothetical protein EUBVEN_01310 [Eubacterium ventriosum ATCC
           27560]
          Length = 277

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 152/284 (53%), Gaps = 21/284 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KMEG GN  + ++     D    D         N HF    D +++I+    A  D  
Sbjct: 3   FTKMEGCGNDYVYVN---GFDTKIEDPNKLSEIVSNRHFGIGSDGLIVINPSDVA--DFK 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT-SRMKRKS-FTFETIRGI----LVAKENRDGSIS 117
           + + N DGSE + CGNG+RCV +++  ++M  K+  T ET+ GI    L  ++++  ++ 
Sbjct: 58  MSMYNADGSEGKMCGNGIRCVAKYVYDNKMTDKTTITVETLSGIKTLVLNVEDDKVKTVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG PIL+   +P+    DK+  +   +    +        VSMGNPHAI FV DD+  
Sbjct: 118 VNMGSPILESAKVPVVSEKDKVIDEPVMVNNKEYRIT----CVSMGNPHAITFV-DDIDS 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+   G +  K  +F E VN    +V S + + +R WERG G T ACG+ ACASVVA  
Sbjct: 173 LDIEHIGPMFEKKEIFPEQVNTEFIQVVSRDVIKMRVWERGSGETLACGTGACASVVACV 232

Query: 238 CLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
               T   V+VK+LGG L IE++ D N V+MTG A+  + G+ +
Sbjct: 233 LNGLTEDKVTVKLLGGDLFIEYNRDENTVYMTGPARITFTGEFN 276


>gi|260912680|ref|ZP_05919166.1| diaminopimelate epimerase [Pasteurella dagmatis ATCC 43325]
 gi|260633058|gb|EEX51223.1| diaminopimelate epimerase [Pasteurella dagmatis ATCC 43325]
          Length = 279

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 140/282 (49%), Gaps = 12/282 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M+   + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  
Sbjct: 1   MKGQEMQFSKMHGLGNDFVVVDAITQNLYFSPETIKRLADRHRGIGFDQMLVVEPPYDPD 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
            D   RI N DGSEV  CGNG RC  RF+T +    +K  T  T  G ++     +  + 
Sbjct: 61  QDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTDKKEITVSTQIGKMILNVLENEKVQ 120

Query: 118 VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MGEPI +   IP +A  F+K    R  I  V         VVSMGNPH +  V DD+ 
Sbjct: 121 VNMGEPIWEPAKIPFVANKFEKNYILRTDIQTVLC------GVVSMGNPHCVVQV-DDIK 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+V   
Sbjct: 174 TANVEQLGPLLESHERFPERVNAGFMQVINRRHIKLRVYERGAGETQACGSGACAAVAVG 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
                 +  V V + GG L IEW      +FMTGEA   ++G
Sbjct: 234 IMQGLLDSKVQVDLPGGSLTIEWEGVGKPLFMTGEATHVYDG 275


>gi|94309098|ref|YP_582308.1| diaminopimelate epimerase [Cupriavidus metallidurans CH34]
 gi|166225747|sp|Q1LS37|DAPF_RALME RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|93352950|gb|ABF07039.1| diaminopimelate epimerase [Cupriavidus metallidurans CH34]
          Length = 288

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 146/292 (50%), Gaps = 23/292 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD--NITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F KM G GN  +V+D  G H   ++T     AL+   N HF    DQI+++       
Sbjct: 3   LQFTKMHGAGNDFIVLD--GIHQKLDLTDAQWRALA---NRHFGIGADQILIVEKSSRDD 57

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI+N DG EV+ CGNG RC VRF+T R    ++S   E + G++  K   DG ++
Sbjct: 58  VDFRYRIVNADGGEVEHCGNGARCFVRFVTDRGMTDKQSVRVEVMNGVITLKLQDDGQVT 117

Query: 118 VDMGEPILDWKLIPL---ARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVE 172
           VDMGEP L    +P            +D  +   VN    R  ++  VSMGNPHA+  V 
Sbjct: 118 VDMGEPELTPARVPFIADGLPTRAEAQDTLYGLEVNG---RTEWISPVSMGNPHAVQIV- 173

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DD+  + +   G ++  H  F   VN    ++    ++ LR +ERG G T ACG+ ACA+
Sbjct: 174 DDVEQFPVLQDGPVIEHHKSFPNRVNAGFMQIVDRNTVRLRVFERGAGETLACGTGACAA 233

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
           VVA       +  V V   GG L I W      V MTG A   +EG +D+ T
Sbjct: 234 VVAGIRRGLLDSPVKVHTHGGDLTIAWQGAGQPVQMTGPATTVFEGTIDLST 285


>gi|121997990|ref|YP_001002777.1| diaminopimelate epimerase [Halorhodospira halophila SL1]
 gi|166224261|sp|A1WWB3|DAPF_HALHL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|121589395|gb|ABM61975.1| diaminopimelate epimerase [Halorhodospira halophila SL1]
          Length = 287

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 140/285 (49%), Gaps = 22/285 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KME +GN  +V+D      ++T + I  L+        DQ+++       + D   RI
Sbjct: 3   FTKMEALGNDFVVLDGIRQRLHLTPETIRTLADRRRGVGCDQLLIAEPPAHIAADVRYRI 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG+EV+ CGNG+RC+ RFL             ET   I  A+   DG +SVDMG P 
Sbjct: 63  FNADGTEVEHCGNGVRCLARFLVDEGLAAPGVLRIETDGRITEAEPRDDGQVSVDMGPPE 122

Query: 125 LDWKLIPLARSFDK------MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           L+   IP      +        R    IG            VSMGNPHA+  V DD+   
Sbjct: 123 LEPARIPFQAPVRQEAYRLATSRGEQTIG-----------AVSMGNPHAVLRV-DDMTGA 170

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +A  G  + +HP F   VN+    V + + + LR +ERGVG T ACG+ ACA+VVA   
Sbjct: 171 PVAELGPEIERHPRFPRRVNVGFMEVCTRDRIRLRVFERGVGETPACGTGACAAVVAGRL 230

Query: 239 LHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
               +  V+V++ GG L+I W      V+MTG A+  + G++++ 
Sbjct: 231 RDWLDAPVTVELTGGVLVIHWLGPGRSVWMTGPARTVFRGEIELP 275


>gi|33151302|ref|NP_872655.1| diaminopimelate epimerase [Haemophilus ducreyi 35000HP]
 gi|71153321|sp|Q7VPN0|DAPF_HAEDU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33147522|gb|AAP95044.1| diaminopimelate epimerase [Haemophilus ducreyi 35000HP]
          Length = 274

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 140/283 (49%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEDMIRKLADRHYGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF++ +  + R      T +G +V     + ++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVSLKGLINRSDMYVSTAKGKMVLTLVDEENVRVNMGE 120

Query: 123 PILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   IP +A  F+K            +  LR         VVSMGNPH +  V DD+
Sbjct: 121 PIWEPAKIPFIANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQV-DDI 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL KH  F E  N+   ++     + LR +ERGVG T ACGS ACA+V  
Sbjct: 168 EQATVHQLGALLEKHHRFPERANVGFMQIIDRHHIKLRVFERGVGETKACGSGACAAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW      ++MTG A   ++G
Sbjct: 228 GIMQGVLDANVQVSLPGGTLQIEWQGKGKPLYMTGTATHIYDG 270


>gi|117620561|ref|YP_855007.1| diaminopimelate epimerase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|166224237|sp|A0KFI1|DAPF_AERHH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|117561968|gb|ABK38916.1| diaminopimelate epimerase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 276

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 144/282 (51%), Gaps = 12/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++DF+KM G+GN  +V+D        +++ I  L+       FDQ++L+    D  +D  
Sbjct: 2   LIDFSKMHGLGNDFMVVDGVTQKVFFSNEVIKKLADRHFGIGFDQLLLVEPPYDPELDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF  L   + R      T RG +V +   +  ++V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTARGRIVLQLEGENQVTVNMG 121

Query: 122 EPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P  +   IP  A+  +K    R       H  +     VSMGNPH +  V   +    +
Sbjct: 122 VPQFEPGKIPFRAQKAEKTYLLRAQ----EHTVMCG--AVSMGNPHCVIEV-PSVADAPV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A+ G ++ +H  F E VN+    + +   + LR +ERGVG T ACG+ ACA+VV      
Sbjct: 175 ATLGPIMERHERFPERVNVGFMEMVNASEIKLRVFERGVGETLACGTGACAAVVVGISQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           K    V+V + GG L I W      V+MTG A+  ++G++++
Sbjct: 235 KLKERVTVTLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL 276


>gi|92115228|ref|YP_575156.1| diaminopimelate epimerase [Chromohalobacter salexigens DSM 3043]
 gi|122419111|sp|Q1QSV1|DAPF_CHRSD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91798318|gb|ABE60457.1| diaminopimelate epimerase [Chromohalobacter salexigens DSM 3043]
          Length = 277

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 142/288 (49%), Gaps = 22/288 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +VID+      + ++ I  L+       FDQ++L+   +D  +D  
Sbjct: 2   LLHFTKMHGLGNDFVVIDLITQRARLDTERIRQLADRHVGIGFDQLLLVEPPRDPEMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV++CGNG RC  RF+       ++    ET  G L  +   D  I VDMG
Sbjct: 62  YRIFNADGNEVENCGNGARCFARFVRDNRLTHKREIRVETQAGPLTLRVEDDERIRVDMG 121

Query: 122 EPILDWKLIPLARSFD------KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
            P    +++P     D      ++D + + IG            VSMGNPHA+  V DD+
Sbjct: 122 VPRFAPEVVPFDAPADAPAHCLEVDGETWDIG-----------AVSMGNPHAVLRV-DDV 169

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +A  G L+ +HP F  GVN+   +V S     LR +ERG G T ACG+ ACA+V  
Sbjct: 170 AQAPVARLGPLIERHPRFPRGVNVGFLQVVSRHEARLRVFERGSGETLACGTGACAAVAH 229

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
                     V V + GG L + W   +  + MTG A   +EG++ + 
Sbjct: 230 GIRRGWLESPVDVHLPGGTLTLAWPAPDASLMMTGPATSVFEGRIALP 277


>gi|255584553|ref|XP_002533003.1| Diaminopimelate epimerase, putative [Ricinus communis]
 gi|223527214|gb|EEF29378.1| Diaminopimelate epimerase, putative [Ricinus communis]
          Length = 369

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 150/294 (51%), Gaps = 19/294 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMR-GCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDAS 59
           +S +  F K +G+GN  +++D R      IT + A+     +     D ++      + +
Sbjct: 81  ESGIHHFVKYQGLGNDFILVDNRDSTEPRITPEQAVRLCDRNFGIGADGVIFAMPGTNGT 140

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF   L +   ++SFT  T  G++V +   DG +
Sbjct: 141 -DYSMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKQSFTIHTGAGLIVPEIQEDGKV 199

Query: 117 SVDMGEPILDWKLIPLARSFDKMD---RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
            VDMGEPIL    +P     +K D   + + +I  V      N   VSMGNPH + F  +
Sbjct: 200 KVDMGEPILKASDVPTRLRENKGDAVVKAKLNIDGVTW----NVTCVSMGNPHCVTFGSN 255

Query: 174 D-----LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
           +     +   +LA  G     H +F    N    +V S   L +R WERG G T ACG+ 
Sbjct: 256 ENQDLQVDKLNLAEIGPKFEHHDVFPARTNTEFVQVHSHSHLKMRVWERGAGATLACGTG 315

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           ACA+VVA+    +  R  +V + GG L IEW  ++NHV+MTG A+  + G + +
Sbjct: 316 ACATVVAAVLEGRAGRNCTVDLPGGPLEIEWKEEDNHVYMTGPAEAVFYGAVAL 369


>gi|114319225|ref|YP_740908.1| diaminopimelate epimerase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312761|sp|Q0ACL9|DAPF_ALHEH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|114225619|gb|ABI55418.1| diaminopimelate epimerase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 279

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 143/282 (50%), Gaps = 12/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F KM+G+GN  +VID        + + I  ++        DQ++L    + +  D   
Sbjct: 3   VRFTKMQGLGNDFVVIDAVRQPVEPSPEQIRHIADRRYGVGCDQVLLATPARRSQADFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR----MKRKSFTFETIRGILVAKENRDGSISVDM 120
            I N DGS+ + CGNG+RC+ RFL  R      R     ETI G+   +   DG ++VDM
Sbjct: 63  LIFNPDGSQAEHCGNGVRCLARFLDDRGLVPAGRHELVIETINGLSRVRLCDDGPVTVDM 122

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P+L+   IP    F    R R +   V    +R    VSMGNPHA+  V DD+    +
Sbjct: 123 GAPVLEPPHIP----FRAPSRAREYELEVEGQVVRL-GAVSMGNPHAVLRV-DDVDSAPV 176

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G  +  H  F   VN+   +V +   + LR +ERG G T ACG+ ACA+VV+     
Sbjct: 177 ETLGPAIESHSRFPRRVNVGFMQVLTPTHIRLRVYERGAGETLACGTGACAAVVSGRLRG 236

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
               AV V + GG L+I W  D  HV+MTG A+  +EG++ +
Sbjct: 237 WLEEAVDVDLPGGRLVIHWAGDGEHVWMTGPAETVFEGEIRL 278


>gi|317486309|ref|ZP_07945141.1| diaminopimelate epimerase [Bilophila wadsworthia 3_1_6]
 gi|316922479|gb|EFV43733.1| diaminopimelate epimerase [Bilophila wadsworthia 3_1_6]
          Length = 280

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 146/292 (50%), Gaps = 27/292 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQD-ASVDA 62
           F KM+  GN  + +D       I+S    A    D  HF    D ++LI    D    D 
Sbjct: 3   FTKMQAAGNDYVYMDT--LKAPISSPEALARRISDR-HFGVGSDGLILICPPSDPGEADF 59

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDG----SI 116
            +R+ N DGSE + CGNG+RCV +++       ++    ET+ G+L  + +  G    ++
Sbjct: 60  RMRMFNADGSEAEMCGNGIRCVGKYVYDNGHTDKEQVRIETLAGVLTLRLHVSGEKVETV 119

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           +VDMGEP L  K IP++   +        +       + N   VSMGNPHA+ F+   + 
Sbjct: 120 TVDMGEPRLAPKDIPVSGPGEDFINRPLRV----QGRVWNVTAVSMGNPHAVVFMHG-ID 174

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
           + DL+  G     HP+F    N     V     L +R WERG G T ACG+ ACASVVA+
Sbjct: 175 NLDLSGIGPQFEHHPLFPRRTNTEFVEVVGRHHLKMRVWERGAGETLACGTGACASVVAA 234

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWI 287
                T R V +K+LGG L IEW +  NHVFMTG       G + + TG+W+
Sbjct: 235 VLTGNTERKVRMKLLGGELDIEWDEATNHVFMTG-------GAVTVFTGEWL 279


>gi|152997589|ref|YP_001342424.1| diaminopimelate epimerase [Marinomonas sp. MWYL1]
 gi|150838513|gb|ABR72489.1| Diaminopimelate epimerase [Marinomonas sp. MWYL1]
          Length = 276

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 148/280 (52%), Gaps = 12/280 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D            I  LS  +    FDQ++++    D  +D  
Sbjct: 2   LLKFTKMHGLGNDFVVVDAVSRKVFFNKQQIEKLSDRNWGIGFDQLLVVEPPTDPDMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  +F+  R    ++    ET RG +  +    G ++VDMG
Sbjct: 62  YRIYNSDGSEVEHCGNGARCFAKFVLDRELTNKRIINVETKRGAIQLRVLDGGLVTVDMG 121

Query: 122 EPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P  + + +P  A   D +    + I   +  +L  P  VS+GNPHA+  V D L   ++
Sbjct: 122 APSFEPQDLPFTAEPCDVL----YSIMAEDTEYLITP--VSVGNPHAVIKV-DQLIDDEV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G L+  H  F   VN+   +V + + ++LR +ERGVG T ACG+ ACA+VVA     
Sbjct: 175 AKVGALIECHERFPRKVNVGFMQVVNPDEINLRVYERGVGETQACGTGACAAVVAGIKQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
             +  V+  + GG L IEW  + + + MTG A+K +EG++
Sbjct: 235 WLSPKVTAHLRGGDLHIEWQGEGSPILMTGPAEKVFEGQI 274


>gi|24212783|ref|NP_710264.1| diaminopimelate epimerase [Leptospira interrogans serovar Lai str.
           56601]
 gi|29839327|sp|Q8F9V5|DAPF_LEPIN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|24193430|gb|AAN47282.1|AE011200_1 diaminopimelate epimerase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 281

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 148/283 (52%), Gaps = 16/283 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KMEGIGN  + ID       +T + I  +S  +     D ++ I + +    D  + +
Sbjct: 6   FTKMEGIGNDYVYIDSTRNDIRLTPEQIQKISDRNFGIGSDGVIFIRNSKQG--DFMMDM 63

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL-----VAKENRDGSISVD 119
            N DGS  + CGNG+RCV +++        K+   ET  GIL     +   N+   +SVD
Sbjct: 64  YNSDGSSSEMCGNGIRCVAKYIYDHGLTSSKNPKIETGAGILEVDLKIGSGNKVDLVSVD 123

Query: 120 MGEPILDWKLIPLARSFDKMDRDR-FHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG+P+L    IP+    ++   D+   IG  N  F      VSMGNPH + FV DD   +
Sbjct: 124 MGKPVLVPSQIPVVWKNEETIIDQPLEIGDKNLKFT----AVSMGNPHCVIFV-DDSDEF 178

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G L+ +H +F + VN+    +   + L  RTWERG G T ACG+ ACA +VA   
Sbjct: 179 PVRGIGPLIERHSIFPKRVNVEFVTIRGKDHLYQRTWERGAGETLACGTGACAVMVAGNL 238

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             ++ + V + + GG L I+W ++ ++ MTG A++ + G+++I
Sbjct: 239 TRRSGKDVQIDLRGGTLRIQWQESGNILMTGPAREIFSGEIEI 281


>gi|59800783|ref|YP_207495.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA 1090]
 gi|194098069|ref|YP_002001117.1| diaminopimelate epimerase [Neisseria gonorrhoeae NCCP11945]
 gi|239998527|ref|ZP_04718451.1| diaminopimelate epimerase [Neisseria gonorrhoeae 35/02]
 gi|240013652|ref|ZP_04720565.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI18]
 gi|240016091|ref|ZP_04722631.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA6140]
 gi|240080233|ref|ZP_04724776.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA19]
 gi|240112446|ref|ZP_04726936.1| diaminopimelate epimerase [Neisseria gonorrhoeae MS11]
 gi|240117470|ref|ZP_04731532.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID1]
 gi|240120722|ref|ZP_04733684.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID24-1]
 gi|240125278|ref|ZP_04738164.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-92-679]
 gi|254493249|ref|ZP_05106420.1| diaminopimelate epimerase [Neisseria gonorrhoeae 1291]
 gi|268594387|ref|ZP_06128554.1| diaminopimelate epimerase [Neisseria gonorrhoeae 35/02]
 gi|268596384|ref|ZP_06130551.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA19]
 gi|268598514|ref|ZP_06132681.1| diaminopimelate epimerase [Neisseria gonorrhoeae MS11]
 gi|268603172|ref|ZP_06137339.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID1]
 gi|268683880|ref|ZP_06150742.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-92-679]
 gi|293399514|ref|ZP_06643667.1| diaminopimelate epimerase [Neisseria gonorrhoeae F62]
 gi|59717678|gb|AAW89083.1| putative diaminopimelate epimerase [Neisseria gonorrhoeae FA 1090]
 gi|193933359|gb|ACF29183.1| DapF [Neisseria gonorrhoeae NCCP11945]
 gi|226512289|gb|EEH61634.1| diaminopimelate epimerase [Neisseria gonorrhoeae 1291]
 gi|268547776|gb|EEZ43194.1| diaminopimelate epimerase [Neisseria gonorrhoeae 35/02]
 gi|268550172|gb|EEZ45191.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA19]
 gi|268582645|gb|EEZ47321.1| diaminopimelate epimerase [Neisseria gonorrhoeae MS11]
 gi|268587303|gb|EEZ51979.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID1]
 gi|268624164|gb|EEZ56564.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-92-679]
 gi|291610083|gb|EFF39205.1| diaminopimelate epimerase [Neisseria gonorrhoeae F62]
 gi|317163802|gb|ADV07343.1| diaminopimelate epimerase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 283

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 142/279 (50%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    D   A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDVPIAAWADRFRGVGFDQLLVVGCSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET +GI+  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+ +  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|186685304|ref|YP_001868500.1| diaminopimelate epimerase [Nostoc punctiforme PCC 73102]
 gi|229813236|sp|B2J3A7|DAPF_NOSP7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|186467756|gb|ACC83557.1| diaminopimelate epimerase [Nostoc punctiforme PCC 73102]
          Length = 279

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 147/298 (49%), Gaps = 45/298 (15%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-----NTHF----DQIMLIHDFQ 56
           ++F K  G+GN  ++ID R       S ++  L+ +      + HF    D ++     +
Sbjct: 3   IEFTKYHGLGNDFILIDNR-------SSSLPVLTPEQAIQLCDRHFGIGADGVIFALPGE 55

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENR 112
           + + D  +RI N DGSE + CGNG+RC+  FL         + S+   T+ G++  +   
Sbjct: 56  NGT-DYTMRIFNSDGSEPEMCGNGIRCLAGFLADLEGQSRNKDSYRIHTLGGVMTPQLLS 114

Query: 113 DGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF----------VVSM 162
           DG + VDMG P L    IP              + PV    +  P            V+M
Sbjct: 115 DGLVKVDMGLPRLLAGEIPTT------------LAPVEEKVISVPLEVAGKTWEVTCVNM 162

Query: 163 GNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLT 222
           GNPH I FVED +   +L S G     HP F + +N    +V   + L +R WERG G+T
Sbjct: 163 GNPHCITFVED-VAAIELESIGPKFEHHPAFPQRINTEFIQVVRRDYLKMRVWERGAGIT 221

Query: 223 AACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            ACG+ ACAS+VA     K +R  +V++ GG L IEW + +  V+MTG A++ + GKL
Sbjct: 222 LACGTGACASLVAGVLTGKCDRTATVELPGGPLQIEWSEIDQRVYMTGPAERVFTGKL 279


>gi|170078250|ref|YP_001734888.1| diaminopimelate epimerase [Synechococcus sp. PCC 7002]
 gi|229813250|sp|B1XP39|DAPF_SYNP2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169885919|gb|ACA99632.1| diaminopimelate epimerase [Synechococcus sp. PCC 7002]
          Length = 281

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 143/286 (50%), Gaps = 15/286 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITS--DAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +++F K +G+GN  +++D R     + +   AI           D ++     Q A  D 
Sbjct: 2   VLEFTKYQGLGNDFILLDNRQQTTPLVTPEQAIQLCDRHFGIGADGVIFALPGQ-AGADY 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGSISV 118
            +RI N DGSE + CGNG+RC+ RF+          K+++  T+ G++  +   D  + V
Sbjct: 61  TMRIFNSDGSEPEMCGNGIRCLARFIDHLEGGNAPGKTYSIHTLAGMIRPRLETDALVRV 120

Query: 119 DMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMGEPIL    IP  L  S  +       +     +       VSMGNPH I FVED + 
Sbjct: 121 DMGEPILTATDIPTTLKDSNGQAVNQPLEVAGKTWMVT----CVSMGNPHCITFVED-VA 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L   G     HP F + +N     V   + + +R WERG G+T ACG+ ACASVVA 
Sbjct: 176 AIALEVIGKDFEHHPAFPQRINTEFIEVVRPDYIKMRVWERGAGITLACGTGACASVVAG 235

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +R  +V++ GG L IEW   +NH++MTG A   ++G++ +
Sbjct: 236 VLTGHCDRLCTVELPGGCLQIEWSAADNHIYMTGPAAISFQGQVTL 281


>gi|254804641|ref|YP_003082862.1| Diaminopimelate epimerase [Neisseria meningitidis alpha14]
 gi|254668183|emb|CBA04889.1| Diaminopimelate epimerase [Neisseria meningitidis alpha14]
          Length = 283

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 143/279 (51%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    DA  A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGN HA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNSHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|75909296|ref|YP_323592.1| diaminopimelate epimerase [Anabaena variabilis ATCC 29413]
 gi|75703021|gb|ABA22697.1| diaminopimelate epimerase [Anabaena variabilis ATCC 29413]
          Length = 282

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 149/300 (49%), Gaps = 39/300 (13%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHF----DQIMLIHDF 55
           M    ++F K  G+GN  ++ID R      IT +   A+   D  HF    D ++     
Sbjct: 1   MGKMAIEFTKYHGLGNDFILIDNRASKTPAITPE--KAVEMCDR-HFGIGADGVIFALPG 57

Query: 56  QDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLT-----SRMKRKSFTFETIRGILVAKE 110
           ++ + D  +RI N DGSE + CGNG+RC+  FL      SR K  ++   T+ G++  + 
Sbjct: 58  ENGT-DYTMRIFNSDGSEPEMCGNGIRCLAAFLADLEGLSRNK-DTYRIHTLAGVITPQL 115

Query: 111 NRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF----------VV 160
             DG I VDMG P L    IP             +I   +   +  P            V
Sbjct: 116 TPDGQIKVDMGLPRLLAGEIPT------------NIAAADQKVINQPLEVEGKTWEVTCV 163

Query: 161 SMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVG 220
           SMGNPH I FVED +    L + G     HP F +  N    +V S + L +R WERG G
Sbjct: 164 SMGNPHCITFVED-VAAIPLETIGPKFEHHPAFPQRTNTEFIQVVSRDYLKMRVWERGAG 222

Query: 221 LTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +T ACG+ ACAS+VA+    +++R  +V++ GG L IEW + +  ++MTG A + + GKL
Sbjct: 223 ITLACGTGACASLVAAVLTGRSDRLATVELPGGPLEIEWSEVDQRIYMTGPADRVFTGKL 282


>gi|15603568|ref|NP_246642.1| diaminopimelate epimerase [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|13431432|sp|P57962|DAPF_PASMU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|12722112|gb|AAK03787.1| DapF [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 274

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 137/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAITQNLYFSPETIKRLADRHRGIGFDQMLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T  G ++     DG I ++MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTDKKDIAVSTQTGKMILSIKDDGMIRINMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   IP  A  F+K    R  I  V          VSMGNPH +  V DD+   ++ 
Sbjct: 121 PIWEPAKIPFTANKFEKNYILRTSIQTVLC------GAVSMGNPHCVVQV-DDIQTANVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F E VN    +V     + LR +ERG G T ACGS ACA+V        
Sbjct: 174 QLGPLLENHERFPERVNAGFMQVIHRGHIKLRVYERGAGETQACGSGACAAVAVGVMQGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
            +  V V + GG L+IEW      +FMTG+A   ++G
Sbjct: 234 LDSKVQVDLPGGSLIIEWEGVGKPLFMTGDATHVYDG 270


>gi|313895012|ref|ZP_07828569.1| diaminopimelate epimerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975907|gb|EFR41365.1| diaminopimelate epimerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 279

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 141/280 (50%), Gaps = 15/280 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F K +G GN  +V+D       +  + A+           D +M++      + D  +
Sbjct: 1   MEFTKWQGCGNDFVVVDFLAREPVDFAALAVRMCDRHFGVGADGLMVV--LPSETADIRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAK----ENRDGSISV 118
           R  N DG+E + CGNG+RC  R+L    R+K++ FT ET+ GI+  +    + +  ++ V
Sbjct: 59  REFNPDGTEPEMCGNGIRCFARYLYEYGRIKKEQFTIETLAGIMTPRILIEDGKVTAVEV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV-VSMGNPHAIFFVEDDLYH 177
           DMG P+L    IP+ R F     +R    P+           VSMGNPHA+ FV DD  H
Sbjct: 119 DMGVPVLTGDDIPV-RGFGT---ERVIAAPITVAGRTYKMTCVSMGNPHAVIFV-DDAEH 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + LA  G     H +F   +N     V       +R WERG G+T ACG+  CA++ A  
Sbjct: 174 FPLAELGAQFENHELFPRKINTEFVEVKDRSHARMRVWERGAGITLACGTGTCATLTAGV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
                +RA  +++ GG + +EW ++ H+FMTG A+  + G
Sbjct: 234 LTGVLDRAADIEVDGGVIRVEWREDGHIFMTGPAEPVFTG 273


>gi|224087786|ref|XP_002308231.1| predicted protein [Populus trichocarpa]
 gi|222854207|gb|EEE91754.1| predicted protein [Populus trichocarpa]
          Length = 314

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 142/293 (48%), Gaps = 18/293 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-VD 61
           S  + F K  G+GN  +V+D R   +            D N       +I      +  D
Sbjct: 26  SRFLHFVKYHGLGNDFIVLDNRDSSEPKIRPEQAVKLCDRNFGIGADGVIFALPGVNGTD 85

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSIS 117
             +RI N DGSE + CGNG+RC  RF+        KR+SFT  T  G++V +   DG + 
Sbjct: 86  YTMRIFNSDGSEPEMCGNGVRCFARFIAELENFHGKRQSFTVHTGAGLIVPEIQEDGQVK 145

Query: 118 VDMGEPILDWKLIPLARSFDKMD---RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE-- 172
           VDMGEP+L    +P   + +K D   +    +  V      N   VSMGNPH + F    
Sbjct: 146 VDMGEPVLKAANVPTKLASNKNDAVVKSELVVDGVTW----NVTCVSMGNPHCVTFGTKG 201

Query: 173 -DDLY--HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
            +DL     +LA  G     H +F    N    +V S   L +R WERG G T ACG+ A
Sbjct: 202 GEDLQVDALNLAQIGPKFEHHDVFPARTNTEFVQVYSPSHLKMRVWERGAGATLACGTGA 261

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           CA+VVA+    +  R  +V + GG L IEW  ++NHV+MTG A+  + G + +
Sbjct: 262 CATVVAAVLEGRAGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEVVFYGSVRL 314


>gi|240123026|ref|ZP_04735982.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID332]
 gi|240127732|ref|ZP_04740393.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-93-1035]
 gi|268681653|ref|ZP_06148515.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID332]
 gi|268686123|ref|ZP_06152985.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-93-1035]
 gi|268621937|gb|EEZ54337.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID332]
 gi|268626407|gb|EEZ58807.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-93-1035]
          Length = 283

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 142/279 (50%), Gaps = 11/279 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD--NTHFDQIMLIHDFQDASVDAFIR 65
           F KM G+GN  +VID     D    D   A   D      FDQ++++   +   VD   R
Sbjct: 6   FTKMHGLGNDFMVIDAVS-QDFTPEDVPIAAWADRFRGVGFDQLLVVGCSETEGVDFRYR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV  CGNG RC  RF+  +    +K    ET +GI+  K + +G ++V+MG+P
Sbjct: 65  IFNADGSEVVQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVTVNMGKP 124

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP      + D D    G      ++    V+MGNPHA+  V DD+    +   
Sbjct: 125 KFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVV-DDVECAPVRET 182

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLH 240
           G+ +  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA    G L 
Sbjct: 183 GSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLD 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 243 E-GKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|255009607|ref|ZP_05281733.1| diaminopimelate epimerase [Bacteroides fragilis 3_1_12]
 gi|313147388|ref|ZP_07809581.1| diaminopimelate epimerase [Bacteroides fragilis 3_1_12]
 gi|313136155|gb|EFR53515.1| diaminopimelate epimerase [Bacteroides fragilis 3_1_12]
          Length = 269

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 149/291 (51%), Gaps = 35/291 (12%)

Query: 3   SSMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           +  + F KM G GN  + ++ +R    N    AI   +       D ++LI     A  D
Sbjct: 2   TRTIQFTKMHGAGNDYIYVNTLRFPIRNPGKTAIEWSACHTGIGSDGLVLIGHSDKA--D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----S 115
             +RI N DGSE   CGN  RC+ ++L       +   T ET+ GI V K + +     +
Sbjct: 60  FSMRIFNADGSEAMMCGNASRCIGKYLYEYGLTSKNIITLETLSGIKVLKLHLEAQTVKA 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV---VSMGNPHAIFFVE 172
           ++VDMG P+    +      FD    ++F            PFV   VSMGNPH + FV 
Sbjct: 120 VTVDMGVPLETGTI-----DFD----NKF------------PFVSTQVSMGNPHLVTFV- 157

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DD+   DL   G  L +HP+F +  N+  A++T    + +R WERG G+T ACG+ ACA+
Sbjct: 158 DDIRSIDLPEIGPKLERHPLFPDRTNVEFAQITGENKIRMRVWERGSGITQACGTGACAT 217

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
            VA+    +T R V + M GG L I+W +  NHV+MTG A K ++G ++++
Sbjct: 218 AVAAHLTGRTGRTVDIVMDGGTLTIKWDEATNHVYMTGPAVKVFDGTIELR 268


>gi|317494829|ref|ZP_07953240.1| diaminopimelate epimerase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917154|gb|EFV38502.1| diaminopimelate epimerase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 274

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 140/277 (50%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN-THFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS   N   FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHNGVGFDQMLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V K + D  ++V+MGE
Sbjct: 61  RIFNADGSEVGQCGNGARCFARFVRLKGLTNKREIRVSTQNGRMVLKVSDDELVTVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   IP    F  +  ++ +I     H  L     VSMGNPH +  V DD+    + 
Sbjct: 121 PIFEPSKIP----FKAVKAEKTYIMRAAEHTILCG--AVSMGNPHCVLQV-DDVETALVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E VN+   +V +   + LR +ERG G T ACGS ACA+V        
Sbjct: 174 TIGPVLESHERFPERVNVGFMQVINRNQIKLRVYERGAGETQACGSGACAAVAVGIQQGL 233

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
            +  V V + GG L I W   +N +FMTG A   ++G
Sbjct: 234 LDENVQVDLPGGRLQIRWKGPDNPLFMTGPATHVYDG 270


>gi|291612620|ref|YP_003522777.1| diaminopimelate epimerase [Sideroxydans lithotrophicus ES-1]
 gi|291582732|gb|ADE10390.1| diaminopimelate epimerase [Sideroxydans lithotrophicus ES-1]
          Length = 276

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 144/281 (51%), Gaps = 16/281 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D       ++ + I  ++   + HF    DQ++L+   Q    D  
Sbjct: 5   FTKMHGAGNDFVVLDGVRQSVALSPEQIRYIA---DRHFGIGCDQVLLVEKTQRDEADFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC VRF+  +    ++    ET  G++  +   DG I+V+MG
Sbjct: 62  YRIFNADGGEVEQCGNGARCFVRFVHDQNLTSKREIVVETKSGLISPRLEEDGRITVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PI D   IP      ++ +    +G  +        VVSMGNPHA+  V DD+    +A
Sbjct: 122 LPIFDPAQIPFVSDSTEVIQP-LQVGNESVQIT----VVSMGNPHAVQVV-DDVETAPVA 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  +  HP F + VN+   +V   E + LR +ERG G T +CG+ ACA+VVA      
Sbjct: 176 TQGPFIEIHPRFPKRVNVGYMQVVDREHIRLRVYERGAGETLSCGTGACAAVVAGIRRKL 235

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            +  V V   GG L I W  + + V MTG A   +EG++++
Sbjct: 236 LDNTVHVATRGGTLSITWAGERSPVMMTGPAITVFEGEINL 276


>gi|78044318|ref|YP_360325.1| diaminopimelate epimerase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123576129|sp|Q3AC09|DAPF_CARHZ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|77996433|gb|ABB15332.1| diaminopimelate epimerase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 274

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 143/280 (51%), Gaps = 16/280 (5%)

Query: 6   VDFAKMEGIGNKILVID----MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++F KM G+GN  +V+D        + N++  A            D ++L+   + A  D
Sbjct: 1   MEFLKMHGLGNDFVVVDEIKNQNLVNKNLSDLAKKICDRRFGIGADGLVLLLPSEKA--D 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVD 119
             +RIIN DGSE + CGN +RCV R+   +    +K    ET+ GI+  +   +  + VD
Sbjct: 59  FKMRIINSDGSEAEMCGNAIRCVARYYVEKYNPAKKQLEVETLAGIIKPEVLENNMVRVD 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV-VSMGNPHAIFFVEDDLYHY 178
           MG PIL  + IP+A     ++ +  +I P+  L  +  F  VSMGNPHA+ FV D L   
Sbjct: 119 MGRPILKPQEIPVA-----VEEEPVNI-PLEVLGQKFYFTAVSMGNPHAVIFV-DSLAKI 171

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           +L  +G L+  HP+F    N+    + S   + +  WERG G T ACG+ A A VVA   
Sbjct: 172 ELEKYGPLIETHPLFPRKTNVEFVEILSPAKVKVFVWERGAGATLACGTGASAVVVAGRI 231

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           L      V V + GG L I W     V+MTG A+  ++G+
Sbjct: 232 LGHLQEDVEVVLPGGSLFINWVFGESVYMTGPAEIVFKGE 271


>gi|45655988|ref|YP_000074.1| diaminopimelate epimerase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|59797812|sp|Q72W63|DAPF_LEPIC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|45599221|gb|AAS68711.1| diaminopimelate epimerase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 281

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 148/283 (52%), Gaps = 16/283 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KMEGIGN  + ID       +T + I  +S  +     D ++ I + +    D  + +
Sbjct: 6   FTKMEGIGNDYVYIDSTRNDIRLTPEQIQKISDRNFGIGSDGVIFIRNSKQG--DFMMDM 63

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL-----VAKENRDGSISVD 119
            N DGS  + CGNG+RCV +++        K+   ET  GIL     +   N+   +SVD
Sbjct: 64  YNSDGSSSEMCGNGIRCVAKYIYDHGLTSSKNPKIETGAGILEVDLKIGSGNKVDLVSVD 123

Query: 120 MGEPILDWKLIPLARSFDKMDRDR-FHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG+P+L    IP+    ++   D+   IG  N  F      VSMGNPH + FV DD   +
Sbjct: 124 MGKPVLVPSQIPVVWKNEETIIDQPLEIGDKNLKFT----AVSMGNPHCVIFV-DDSDEF 178

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G L+ +H +F + VN+    +   + L  RTWERG G T ACG+ ACA +VA   
Sbjct: 179 PVRGIGPLIERHSIFPKRVNVEFVTIRGKDHLYQRTWERGAGETLACGTGACAVMVAGNL 238

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             ++ + V + + GG L I+W ++ ++ MTG A++ + G+++I
Sbjct: 239 TGRSGKDVQIDLRGGTLRIQWQESGNILMTGPAREIFSGEIEI 281


>gi|134299550|ref|YP_001113046.1| diaminopimelate epimerase [Desulfotomaculum reducens MI-1]
 gi|229807506|sp|A4J568|DAPF_DESRM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|134052250|gb|ABO50221.1| diaminopimelate epimerase [Desulfotomaculum reducens MI-1]
          Length = 284

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 143/283 (50%), Gaps = 16/283 (5%)

Query: 8   FAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           F K+ G+GN  ++++    +G  D+ ++ A            D ++L++D      D  +
Sbjct: 3   FTKVHGLGNDFILVNAGTGQGFTDDCSTLAKEVCDRKFGIGADGLVLLYD--SGVADVRM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGSISV 118
           +I+N DGSE + CGN +RCV ++L     +K+     ET+ GI+V +    E    ++ V
Sbjct: 61  KIVNSDGSEAEMCGNAIRCVAKYLYDHGIIKKDEIKVETLAGIIVPQIIQQEGSVKAVRV 120

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEP ++   IP+     ++  +   +    +L       VSMGNPH I FV  DL   
Sbjct: 121 DMGEPRVERAEIPMIGPPGQVIGEELAVNGKVYLVT----AVSMGNPHCIIFV-PDLEDI 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G  +  HP F +  N+   +V     + +  WERG G T ACG+ ACA  VA   
Sbjct: 176 SLTQVGPQIEVHPAFPKKTNVEFVQVLGPNEVRMVVWERGAGPTMACGTGACAVAVAGVL 235

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              T R V+V + GG L+IEW +N  ++MTG A + + G+  +
Sbjct: 236 NGFTERMVTVHLPGGSLMIEWAENGRIYMTGPATEVFSGEYTV 278


>gi|167855050|ref|ZP_02477823.1| glucosamine-6-phosphate deaminase [Haemophilus parasuis 29755]
 gi|219872103|ref|YP_002476478.1| diaminopimelate epimerase [Haemophilus parasuis SH0165]
 gi|254767106|sp|B8F878|DAPF_HAEPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167853788|gb|EDS25029.1| glucosamine-6-phosphate deaminase [Haemophilus parasuis 29755]
 gi|219692307|gb|ACL33530.1| diaminopimelate epimerase [Haemophilus parasuis SH0165]
          Length = 274

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 142/279 (50%), Gaps = 12/279 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I   +       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEELIRKWADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     DG + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKQDIGVSTAKGKMVLSLQDDGQVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PI +   IP  A  F+K    R  I  V         VVSMGNPH +  VE+ +   ++ 
Sbjct: 121 PIWEPAQIPFTANKFEKNYILRTDIQTVLC------GVVSMGNPHCVLQVEN-IQTANVN 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL +H  F E  N+   +V +   + LR +ERG G T ACGS AC +V        
Sbjct: 174 ELGALLERHERFPERANIGFMQVINRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            +  V V + GG L IEW    + ++MTG+A+  ++G +
Sbjct: 234 LDSRVQVDLPGGTLHIEWQGVGSPLYMTGDAEHIYDGAV 272


>gi|126666599|ref|ZP_01737577.1| diaminopimelate epimerase [Marinobacter sp. ELB17]
 gi|126628987|gb|EAZ99606.1| diaminopimelate epimerase [Marinobacter sp. ELB17]
          Length = 328

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/298 (33%), Positives = 148/298 (49%), Gaps = 20/298 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
             ++ F KM G+GN  +V+D       +  + I  L+       FDQ++++       VD
Sbjct: 33  GGVLRFTKMHGLGNDFMVVDAISQMFRLRPEMIRELADRHFGIGFDQLLVVEPPGLPDVD 92

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+  +    +K    +T  GI+  +  +DG + VD
Sbjct: 93  FRYRIFNADGSEVEQCGNGARCFARFVRDQRLTNKKVMRVQTAGGIIELRVGKDGLVKVD 152

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNP----FVVSMGNPHAIFFVEDDL 175
           MG P L+   +P +        D F   PV +L +        VVSMGNPH +    DD+
Sbjct: 153 MGVPRLEPATVPFSA-------DEF--APVYNLDVNGQNIELSVVSMGNPHGVILT-DDV 202

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +A+ G LL KH  F    N+   ++     + LR +ERG G T ACG+ ACA+VVA
Sbjct: 203 DSAPVATLGPLLEKHWRFPAKANIGFMQIVDRSHIRLRVFERGCGETLACGTGACAAVVA 262

Query: 236 SGCLHK-TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNE 291
            GCL    +  V V++ GG L+IEW      V M G     +EG+L +     +++ +
Sbjct: 263 -GCLRGLLDSRVEVELPGGRLIIEWQGLGAAVMMDGPVASVFEGQLRLPAEPGMRRRK 319


>gi|312878385|ref|ZP_07738293.1| diaminopimelate epimerase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311794840|gb|EFR11261.1| diaminopimelate epimerase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 278

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 150/281 (53%), Gaps = 18/281 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +VID RG  D +  S A            D ++L+ D + A  D  +RI
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNSLAKRMCHRHIGVGADGLLLVLDSKLA--DIRMRI 60

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE--NRDG---SISVD 119
           IN DGSE + CGNG+RC  +++  R  +K+  F  ET+ GI+  +   N  G    + V+
Sbjct: 61  INSDGSEAEMCGNGIRCFSKYVFERGIVKKDKFKVETLAGIIEPELILNEYGLVEKVKVN 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVS--MGNPHAIFFVEDDLYH 177
           MG+P    K IP+     + D +   I     +  +   + S  MG PH + FV DD+  
Sbjct: 121 MGKPSFKRKDIPM-----QGDPESDAINTSIEVDGKEYKITSLLMGVPHTVLFV-DDVEK 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+ + G  + KH +F    N++  +V    ++ +RTWERG G T ACG+ +CASV+AS 
Sbjct: 175 VDIYTLGPKIEKHEVFPRKTNVNFVQVIDKNNIKVRTWERGAGATYACGTGSCASVIASN 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
               T R  +V +  G L IEW D+  VFMTG A++ + G+
Sbjct: 235 LNGYTERKANVHLYFGTLEIEWQDSGTVFMTGPAEEVFVGE 275


>gi|331005626|ref|ZP_08328995.1| Diaminopimelate epimerase [gamma proteobacterium IMCC1989]
 gi|330420551|gb|EGG94848.1| Diaminopimelate epimerase [gamma proteobacterium IMCC1989]
          Length = 282

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 146/287 (50%), Gaps = 18/287 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           ++ + F KM G+GN  +V D      ++T + I  ++        DQ++++   Q    D
Sbjct: 6   TTRLRFTKMHGLGNDFVVFDGINQDIDLTPERIRKIADRRFGIGCDQLLVVEVPQHPEND 65

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV++CGNG RC  +F+  +    + +   ET+ G+L    +R G ++VD
Sbjct: 66  FRYRIYNYDGSEVENCGNGARCFAKFVRDKKLTGKNTIRVETLGGVLTLHASRQGDVTVD 125

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----VSMGNPHAIFFVEDDL 175
           MG P+L    IP       ++ D         L L +  +    +SMGNPHA+  V D++
Sbjct: 126 MGVPVLTPAEIPFNADSQAVNYD---------LALADQTISISAISMGNPHAVTLV-DNV 175

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +  +G L+  H  F   VN     V S ES+ LR +ERGVG T ACG+ ACA+VVA
Sbjct: 176 DTAPIEQWGPLIENHSRFPNRVNAGFMAVESRESIRLRVYERGVGETLACGTGACAAVVA 235

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                  +  V+  + GG L IEW    H V MTG A   ++G++ I
Sbjct: 236 GHLQGLLDPVVTAHLRGGDLRIEWQGIGHPVMMTGPATTVFQGQVKI 282


>gi|190150861|ref|YP_001969386.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|307264212|ref|ZP_07545803.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|229807483|sp|B3GYL3|DAPF_ACTP7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189915992|gb|ACE62244.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|306870458|gb|EFN02211.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 274

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 138/283 (48%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 NLAPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 270


>gi|145343420|ref|XP_001416323.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144576548|gb|ABO94616.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 407

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 147/293 (50%), Gaps = 21/293 (7%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASV 60
           S  +DF K +G+GN  ++ID R       S    A   D N     D ++      DAS 
Sbjct: 116 SRTIDFIKYQGLGNDFILIDNRDSATVKMSSEAAAKMCDRNFGIGGDGVIFAMPPNDASE 175

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISV 118
           D  +R+ N DGSE + CGNG+RC+ RF++    M  K +   T+ G++  +   DG ++V
Sbjct: 176 DYSMRMFNSDGSEPEMCGNGIRCLARFVSDLDAMPPKKYKVGTLAGLIQPEMRADGQVAV 235

Query: 119 DMGEPILDWKLIP--LARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV---- 171
           DMG PI +   +P  LA + D K+ R    +      +L N   VSMGNPH I F     
Sbjct: 236 DMGMPIFEPSEVPTTLAATQDGKVVRAEMDVD--GEKWLVN--AVSMGNPHCITFGRAGG 291

Query: 172 EDD-----LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
           E D     L  + L+  G     HP F    N    +V +   + +  WERG G T ACG
Sbjct: 292 EADGPGLKLDEFPLSVVGPKFESHPCFPARTNTEFTQVVNRNYVKMHVWERGAGATLACG 351

Query: 227 SAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGK 278
           + ACA+VVA     + +R  +V++ GG L IEW +++  + MTG A+  + GK
Sbjct: 352 TGACATVVAGVLEGRVDRRCTVELPGGPLEIEWRESDGRIIMTGPAEPVFAGK 404


>gi|322513262|ref|ZP_08066386.1| diaminopimelate epimerase [Actinobacillus ureae ATCC 25976]
 gi|322120969|gb|EFX92816.1| diaminopimelate epimerase [Actinobacillus ureae ATCC 25976]
          Length = 279

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 140/288 (48%), Gaps = 24/288 (8%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M  + + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  
Sbjct: 1   MIGNNMQFSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHTGVGFDQLLLVEPPYDPD 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    ++     T +G ++     +  + 
Sbjct: 61  LDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMILTLKGEEKVR 120

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFF 170
           V+MGEPI +   +P  A  F+K            +  LR         VVSMGNPH +  
Sbjct: 121 VNMGEPIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQ 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           VED +    +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC
Sbjct: 169 VED-IKTAPVNELGPLLENHERFPERANIGFIQVVNRNHIKLRVFERGAGETQACGSGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +V         +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GAVAVGIMQGLLDSNVQVDLPGGSLQIEWKGVGHPLYMTGDATHIYDG 275


>gi|238784733|ref|ZP_04628736.1| Diaminopimelate epimerase [Yersinia bercovieri ATCC 43970]
 gi|238714329|gb|EEQ06338.1| Diaminopimelate epimerase [Yersinia bercovieri ATCC 43970]
          Length = 274

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 142/277 (51%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D  +D  
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLA-DRHTGVGFDQMLVVEPPYDPELDFH 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MG
Sbjct: 60  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDEEVCVNMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  D + +P   +  K ++          +      VVSMGNPH +  V DD+   ++A
Sbjct: 120 EPNFDPQSVPFRAT--KAEKTYIFRAAEQTVLCG---VVSMGNPHCVLQV-DDVAVANVA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   +V S +++ LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLESHERFPERANIGFMQVVSRDNIRLRVYERGAGETQACGSGACAAVAVGIQQDL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +  V+V++ GG LLI W    H ++MTG A   ++G
Sbjct: 234 LDEEVTVELPGGSLLISWKGPGHPLYMTGPATHVYDG 270


>gi|307253187|ref|ZP_07535063.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306859331|gb|EFM91368.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 279

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 140/288 (48%), Gaps = 24/288 (8%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M  + + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  
Sbjct: 1   MIGNNMQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPE 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T  S   ++     T +G +V     +  + 
Sbjct: 61  LDFHYRIFNADGSEVAQCGNGARCFARFVTLKSLTNKQDIHVSTAKGKMVLTLKDEEKVR 120

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFF 170
           V+MGEPI +   +P  A  F+K            +  LR         VVSMGNPH +  
Sbjct: 121 VNMGEPIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQ 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           VED +    +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC
Sbjct: 169 VED-INLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +V         +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GAVAVGIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 275


>gi|298711974|emb|CBJ32916.1| diaminopimelate epimerase [Ectocarpus siliculosus]
          Length = 285

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 145/290 (50%), Gaps = 28/290 (9%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASV 60
           + +V F+K +G+GN  +++D R   + + +   +A   D       D ++      D  +
Sbjct: 4   TKLVPFSKYQGLGNDFILVDNREETEPMLTAEESASLCDRRYGIGGDGVIFALPGSD-EM 62

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETIRGILVAKENRDGSISV 118
           D  +RIIN DGSE + CGNG+RC+ RFL      K+  +   T+ G ++     DG ++V
Sbjct: 63  DYSMRIINSDGSEPEMCGNGIRCMARFLADLEGKKKAEYKIHTLAGTIIPMAREDGLVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF----------VVSMGNPHAI 168
           DMG P L+   +P     +            + + L+ P            VSMGNPHA+
Sbjct: 123 DMGPPELNGPKVPSTLPTND-----------DGVVLKEPIKVDGKDWEVTCVSMGNPHAV 171

Query: 169 FFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
            FV D +   DL + G     HP F   +N    +V +   + +  WERG G+T ACG+ 
Sbjct: 172 VFVPD-VDALDLPTIGPQFETHPSFPAKINTEFVQVLNRGHVKMVVWERGCGITQACGTG 230

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEG 277
           ACA VVAS      +R  +V + GG L IEW +++  V+MTG A+  ++G
Sbjct: 231 ACALVVASVLAGLADRKCTVTLPGGDLQIEWRESDGKVYMTGPAELAFQG 280


>gi|225075130|ref|ZP_03718329.1| hypothetical protein NEIFLAOT_00129 [Neisseria flavescens
           NRL30031/H210]
 gi|224953614|gb|EEG34823.1| hypothetical protein NEIFLAOT_00129 [Neisseria flavescens
           NRL30031/H210]
          Length = 283

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 140/277 (50%), Gaps = 7/277 (2%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V++ +    D + +             FDQ +++      +VD   RI
Sbjct: 6   FTKMHGLGNDFMVVNAINQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDAVDFRYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++V+MG+P 
Sbjct: 66  FNADGREVEQCGNGARCFARFVADKGLTDKTEILVETAKGIIVPKLLDNGLVTVNMGKPR 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
                IP   +  + +    HI  V  L       V+MGNPHA+  V DD+    +  +G
Sbjct: 126 FMPSEIPFVPAHGENEDALTHIVLVG-LESVPVSCVNMGNPHAVILV-DDVETAPVEHWG 183

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS--GCLHKT 242
            ++  H  F E VN+   +V    S+ LR +ERGVG T ACG+ ACA+VVA     L K 
Sbjct: 184 GVIESHEQFPERVNVGFLQVEDELSVRLRVFERGVGETQACGTGACAAVVAGVRNGLLKA 243

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              V V + GG L I W +   V MTG A+  +EG+L
Sbjct: 244 GAPVRVTLPGGELFISWEEGGDVQMTGPAETVFEGEL 280


>gi|88808555|ref|ZP_01124065.1| diaminopimelate epimerase [Synechococcus sp. WH 7805]
 gi|88787543|gb|EAR18700.1| diaminopimelate epimerase [Synechococcus sp. WH 7805]
          Length = 368

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 147/286 (51%), Gaps = 14/286 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNTHF----DQIMLIHDFQDA 58
           M+ F+K +G+GN  ++++ R     ++ITS   + +    +  F    D ++L    Q  
Sbjct: 1   MLQFSKYQGLGNDFILVEGRDGRLPESITSPNADWVRKVCDRRFGLGGDGLILALPPQGQ 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFETIRGILVAKENRDGS 115
             D  +RI N DGSE + CGNG+RC+ RFL      +  +S+  ET  G ++ +  +DG 
Sbjct: 61  G-DLRMRIFNADGSEAEMCGNGIRCLARFLADSDGDLPGRSWRIETPAGQIIPELQQDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P L  + +P   S D+    R  +         +   V MGNPH +  V DDL
Sbjct: 120 IRVDMGAPFLKPEAVPTLLSPDENGLPRGEV--TREGLTLSLAAVGMGNPHVVVPV-DDL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 + G  L   P+F    N+   +V S + L++R WERG G T ACG+ ACA++VA
Sbjct: 177 ETIPFEALGAQLECDPIFPAKTNVHFLKVLSRQHLEIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLD 280
           +  L  ++   +V + GG L I W D    VFMTG A   ++G ++
Sbjct: 237 AFLLGLSDSEATVVLPGGPLSISWPDQQGSVFMTGPAVAVFDGVMN 282


>gi|134045763|ref|YP_001097249.1| diaminopimelate epimerase [Methanococcus maripaludis C5]
 gi|254767111|sp|A4FXV0|DAPF_METM5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|132663388|gb|ABO35034.1| diaminopimelate epimerase [Methanococcus maripaludis C5]
          Length = 277

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 147/282 (52%), Gaps = 15/282 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN  + +D          + I+   +D +       L+        D  +R+ 
Sbjct: 3   FTKMHGLGNDYIYVDAISQKIE-NPNEISKFVSDRHFGIGSDGLVLILPSDVADFKMRMF 61

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISVDMG 121
           N DGSE + CGN +RCV +F+  +    + + + ET+ GI V +   +      + VDMG
Sbjct: 62  NSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTISIETLAGIKVLEMTVENGKVVLVKVDMG 121

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EPIL  + IP L+     +D +   I   ++ +  N   VSMGNPHAI ++E+ +  + L
Sbjct: 122 EPILKAETIPVLSEKHPVIDEE---ITAKDYCY--NFTCVSMGNPHAITYIEN-VEEFPL 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L   H  F +  N+    +    ++ +R WERG G T ACG+ ACA + AS    
Sbjct: 176 EKIGPLFEVHEKFPKKTNVEFVELIDDSTVKMRVWERGAGETLACGTGACAVLTASVLKG 235

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              R  +VK+LGG L+IEW++ +NH++MTG A   +EG++DI
Sbjct: 236 YVGRKATVKLLGGDLIIEWNEKDNHIYMTGPATTVFEGEIDI 277


>gi|254448956|ref|ZP_05062411.1| diaminopimelate epimerase [gamma proteobacterium HTCC5015]
 gi|198261493|gb|EDY85783.1| diaminopimelate epimerase [gamma proteobacterium HTCC5015]
          Length = 281

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 141/282 (50%), Gaps = 12/282 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +VID       ++ D +  ++        DQ++L+   +  S D   RI
Sbjct: 5   FSKMHGLGNDFVVIDAIRQQVELSPDQVRRIADRRFGVGCDQLLLVERPESKSADFRYRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR----MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            N DGSEV+ CGNG RC  RF+  +        S   ET+ G +  +      + VDMG 
Sbjct: 65  YNADGSEVEQCGNGARCFGRFVVDQGLADASCASLKIETLGGPIEIQLLDGHQVQVDMGV 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D   +P      + D +  H        L +   VSMGNPHA+ +V D++    +A 
Sbjct: 125 PRFDPSALPF-----EADAEAAHYALDTAGQLLDIGAVSMGNPHAVLWV-DEIQEAPVAE 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F + VN   A+  S   + LR +ERG G T ACG+ ACA+V       K 
Sbjct: 179 LGPAIESHPRFPQRVNAGFAQCLSRSEIHLRVYERGAGETLACGTGACAAVAVGIRQGKL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
           +R V+V + GG L I W D++  + MTG+A   +EG +D+ +
Sbjct: 239 DREVTVHLPGGDLNIYWPDDDQSLMMTGDAITVFEGTIDLSS 280


>gi|30022977|ref|NP_834608.1| diaminopimelate epimerase [Bacillus cereus ATCC 14579]
 gi|81580413|sp|Q816D1|DAPF_BACCR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|29898537|gb|AAP11809.1| Diaminopimelate epimerase [Bacillus cereus ATCC 14579]
          Length = 288

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 151/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L  S     R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGESETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERVNVEFIEILNEDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|157413339|ref|YP_001484205.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9215]
 gi|157387914|gb|ABV50619.1| Diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9215]
          Length = 286

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 150/287 (52%), Gaps = 20/287 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F K +G GN  +V D RG   + N  ++ I  +    N  F    D ++ I +  + +
Sbjct: 4   ITFEKYQGNGNDFVVFDSRGNDIYKNYKTNKIFDIKKICNRQFGIGADGVIFIEEPNEDN 63

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGS 115
               I I N DGSE Q CGNG+RC+V +L    +  +K K +  ET  G+ +AK   D  
Sbjct: 64  YAKMI-IFNSDGSEAQMCGNGIRCLVEYLHVNDSINIKNKEYKIETKAGLKIAKYIND-K 121

Query: 116 ISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           I+V MG PIL+ + IP  + +  + +    F    +   F    + V MGNPH IFFV+D
Sbjct: 122 ITVKMGVPILESQNIPTTIEKKINSIPSHEF----IEKNFKYIGYAVGMGNPHLIFFVQD 177

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +   +L+  G +  K+ +F E  N+   ++ + +++ ++ WERG G T ACG+ ACA  
Sbjct: 178 -IESINLSRLGPIFEKNELFPEKTNVHFCQIVNRDNIKVKVWERGAGPTLACGTGACAIH 236

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
           VA+  L   N    V + GG L I+W  D+  V MTG AK+ + G +
Sbjct: 237 VAAYKLGLCNSETIVTLPGGNLKIDWSKDDCEVMMTGNAKRVFSGSI 283


>gi|150006487|ref|YP_001301231.1| diaminopimelate epimerase [Bacteroides vulgatus ATCC 8482]
 gi|294775411|ref|ZP_06740926.1| diaminopimelate epimerase [Bacteroides vulgatus PC510]
 gi|166224242|sp|A6L7E5|DAPF_BACV8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|149934911|gb|ABR41609.1| diaminopimelate epimerase [Bacteroides vulgatus ATCC 8482]
 gi|294450731|gb|EFG19216.1| diaminopimelate epimerase [Bacteroides vulgatus PC510]
          Length = 280

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 149/290 (51%), Gaps = 22/290 (7%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDA 58
           ++ + F KM+G GN  + ++      +   D I A       H     D ++LI   + A
Sbjct: 2   ATTIKFTKMQGTGNDYIYVNTL---SSPLQDPIKAARKWSTYHTGIGADGLVLIGASEKA 58

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI 116
             D  +RI N DGSE   CGN  RC+ +++  +    ++  T ET+ GI + K +    +
Sbjct: 59  --DFSMRIFNADGSEAMMCGNASRCIGKYVYEKGLTDKEVITLETLSGIKILKLHTGNGV 116

Query: 117 ----SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
               +VDMG P+L      +A     M  +     P +    +  FV  MGNPH + FV 
Sbjct: 117 VKDVTVDMGTPLLS-NPGQIATKTGGMLAETI---PADGKEYKGTFVC-MGNPHVVIFV- 170

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DD+   DL + G  L  HP+F E  N+    +   +SL +R WERG G+T ACG+ ACA+
Sbjct: 171 DDIKEVDLPAVGPKLENHPLFPERTNVEFVEILPDQSLRMRVWERGSGITMACGTGACAT 230

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
            VA+   HK  R   V+M GG L I W++ + HV+MTG A K +EG++++
Sbjct: 231 AVAAVLNHKAGRKSWVRMDGGDLHIHWNEKDGHVYMTGPAGKVFEGEIEM 280


>gi|169404550|pdb|2OTN|A Chain A, Crystal Structure Of The Catalytically Active Form Of
           Diaminopimelate Epimerase From Bacillus Anthracis
 gi|169404551|pdb|2OTN|B Chain B, Crystal Structure Of The Catalytically Active Form Of
           Diaminopimelate Epimerase From Bacillus Anthracis
          Length = 308

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 22  SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 81

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 82  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 139

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 140 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 194

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 195 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 254

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 255 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 305


>gi|332528838|ref|ZP_08404812.1| diaminopimelate epimerase [Hylemonella gracilis ATCC 19624]
 gi|332041697|gb|EGI78049.1| diaminopimelate epimerase [Hylemonella gracilis ATCC 19624]
          Length = 302

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 142/289 (49%), Gaps = 16/289 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       + +     L+   + HF    DQI+ +       +D
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGQLGLNTAQYRWLA---DRHFGVGADQILSVRPSPAPGID 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG+EV+ CGNG RC  RF+  R   ++ S   +T+ G++  +   DG ++VD
Sbjct: 60  FEYVIHNADGAEVEQCGNGARCFARFVHDRGLSEKPSIRVQTLGGVIEPRITLDGRVTVD 119

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIG----PVN-HLFLRNPFVVSMGNPHAIFFVED 173
           MG PI D   +P  A     +D+   H      PV+      N  V+SMGNPHA+  V D
Sbjct: 120 MGAPIFDLVRVPFDAEGLTPLDQGNAHGAWQTWPVSVDGVPVNLAVLSMGNPHAVQIVAD 179

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    +   G  + +H  F   VN    +V + + + LR WERG G T ACG+ ACA+V
Sbjct: 180 -VDAAPVREQGPRIEQHARFPRRVNAGFMQVVARDRVKLRVWERGAGETLACGTGACAAV 238

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA   L      V V   GG L IEW +   V MTG A   + G++D+ 
Sbjct: 239 VAGIRLGLLEARVDVHTRGGVLTIEWSEGRPVLMTGPATTVFHGEIDVP 287


>gi|71905834|ref|YP_283421.1| diaminopimelate epimerase [Dechloromonas aromatica RCB]
 gi|123628370|sp|Q47JN0|DAPF_DECAR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71845455|gb|AAZ44951.1| diaminopimelate epimerase [Dechloromonas aromatica RCB]
          Length = 276

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 143/281 (50%), Gaps = 16/281 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F+KM G+GN  +V+D      +++ + +  L+   + HF    DQI+L+       +D  
Sbjct: 5   FSKMHGLGNDFVVLDGVRQSVSLSPEQLCYLA---DRHFGVGCDQILLVEKASQPGIDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC VRF+       ++    ET+RGI+  +   DG+++VDMG
Sbjct: 62  YRIFNADGGEVEQCGNGARCFVRFVHDEGLTDKREIRVETMRGIISPRLEGDGNVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    + +P    F   D    H+  V    L    VVSMGNPHA+  V D +    + 
Sbjct: 122 IP----RFLPAEIPFLAEDDVIIHLLDVADETLETS-VVSMGNPHAVQVV-DSVDTAPVG 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+ KHP F   VN    ++    ++ LR +ERG G T ACG+ ACA+VVA      
Sbjct: 176 EHGPLIEKHPRFPLRVNAGFMQIVDRHAIKLRVYERGSGETMACGTGACAAVVAGIRRGL 235

Query: 242 TNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
            +  V V   GG L I W  D   V MTG A   + G++++
Sbjct: 236 LDSPVRVTTRGGDLTIAWGGDERPVLMTGPAVTVFTGEIEL 276


>gi|303250998|ref|ZP_07337186.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|302650155|gb|EFL80323.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 274

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 138/283 (48%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T  S   ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKSLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 NLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 270


>gi|166368685|ref|YP_001660958.1| diaminopimelate epimerase [Microcystis aeruginosa NIES-843]
 gi|189082835|sp|B0JJ58|DAPF_MICAN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166091058|dbj|BAG05766.1| diaminopimelate epimerase [Microcystis aeruginosa NIES-843]
          Length = 281

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 149/288 (51%), Gaps = 21/288 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F K +G+GN  ++ID R   + + +  +     D   HF    D ++     Q A  D
Sbjct: 3   IPFTKYQGLGNDFILIDNRHSPEPLITAEMAVAMCDR--HFGIGADGVIFALPGQ-AETD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKR-----KSFTFETIRGILVAKENRDGSI 116
             +RI N DGSE + CGNG+RC+ +F+ +R++      +++   T+ G ++ +   +  +
Sbjct: 60  YTMRIFNSDGSEPEMCGNGIRCLAQFI-ARLEANNAIGRTYRIHTLAGTIIPRLEANEQV 118

Query: 117 SVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           +VDMG P L    IP  L +  +K+      +   + L       VSMGNPH + FV  D
Sbjct: 119 TVDMGPPQLLGSEIPTTLVKGSEKVLAVPLEVEGKDWLVT----CVSMGNPHCVTFV-GD 173

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           L    L + G     HP+F +  N+    V + + + +R WERG G+T ACG+ ACA VV
Sbjct: 174 LASIPLETIGPKFEHHPVFPQRTNVEFVEVIAPDYMKMRVWERGAGITLACGTGACAVVV 233

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           A+    K +R  +V++ GG L I W   +N V+MTG AK  +EG   I
Sbjct: 234 AALLTGKCDRRCTVELPGGCLQIHWSQTDNRVYMTGPAKAVFEGIYPI 281


>gi|254430557|ref|ZP_05044260.1| diaminopimelate epimerase [Cyanobium sp. PCC 7001]
 gi|197625010|gb|EDY37569.1| diaminopimelate epimerase [Cyanobium sp. PCC 7001]
          Length = 394

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/313 (31%), Positives = 146/313 (46%), Gaps = 29/313 (9%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHD---NITSDAINALSTDDNT---HFDQIMLIHDFQ-D 57
           M+ + K +G+GN  L++D RG  D   ++ ++A     TDD       ++I  + D +  
Sbjct: 1   MLQYCKYQGLGNDFLMVDGRGATDAATDVATEAATETPTDDTCLGLTPERIRRLCDRRFG 60

Query: 58  ASVDAFI-------------RIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFET 101
              D  I             RI N DGSE + CGNG+RC+ RFL      +  + +  ET
Sbjct: 61  IGADGLIVAAPPREGGELRMRIFNADGSEPEMCGNGIRCLARFLADSDGDLPGRRWQVET 120

Query: 102 IRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVS 161
           + G +V +   DGS+ VDMG+P L  + +P           +  +      F        
Sbjct: 121 LAGRIVPELQPDGSVRVDMGQPFLAPETVPTTLEIGDAGIPQGSLEAAGESFQVG--AAG 178

Query: 162 MGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGL 221
           MGNPH +  V D L   DL  FG  L  HP F    N+   +V +   L +R WERG G 
Sbjct: 179 MGNPHVVIPVPD-LEAVDLERFGAALEVHPAFPARTNVHFVQVLTPAHLVMRVWERGAGP 237

Query: 222 TAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           T ACG+ ACA++V    L    R+  + + GG L I W   ++HV+MTG A+  ++    
Sbjct: 238 TLACGTGACATLVVCHALGLAERSARLDLPGGPLQISWDPADDHVWMTGPAEAVFDAV-- 295

Query: 281 IKTGKWIKKNEDD 293
           I    W  +  DD
Sbjct: 296 IAPSLWDPEGVDD 308


>gi|294085379|ref|YP_003552139.1| diaminopimelate epimerase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664954|gb|ADE40055.1| Diaminopimelate epimerase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 293

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 145/288 (50%), Gaps = 21/288 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTH----FDQIMLIHDFQDAS 59
           M+ F KM G+GN  +++D R     I +D ++ A S   +       DQ+++I    +A 
Sbjct: 1   MITFLKMHGLGNDFVILDARDPDSGIGADISVRAASLVSDRRRGIGCDQLLIIRPSDNA- 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGS---I 116
            D F++I+N DGS   +CGNG RCV  ++   +       ET   +L A+ +R G    I
Sbjct: 60  -DIFMQILNQDGSVAGACGNGTRCVADYVMRDLDVDQLLIETKSTMLFAERSRIGDADLI 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           +V+MG   LDW+ +PLA++ D +  D     P   +        SMGNPHA+ FV DD+ 
Sbjct: 119 AVNMGAARLDWQQVPLAQAQDTLHVDLGADAPALAV------CQSMGNPHAVMFV-DDVA 171

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             DL + G  L    +F +  N+SI +        +R WER VG+T ACGS ACA  VA+
Sbjct: 172 AIDLDAIGPKLEHADIFPDRANISIVQKLDDAKFRMRVWERSVGITQACGSGACAVGVAA 231

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN----NHVFMTGEAKKEWEGKLD 280
                  R   + M GG ++IEW DN      V MTG       G LD
Sbjct: 232 HRRGLAGRLSEIVMDGGSVIIEWRDNGTAGGEVIMTGPVTYVGHGVLD 279


>gi|269103728|ref|ZP_06156425.1| diaminopimelate epimerase [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163626|gb|EEZ42122.1| diaminopimelate epimerase [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 276

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 142/278 (51%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + D +  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFMVVDAVTQNVFFSPDMVRRLADRHRGIGFDQLLIVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMLLKLENDDQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI D   IP     ++ ++          +F       SMGNPH +  V DD+   D+ +
Sbjct: 123 PIFDPAKIPFRA--NQAEKTYILRAGDQTVFCG---AASMGNPHCVTVV-DDVLTADVET 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN+   +V S   + LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNVGFMQVISRSEVKLRVYERGAGETQACGSGACAAVAIGRQQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKL 279
           +  V+V + GG L I W+ N +++FMTG     ++G++
Sbjct: 237 DEEVTVSLPGGDLRIRWNGNGSNLFMTGPVAHVFDGQV 274


>gi|207727618|ref|YP_002256012.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum MolK2]
 gi|206590857|emb|CAQ56469.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum MolK2]
          Length = 307

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 140/286 (48%), Gaps = 19/286 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      + T +   A++   + HF    DQ++L+       VD  
Sbjct: 20  FTKMHGAGNDFVVLDGIETPIDFTPEQWRAIA---DRHFGVGADQLLLVERATRPDVDFR 76

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG
Sbjct: 77  YRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVTVDMG 136

Query: 122 EPILDWKLIPLAR---SFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLY 176
            P+ +   +P            RD  H   VN    R  ++  VSMGNPHA+  V DD  
Sbjct: 137 APVFEAARLPFVPDGLPTRVEGRDAQHALQVND---RTAWLSTVSMGNPHAVQVV-DDAE 192

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 193 AFPVLEDGPLIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVAG 252

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V V   GGGL I W  +   V MTG A   +EG LD+
Sbjct: 253 IRRGLLDSPVKVATHGGGLTIAWAGEGEPVMMTGPATTVFEGTLDL 298


>gi|83745969|ref|ZP_00943025.1| Diaminopimelate epimerase [Ralstonia solanacearum UW551]
 gi|207742011|ref|YP_002258403.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum IPO1609]
 gi|83727363|gb|EAP74485.1| Diaminopimelate epimerase [Ralstonia solanacearum UW551]
 gi|206593397|emb|CAQ60324.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum IPO1609]
          Length = 307

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 140/286 (48%), Gaps = 19/286 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      + T +   A++   + HF    DQ++L+       VD  
Sbjct: 20  FTKMHGAGNDFVVLDGIETPIDFTPEQWRAIA---DRHFGVGADQLLLVERSTRPDVDFR 76

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG
Sbjct: 77  YRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVTVDMG 136

Query: 122 EPILDWKLIPLAR---SFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLY 176
            P+ +   +P            RD  H   VN    R  ++  VSMGNPHA+  V DD  
Sbjct: 137 APVFEAARLPFVPDGLPTRVEGRDAQHALQVND---RTAWLSTVSMGNPHAVQVV-DDTE 192

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 193 AFPVLEDGPLIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVAG 252

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V V   GGGL I W  +   V MTG A   +EG LD+
Sbjct: 253 IRRGLLDSPVKVATHGGGLTIAWAGEGEPVMMTGPATTVFEGTLDL 298


>gi|30264977|ref|NP_847354.1| diaminopimelate epimerase [Bacillus anthracis str. Ames]
 gi|49187796|ref|YP_031049.1| diaminopimelate epimerase [Bacillus anthracis str. Sterne]
 gi|50196964|ref|YP_052652.1| diaminopimelate epimerase [Bacillus anthracis str. 'Ames Ancestor']
 gi|52140590|ref|YP_086240.1| diaminopimelate epimerase [Bacillus cereus E33L]
 gi|165870848|ref|ZP_02215500.1| diaminopimelate epimerase [Bacillus anthracis str. A0488]
 gi|167634949|ref|ZP_02393267.1| diaminopimelate epimerase [Bacillus anthracis str. A0442]
 gi|167639995|ref|ZP_02398263.1| diaminopimelate epimerase [Bacillus anthracis str. A0193]
 gi|170685806|ref|ZP_02877029.1| diaminopimelate epimerase [Bacillus anthracis str. A0465]
 gi|170706937|ref|ZP_02897394.1| diaminopimelate epimerase [Bacillus anthracis str. A0389]
 gi|177652291|ref|ZP_02934794.1| diaminopimelate epimerase [Bacillus anthracis str. A0174]
 gi|190567303|ref|ZP_03020218.1| diaminopimelate epimerase [Bacillus anthracis Tsiankovskii-I]
 gi|196040444|ref|ZP_03107744.1| diaminopimelate epimerase [Bacillus cereus NVH0597-99]
 gi|227817708|ref|YP_002817717.1| diaminopimelate epimerase [Bacillus anthracis str. CDC 684]
 gi|228988182|ref|ZP_04148279.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229603550|ref|YP_002869180.1| diaminopimelate epimerase [Bacillus anthracis str. A0248]
 gi|254687270|ref|ZP_05151127.1| diaminopimelate epimerase [Bacillus anthracis str. CNEVA-9066]
 gi|254725282|ref|ZP_05187065.1| diaminopimelate epimerase [Bacillus anthracis str. A1055]
 gi|254735393|ref|ZP_05193101.1| diaminopimelate epimerase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254740660|ref|ZP_05198351.1| diaminopimelate epimerase [Bacillus anthracis str. Kruger B]
 gi|254753078|ref|ZP_05205114.1| diaminopimelate epimerase [Bacillus anthracis str. Vollum]
 gi|254761420|ref|ZP_05213441.1| diaminopimelate epimerase [Bacillus anthracis str. Australia 94]
 gi|81685654|sp|Q632C7|DAPF_BACCZ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|81715620|sp|Q81XR2|DAPF_BACAN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767089|sp|C3PDH0|DAPF_BACAA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767090|sp|C3LC72|DAPF_BACAC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|30259654|gb|AAP28840.1| diaminopimelate epimerase [Bacillus anthracis str. Ames]
 gi|49181723|gb|AAT57099.1| diaminopimelate epimerase [Bacillus anthracis str. Sterne]
 gi|50083026|gb|AAT70160.1| diaminopimelate epimerase [Bacillus anthracis str. 'Ames Ancestor']
 gi|51974059|gb|AAU15609.1| diaminopimelate epimerase [Bacillus cereus E33L]
 gi|164713357|gb|EDR18882.1| diaminopimelate epimerase [Bacillus anthracis str. A0488]
 gi|167512076|gb|EDR87454.1| diaminopimelate epimerase [Bacillus anthracis str. A0193]
 gi|167529699|gb|EDR92448.1| diaminopimelate epimerase [Bacillus anthracis str. A0442]
 gi|170128040|gb|EDS96910.1| diaminopimelate epimerase [Bacillus anthracis str. A0389]
 gi|170670270|gb|EDT21010.1| diaminopimelate epimerase [Bacillus anthracis str. A0465]
 gi|172082297|gb|EDT67363.1| diaminopimelate epimerase [Bacillus anthracis str. A0174]
 gi|190561807|gb|EDV15777.1| diaminopimelate epimerase [Bacillus anthracis Tsiankovskii-I]
 gi|196028576|gb|EDX67183.1| diaminopimelate epimerase [Bacillus cereus NVH0597-99]
 gi|227005634|gb|ACP15377.1| diaminopimelate epimerase [Bacillus anthracis str. CDC 684]
 gi|228771479|gb|EEM19948.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229267958|gb|ACQ49595.1| diaminopimelate epimerase [Bacillus anthracis str. A0248]
          Length = 288

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|238793578|ref|ZP_04637202.1| Diaminopimelate epimerase [Yersinia intermedia ATCC 29909]
 gi|238727168|gb|EEQ18698.1| Diaminopimelate epimerase [Yersinia intermedia ATCC 29909]
          Length = 274

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 140/278 (50%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D  +D  
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLA-DRHTGVGFDQMLVVEPPYDPELDFH 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MG
Sbjct: 60  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EP  D + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+   ++
Sbjct: 120 EPNFDPQTVP----FRATKAEKTYILRAAEHTVLCG--VVSMGNPHCVMQV-DDVSVANV 172

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V       
Sbjct: 173 ALLGPVLESHERFPERANIGFMQVVSREQIRLRVYERGAGETQACGSGACAAVAVGIQQE 232

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                V V++ GG L I W    H ++MTG A   ++G
Sbjct: 233 LLAEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 270


>gi|319764398|ref|YP_004128335.1| diaminopimelate epimerase [Alicycliphilus denitrificans BC]
 gi|317118959|gb|ADV01448.1| diaminopimelate epimerase [Alicycliphilus denitrificans BC]
          Length = 292

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 141/295 (47%), Gaps = 26/295 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +T      L+   + HF    DQI+ +       +D
Sbjct: 3   IRFTKMQGAGNDFVVLDETRERLGLTPAQYRFLA---DRHFGVGADQILTVRPSPAEGID 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG +VQ CGNG RC  R++  +    +     +T+ G++  +   DG ++VD
Sbjct: 60  FEYLIHNADGGQVQQCGNGARCFARYVRDKGLTAKDRIRVQTMAGVIAPELTADGRVTVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFL----RNP------FVVSMGNPHAIF 169
           MG P+LD   +P    FD         G V    L    + P        VSMGNPHA+ 
Sbjct: 120 MGRPVLDPARLP----FDTAGLVPVPQGSVKKWPLALDGKAPQATVMIVAVSMGNPHAVQ 175

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
            V DD+    +A  G L+  HP F + VN    +V     + LR +ERG G T ACG+ A
Sbjct: 176 LV-DDVDSAPVARTGPLIEGHPRFPQRVNAGYLQVVGRTEVRLRVYERGAGETLACGTGA 234

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           CA+VVA   L   +  V V   GG L I W     + VFMTG A   +EG++DI 
Sbjct: 235 CAAVVAGIGLGLLDARVDVHTRGGLLTIAWAGGLQDPVFMTGPATTVFEGQIDIP 289


>gi|320529829|ref|ZP_08030906.1| diaminopimelate epimerase [Selenomonas artemidis F0399]
 gi|320137847|gb|EFW29752.1| diaminopimelate epimerase [Selenomonas artemidis F0399]
          Length = 287

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 143/287 (49%), Gaps = 21/287 (7%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQD 57
           Q   ++F K +G GN  +V+D     D    D         + HF    D +M++     
Sbjct: 5   QGKTMEFTKWQGCGNDFVVVDFL---DREPVDFAALAVRMCDRHFGIGADGLMVV--LPS 59

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAK----EN 111
            + D  +R  N DG+E + CGNG+RC  R+L    R++++ FT ET+ GI+  +    + 
Sbjct: 60  ETADIRMREFNPDGTEPEMCGNGIRCFARYLYEYGRIEKEQFTIETLAGIMTPRILIEDG 119

Query: 112 RDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV-VSMGNPHAIFF 170
           +  ++ VDMG P+L    IP+ R F     +R    P+           VSMGNPHA+ F
Sbjct: 120 KVTAVEVDMGVPVLTGDDIPV-RGFGT---ERVIAVPITVAGEEYKMTCVSMGNPHAVIF 175

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V DD  H+ LA  G     H +F   +N     V       +R WERG G+T ACG+  C
Sbjct: 176 V-DDAEHFPLAELGAQFENHELFPRKINTEFVEVKDRSHARMRVWERGAGITLACGTGTC 234

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           A++ A       +RA  +++ GG + +EW ++ H+FMTG A+  + G
Sbjct: 235 ATLTAGVLTGVLDRAADIEVDGGVIRVEWREDGHIFMTGPAEPVFTG 281


>gi|49481006|ref|YP_038958.1| diaminopimelate epimerase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|196032886|ref|ZP_03100299.1| diaminopimelate epimerase [Bacillus cereus W]
 gi|196043802|ref|ZP_03111039.1| diaminopimelate epimerase [Bacillus cereus 03BB108]
 gi|206976422|ref|ZP_03237329.1| diaminopimelate epimerase [Bacillus cereus H3081.97]
 gi|217962402|ref|YP_002340974.1| diaminopimelate epimerase [Bacillus cereus AH187]
 gi|225866910|ref|YP_002752288.1| diaminopimelate epimerase [Bacillus cereus 03BB102]
 gi|81613513|sp|Q6HBW8|DAPF_BACHK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724205|sp|B7HUS8|DAPF_BACC7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767091|sp|C1EX98|DAPF_BACC3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|49332562|gb|AAT63208.1| diaminopimelate epimerase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|195994315|gb|EDX58270.1| diaminopimelate epimerase [Bacillus cereus W]
 gi|196025138|gb|EDX63808.1| diaminopimelate epimerase [Bacillus cereus 03BB108]
 gi|206745346|gb|EDZ56746.1| diaminopimelate epimerase [Bacillus cereus H3081.97]
 gi|217064842|gb|ACJ79092.1| diaminopimelate epimerase [Bacillus cereus AH187]
 gi|225789422|gb|ACO29639.1| diaminopimelate epimerase [Bacillus cereus 03BB102]
          Length = 288

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHGVYEYK 285


>gi|90019886|ref|YP_525713.1| diaminopimelate epimerase [Saccharophagus degradans 2-40]
 gi|123396771|sp|Q21P78|DAPF_SACD2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|89949486|gb|ABD79501.1| diaminopimelate epimerase [Saccharophagus degradans 2-40]
          Length = 277

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 136/281 (48%), Gaps = 15/281 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  ++ID       IT +    L+   + HF    DQ++++        D  
Sbjct: 5   FTKMHGLGNDFVMIDAISQRVTITPERARQLA---DRHFGVGCDQVLVVETPDSPDADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV++CGNG RC   F+  R    +   T ET  G +V     D  ++VDMG
Sbjct: 62  YRIFNHDGSEVENCGNGARCFAVFVRQRGLTAKSVITVETAVGRMVLHVQEDDQVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PIL    IPLA       +   +  P           VSMGNPHA++ V +D     + 
Sbjct: 122 APILSPADIPLAAP----QQATSYTLPTQGAGDITIGAVSMGNPHAVYCV-NDCKTAPVE 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  +  HP F + VN    +V S   ++LR +ERG G T ACG+ ACA+VVA      
Sbjct: 177 TLGPEIEAHPHFPKKVNAGFMQVVSPSEINLRVYERGAGETLACGTGACAAVVAGRLQGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V V + GG L I W   ++ V MTG A   + G++ I
Sbjct: 237 LENTVKVNLPGGSLSITWEGVDSPVMMTGPATTVFHGQVKI 277


>gi|307262015|ref|ZP_07543670.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306868298|gb|EFN00120.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 279

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 140/288 (48%), Gaps = 24/288 (8%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M  + + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  
Sbjct: 1   MIGNNMQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPE 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + 
Sbjct: 61  LDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVR 120

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFF 170
           V+MGEPI +   +P  A  F+K            +  LR         VVSMGNPH +  
Sbjct: 121 VNMGEPIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQ 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           VED +    +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC
Sbjct: 169 VED-INLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +V         +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GAVAVGIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 275


>gi|56964698|ref|YP_176429.1| diaminopimelate epimerase [Bacillus clausii KSM-K16]
 gi|56910941|dbj|BAD65468.1| diaminopimelate epimerase [Bacillus clausii KSM-K16]
          Length = 282

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 145/285 (50%), Gaps = 30/285 (10%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH---DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           ++F KM G+GN  + I++   H   + +   A+     +     D ++LI      ++  
Sbjct: 1   MEFTKMHGLGNSYIYINLFKEHLPEERLAETAVWLADPNRGIGSDGMILIGPSTSCAIK- 59

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA-----KENRDGS 115
            +RI N DGSE ++CGNG+RCV ++      +  K+F+ ET+ G + A     +E R G+
Sbjct: 60  -MRIFNNDGSEAKNCGNGLRCVAKYSYEHGLVHEKAFSIETLGGPVFATVEVDEEGRVGA 118

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR------NPFVVSMGNPHAIF 169
           ++++MG+P L  + IP+    DK         PV    L           VSMGNPHA+ 
Sbjct: 119 VAINMGQPRLTRQAIPMIGEGDK---------PVVGEKLEANGETVQVTAVSMGNPHAVM 169

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           FVE  +    + S G ++ KH  F + VN     V S   L  R WERG G+T ACG+ A
Sbjct: 170 FVEQ-IEKAPVESLGPVIEKHSAFPDWVNAEWVEVVSETELHFRVWERGSGITQACGTGA 228

Query: 230 CASVVAS--GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
           CA+VVAS      K    V+V +LGG L I W +N  V M G A+
Sbjct: 229 CAAVVASVLNGYAKQGVPVTVHLLGGDLTIVWQENGDVLMRGPAE 273


>gi|300705469|ref|YP_003747072.1| diaminopimelate epimerase [Ralstonia solanacearum CFBP2957]
 gi|299073133|emb|CBJ44491.1| diaminopimelate epimerase [Ralstonia solanacearum CFBP2957]
          Length = 292

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 140/286 (48%), Gaps = 19/286 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      + T +   A++   + HF    DQ++L+       VD  
Sbjct: 5   FTKMHGAGNDFVVLDGIETPIDFTPEQWRAIA---DRHFGVGADQLLLVERSTRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG
Sbjct: 62  YRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVTVDMG 121

Query: 122 EPILDWKLIPLAR---SFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLY 176
            P+ +   +P            RD  H   VN    R  ++  VSMGNPHA+  V DD  
Sbjct: 122 APVFEAARLPFVPDGLPTRVEGRDAQHALQVNG---RTAWLSTVSMGNPHAVQVV-DDTE 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 178 AFPVLEDGPLIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVAG 237

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V V   GGGL I W  +   V MTG A   +EG LD+
Sbjct: 238 IRRGLLDSPVKVATHGGGLTIAWAGEGEPVMMTGPATTVFEGTLDL 283


>gi|119776381|ref|YP_929121.1| diaminopimelate epimerase [Shewanella amazonensis SB2B]
 gi|166225753|sp|A1SAP5|DAPF_SHEAM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|119768881|gb|ABM01452.1| diaminopimelate epimerase [Shewanella amazonensis SB2B]
          Length = 275

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 151/284 (53%), Gaps = 16/284 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIHFTKMHGLGNDFMVVD--GVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDG ++V+
Sbjct: 59  FHYRIFNADGSEVEQCGNGARCFARFVRNKGLTQKHKIKVSTSAGKMTLRLERDGGVTVN 118

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG PILD   IP  A+ F+K     + +      FL     VSMGNPH +  V DD+   
Sbjct: 119 MGVPILDPAQIPFKAKKFEKT----YLLQSAQQTFLCG--AVSMGNPHVVLEV-DDITQA 171

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +A  G  L +H  F +GVN+   +V + + + LR +ERG   T ACGS ACA+ V    
Sbjct: 172 PVADVGAQLTRHERFPKGVNVGFMQVVAPDHIKLRVYERGAAETLACGSGACAAAVVGQL 231

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
             K    V V + GG L I W  +   ++MTG A++ ++G++ +
Sbjct: 232 QGKLGSRVRVDLPGGSLTINWEGEGKPLWMTGPAQQVYDGQIQL 275


>gi|188590966|ref|YP_001795566.1| diaminopimelate epimerase [Cupriavidus taiwanensis LMG 19424]
 gi|229807504|sp|B2AGE5|DAPF_CUPTR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|170937860|emb|CAP62844.1| diaminopimelate epimerase [Cupriavidus taiwanensis LMG 19424]
          Length = 288

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 146/288 (50%), Gaps = 23/288 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           F KM G GN  +V+D  G H  I  T     AL++    HF    DQI+++       VD
Sbjct: 5   FTKMHGAGNDFVVLD--GIHQQIDLTPAQWRALAS---RHFGVGADQILIVEKPTRPDVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI+N DGSEV+ CGNG RC VRF+T +    ++S   E + G++      DG ++VD
Sbjct: 60  FRYRIVNADGSEVEHCGNGARCFVRFVTEQGMTDKRSVRVEVMNGVITLTLQDDGQVTVD 119

Query: 120 MGEPILDWKLIPL-ARSFDKMDR--DRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDD 174
           MG P L+   +P  A+         D  +   VN    R  ++  VSMGNPHA+  V DD
Sbjct: 120 MGAPELEPARVPFRAQGLPTHAEGADALYGLEVNG---RTEWISAVSMGNPHAVQVV-DD 175

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           + ++ +   G ++  HP F   VN    +V    ++ LR +ERG G T ACG+ ACA+VV
Sbjct: 176 VENFPVLQDGPVIEHHPAFPNRVNAGFMQVVDRHAIRLRVYERGAGETLACGTGACAAVV 235

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
           A       +  V V   GG L I W      V MTG A   +EG +D+
Sbjct: 236 AGIRRGLLDSPVRVHTHGGELTIAWDGGAEPVRMTGPATTVFEGSIDL 283


>gi|312792704|ref|YP_004025627.1| diaminopimelate epimerase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312179844|gb|ADQ40014.1| diaminopimelate epimerase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 278

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 149/287 (51%), Gaps = 30/287 (10%)

Query: 8   FAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +VID RG  D +  S A            D ++L+ D + A  D  +RI
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNSLAKRMCHRHIGVGADGLLLVLDSKLA--DIRMRI 60

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE--NRDG---SISVD 119
           IN DGSE + CGNG+RC  +++  R  +K+  F  ET+ GI+  +   N  G    + V+
Sbjct: 61  INSDGSEAEMCGNGIRCFSKYVFERGIVKKDKFKVETLAGIIEPELILNEYGLVEKVKVN 120

Query: 120 MGEPILDWKLIPLARSFD--------KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           MG+P    K IP+    D        ++D   + I  +            MG PH + FV
Sbjct: 121 MGKPSFKRKDIPMQGEPDSDAINTSIEVDGKEYKITSL-----------LMGVPHTVLFV 169

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+   D+ + G  + +H +F    N++  +V    ++ +RTWERG G T ACG+ +CA
Sbjct: 170 -DDVEKVDIYTLGPKIERHEVFPRKTNVNFVQVIDKNNIKVRTWERGAGATYACGTGSCA 228

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           SV+AS     T R  +V +  G L IEW ++  VFMTG A++ + G+
Sbjct: 229 SVIASNLNGYTERKANVHLYFGTLEIEWQEDGTVFMTGPAEEVFVGE 275


>gi|225175575|ref|ZP_03729569.1| Diaminopimelate epimerase [Dethiobacter alkaliphilus AHT 1]
 gi|225168904|gb|EEG77704.1| Diaminopimelate epimerase [Dethiobacter alkaliphilus AHT 1]
          Length = 290

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 140/283 (49%), Gaps = 22/283 (7%)

Query: 8   FAKMEGIGNKILVI-DMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +++ D      N    A+   + +     D + L+   + A+    +RI
Sbjct: 3   FTKMHGLGNDFVIVEDFDLGLTNYAELAMGLCNRNFGIGADGLALLQPSEQAAFR--VRI 60

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGI----------LVAKENRDGSI 116
            N DGSE + CGN +RC  ++L      K  T ET+  +          L   +    S+
Sbjct: 61  FNPDGSEAELCGNLLRCAGKYLYE----KGHTGETVIPVEMYDKIKVLRLAVTDGVVQSV 116

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEPIL+  L+P+A    +   +   +      F+     VSMGNPH + FV D+  
Sbjct: 117 EVDMGEPILESDLVPVAGKRRQAVNE--EVTASGEKFVMT--AVSMGNPHCVIFV-DETA 171

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L ++G  L  HP F +  N+    V S +    R WERG G T ACGS ACA +VA 
Sbjct: 172 AVPLETWGPALEAHPDFPKKTNVEFVEVRSRDEAAFRVWERGAGATLACGSGACAVLVAG 231

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
               K NR  ++ + GG L IEW D+NHV+MTG A + + G+L
Sbjct: 232 VLSDKLNRKATLHLPGGSLEIEWRDDNHVYMTGPAAEVFRGEL 274


>gi|307248575|ref|ZP_07530590.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306854925|gb|EFM87113.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
          Length = 279

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 140/288 (48%), Gaps = 24/288 (8%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M  + + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  
Sbjct: 1   MIGNNMQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPE 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + 
Sbjct: 61  LDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVR 120

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFF 170
           V+MGEPI +   +P  A  F+K            +  LR         VVSMGNPH +  
Sbjct: 121 VNMGEPIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQ 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           VED +    +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC
Sbjct: 169 VED-INLAPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +V         +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GAVAVGIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 275


>gi|114769927|ref|ZP_01447537.1| diaminopimelate epimerase [alpha proteobacterium HTCC2255]
 gi|114549632|gb|EAU52514.1| diaminopimelate epimerase [alpha proteobacterium HTCC2255]
          Length = 280

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 145/278 (52%), Gaps = 21/278 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           V F KM G+GN  ++ID R     + +     +    + HF    DQ+++I   + A V+
Sbjct: 11  VPFLKMHGLGNDFVIIDARESESPVNAQIAKVIG---DRHFGVGYDQLVVITKSKKADVE 67

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
             +   N DGS   +CGN  RCV + +      +  T +T  G+LVA++ ++  ISV+MG
Sbjct: 68  --VVFWNSDGSLSDACGNASRCVAKLIMDENNIEEITLKTGSGVLVAQKGQNDLISVNMG 125

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P LDW +IPL    D ++       P+      +P  V +GNPH +F V DD+   DL 
Sbjct: 126 HPQLDWDVIPLKEKVDLIEL------PIEG----SPGAVGIGNPHCVFVV-DDVNSVDLI 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S+G+ +  H +F +  N+   ++   +++  RT+ERG G T ACGS ACA  V +     
Sbjct: 175 SWGSKIETHELFPKKTNVEFIQIIDQKNIRQRTFERGAGETLACGSGACAVAVVAHLKGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           T R VSV + GG L I W  +  ++MTG     ++G L
Sbjct: 235 TERNVSVHLDGGELNINWAKDG-IWMTGPTTLVFKGVL 271


>gi|294340801|emb|CAZ89196.1| Diaminopimelate epimerase (DAP epimerase) [Thiomonas sp. 3As]
          Length = 287

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 144/287 (50%), Gaps = 15/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           V F KM G GN  +V+D       +++  +  L+   + HF    DQI+L+       VD
Sbjct: 3   VAFTKMHGAGNDFVVLDATRAPLALSAAQLRLLA---DRHFGVGADQILLVEAAPSPEVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC V ++  +    ++    +T+ G++  +   DG ++VD
Sbjct: 60  FGYRIFNADGGEVEQCGNGARCFVAYVHGKGLTAKRRIRVQTLSGLIEPELQPDGRVTVD 119

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF-VVSMGNPHAIFFVEDDLYH 177
           MG P+ D   +P  A        D +   P++ +       V+SMGNPHA+  V DD+  
Sbjct: 120 MGAPVFDLPRVPFEAHGLRPRQVDGWEQWPLDLVGATAWVSVLSMGNPHAVQRV-DDVDT 178

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             + S G L+  HP F   VN    ++   + + LR WERG G T ACG+ ACA+VVA G
Sbjct: 179 APVLSHGPLIEHHPRFPRRVNAGFMQIVDAQHIRLRVWERGAGETLACGTGACAAVVA-G 237

Query: 238 CLHK-TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIK 282
             H     AV V+  GG L I W      V MTG A   ++G +D+ 
Sbjct: 238 LRHGWLQGAVDVQTHGGELTISWAGAGQPVRMTGPAAFVFDGTIDLP 284


>gi|153852916|ref|ZP_01994353.1| hypothetical protein DORLON_00335 [Dorea longicatena DSM 13814]
 gi|149754558|gb|EDM64489.1| hypothetical protein DORLON_00335 [Dorea longicatena DSM 13814]
          Length = 282

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 149/286 (52%), Gaps = 23/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+G+GN  + ++   C +    +         + HF    D +++I+  + A  D  
Sbjct: 3   FTKMQGLGNDYVYVN---CFEEKIENPPAVARYVSDRHFGIGSDGLIMINPSEVA--DFE 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DGS  + CGNG+RCV +++       +   + ET+ GI    L  ++ +   + 
Sbjct: 58  MEMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTQISVETLGGIKYLDLTVEDGKVVLVK 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           VDMG+P L   LIP+    +K+  +   + G V H+       VSMGNPH + +V DD+ 
Sbjct: 118 VDMGKPELKSDLIPIISENEKVIDEPIEVDGQVYHMTG-----VSMGNPHTVIYV-DDVK 171

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
           + DL   G     H  F + +N          ++++R WERG G T ACG+ ACA  VAS
Sbjct: 172 NLDLEKIGPKFENHERFPKRINTEFVHCIDRNTVEMRVWERGSGETLACGTGACAVAVAS 231

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
              + T+  V+VK+LGG L IEW    NHVFMTG AK  ++G +DI
Sbjct: 232 ILNNLTDTRVTVKLLGGDLQIEWDQKKNHVFMTGPAKVVFDGVIDI 277


>gi|330826619|ref|YP_004389922.1| diaminopimelate epimerase [Alicycliphilus denitrificans K601]
 gi|329311991|gb|AEB86406.1| Diaminopimelate epimerase [Alicycliphilus denitrificans K601]
          Length = 292

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 141/295 (47%), Gaps = 26/295 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +T      L+   + HF    DQI+ +       +D
Sbjct: 3   IRFTKMQGAGNDFVVLDETRERLGLTPAQYRFLA---DRHFGVGADQILTVRPSPAEGID 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG +VQ CGNG RC  R++  +    +     +T+ G++  +   DG ++VD
Sbjct: 60  FEYLIHNADGGQVQQCGNGARCFARYVRDKGLTAKDRIRVQTMAGVIAPELTADGRVTVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFL----RNP------FVVSMGNPHAIF 169
           MG P+LD   +P    FD         G V    L    + P        VSMGNPHA+ 
Sbjct: 120 MGRPVLDPARLP----FDTAGLVPVPQGSVKKWPLALDGQAPQATVMIVAVSMGNPHAVQ 175

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
            V DD+    +A  G L+  HP F + VN    +V     + LR +ERG G T ACG+ A
Sbjct: 176 LV-DDVDSAPVARTGPLIEGHPRFPQRVNAGYLQVVGRTEVRLRVYERGAGETLACGTGA 234

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           CA+VVA   L   +  V V   GG L I W     + VFMTG A   +EG++DI 
Sbjct: 235 CAAVVAGIGLGLLDARVDVHTRGGLLTIAWAGGLQDPVFMTGPATTVFEGQIDIP 289


>gi|238763613|ref|ZP_04624573.1| Diaminopimelate epimerase [Yersinia kristensenii ATCC 33638]
 gi|238698091|gb|EEP90848.1| Diaminopimelate epimerase [Yersinia kristensenii ATCC 33638]
          Length = 274

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 137/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  D + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+   ++A
Sbjct: 121 PNFDPQAVP----FRATKAEKTYIFRAAEHTVLCG--VVSMGNPHCVMQV-DDVSVANVA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQEL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
               V V++ GG L I W    H ++MTG A   ++G
Sbjct: 234 LGEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 270


>gi|229163916|ref|ZP_04291856.1| Diaminopimelate epimerase [Bacillus cereus R309803]
 gi|228619537|gb|EEK76423.1| Diaminopimelate epimerase [Bacillus cereus R309803]
          Length = 288

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 151/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L  + IP L        R+ F     NH +      VSMGNPHA+ FVED
Sbjct: 120 LAKIDMGAPRLTREEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFVED 175

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 176 -VEEAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|119943833|ref|YP_941513.1| diaminopimelate epimerase [Psychromonas ingrahamii 37]
 gi|166225746|sp|A1SQZ9|DAPF_PSYIN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|119862437|gb|ABM01914.1| diaminopimelate epimerase [Psychromonas ingrahamii 37]
          Length = 275

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 152/280 (54%), Gaps = 11/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  ++ D I+ L+  +    FDQ+++I    D  +D   
Sbjct: 3   IQFSKMHGLGNDFMVIDNVTQNVFLSKDTISRLADRNFGIGFDQLLMIEPPYDPELDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +   +++     T +G +  K   DG+I+VDMG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKMKGLTQKRIINVSTAKGKIQLKIEHDGNITVDMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPV-NHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           PIL+   +P    F+    ++ +I  V +H  L    VVS+GNPH +  V DD+ +  + 
Sbjct: 123 PILEPAKVP----FEAQKEEKTYILRVEDHTVLCG--VVSIGNPHCVVLV-DDIDNAPVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F   VN+    + S +   LR WERGVG T ACG+ ACA+ V      K
Sbjct: 176 TLGPLLENHERFPNKVNVGFLEIKSRDHARLRVWERGVGETLACGTGACAAAVVGQLQDK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            N   ++++ GG L + W     V MTG A   ++G++ I
Sbjct: 236 LNPHCTIELPGGELRLFWQPGQSVKMTGTADFVFDGQIQI 275


>gi|219116604|ref|XP_002179097.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217409864|gb|EEC49795.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 334

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 146/301 (48%), Gaps = 25/301 (8%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS- 59
           +++  V F+K  G+GN  ++ID R   +   +   +A+    N       +I   Q  S 
Sbjct: 39  LEARKVPFSKYHGLGNDFILIDDRDKSEPSLTPEESAMLCHRNFGIGGDGVIFALQPPSE 98

Query: 60  ------VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS----FTFETIRGILVAK 109
                  D  +RI N DGSE + CGNG+RC+ +FL    + KS    +   T+ G +V  
Sbjct: 99  SGDGADFDFTMRIYNSDGSEPEMCGNGIRCMAQFLKDLGESKSDDGAYQIHTLAGRIVPV 158

Query: 110 ENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNP-----FVVSMGN 164
            N DG+I+VDMGEP L+   +P       ++ +  H   V      N        V MGN
Sbjct: 159 MNEDGTITVDMGEPFLEAAKVPTT-----LEANAEHDSVVEQTLEANGKTWKCTAVGMGN 213

Query: 165 PHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAA 224
           PHAIFFV D     D    G  L  H  F    N+   +V   + L ++ WERG G T A
Sbjct: 214 PHAIFFVNDLEKDIDFEKDGPALEAHESFPAKTNVEFVQVKGDDHLIMKVWERGAGPTLA 273

Query: 225 CGSAACASVVA---SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           CG+ ACA  VA   +G + + ++ V V + GG L IEW + +N ++MTG A   + G+  
Sbjct: 274 CGTGACALTVAAMRAGKIPRGDQPVRVTLPGGDLWIEWRESDNKIYMTGPATFAFAGETK 333

Query: 281 I 281
           +
Sbjct: 334 V 334


>gi|298369275|ref|ZP_06980593.1| diaminopimelate epimerase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283278|gb|EFI24765.1| diaminopimelate epimerase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 282

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 141/287 (49%), Gaps = 21/287 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASVDA 62
           + F KM G+GN  +VID  G +           +  D      FDQ++L+       VD 
Sbjct: 4   LKFTKMHGLGNDFMVID--GINQTFEPKEAPLSAWSDRFRGVGFDQLLLVERPSSELVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DG EV  CGNG RC VRF+T +    +K    ET  G++V +   +G ++V+M
Sbjct: 62  RYRIFNADGGEVGQCGNGARCFVRFVTDKGLTDKKEILVETAGGVIVPRLLENGLVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRN----PF-VVSMGNPHAIFFVEDDL 175
           G+P      IP      + D D      + H+ L      P   V+MGNPHA+  VED  
Sbjct: 122 GQPRFMPSEIPFVPDSGE-DSDA-----LTHIILVGLESVPVSCVNMGNPHAVIIVEDT- 174

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +  +G  +  H  F E VN+   ++ +   + LR +ERG G T ACG+ ACA+VVA
Sbjct: 175 ETAPVGQWGEAIESHEQFPERVNVGFMQIINRREIRLRVYERGTGETQACGTGACAAVVA 234

Query: 236 SGCLHKTNRAVSVKML--GGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              L   +   SVK++  GG L I W     V MTG A+  +EG+L 
Sbjct: 235 GVRLGLLDAGESVKVMLPGGDLFISWAPEGGVMMTGPAETVFEGELQ 281


>gi|307823077|ref|ZP_07653307.1| diaminopimelate epimerase [Methylobacter tundripaludum SV96]
 gi|307735852|gb|EFO06699.1| diaminopimelate epimerase [Methylobacter tundripaludum SV96]
          Length = 275

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 141/282 (50%), Gaps = 12/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +VID    H ++T + I  +S       FDQ++LI    +A+ D  
Sbjct: 1   MINFTKMHGLGNDFVVIDAINQHIDLTPEQIRLMSDRHFGIGFDQLLLIEKAVNANADFK 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV  CGNG RC  RF+  +    +     +T  G L+ + + D  I+V+MG
Sbjct: 61  YRIFNADGGEVAQCGNGARCFARFVRDKKLSDKNEICVDTNSGQLLLRFDADNLITVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF-VVSMGNPHAIFFVEDDLYHYDL 180
            P      IPL       +  RF+   VN       F  VSMGNPHA+  V D +    +
Sbjct: 121 IPRHAPAEIPLLAE----EESRFYTVLVNET--EKAFGAVSMGNPHAVIQVTD-VKTAPV 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G  L  H  F E VN+   +V   + + LR +ERG   T ACGS ACA+VV     +
Sbjct: 174 AELGKALESHTFFPERVNVGFMQVVDRQHIKLRVYERGAAETLACGSGACAAVVIGIEHN 233

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             +  VSV + GG L I W      V MTG A   +EG++ +
Sbjct: 234 LLDHTVSVDLPGGTLSINWLGRGEPVLMTGPAISVFEGQITL 275


>gi|46143537|ref|ZP_00135025.2| COG0253: Diaminopimelate epimerase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208995|ref|YP_001054220.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae L20]
 gi|307246450|ref|ZP_07528523.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307255433|ref|ZP_07537240.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307259885|ref|ZP_07541599.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|166224236|sp|A3N2H9|DAPF_ACTP2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|126097787|gb|ABN74615.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|306852654|gb|EFM84886.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306861617|gb|EFM93604.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306866055|gb|EFM97929.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 274

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 138/283 (48%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 NLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 270


>gi|91774552|ref|YP_544308.1| diaminopimelate epimerase [Methylobacillus flagellatus KT]
 gi|91708539|gb|ABE48467.1| diaminopimelate epimerase [Methylobacillus flagellatus KT]
          Length = 290

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 143/282 (50%), Gaps = 10/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  +V+D      ++ +D I  L+       FDQ++L+       VD   
Sbjct: 15  LSFTKMQGIGNDFIVVDGYSRPVSLDADTIRRLADRHFGIGFDQLLLVERPTVEGVDFRY 74

Query: 65  RIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VR++   S   ++    +T RGI++ +   +G ++V+MGE
Sbjct: 75  RIFNADGGEVEQCGNGARCFVRYVHDKSLTSKREIRVQTARGIILPRLEDNGLVTVNMGE 134

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P     + M     ++  V    L    V SMGNPHA+  VE D+    +  
Sbjct: 135 PRFEPAEVPFIADREAMT----YLLQVADQALEIS-VASMGNPHAVTVVE-DVDTAPVER 188

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V +       
Sbjct: 189 LGPLVERHERFPQRVNAGFMQIVDEHHIRLRVFERGSGETLACGTGACAAVASGIRRGLL 248

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
              V V   GG L+I W      V+MTG A+  +EG +DI+ 
Sbjct: 249 QSPVRVATRGGELIIAWEGGGQPVWMTGPAETVFEGSIDIEV 290


>gi|303253047|ref|ZP_07339199.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302648111|gb|EFL78315.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
          Length = 274

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 138/283 (48%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 NLAPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 270


>gi|218906133|ref|YP_002453967.1| diaminopimelate epimerase [Bacillus cereus AH820]
 gi|226724202|sp|B7JDJ2|DAPF_BACC0 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218535645|gb|ACK88043.1| diaminopimelate epimerase [Bacillus cereus AH820]
          Length = 288

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWIEEGNVLMKGPAEVICHGVYEYK 285


>gi|324328866|gb|ADY24126.1| diaminopimelate epimerase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 288

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINIGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|296133317|ref|YP_003640564.1| diaminopimelate epimerase [Thermincola sp. JR]
 gi|296031895|gb|ADG82663.1| diaminopimelate epimerase [Thermincola potens JR]
          Length = 277

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 140/278 (50%), Gaps = 11/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           + F KM G+GN  ++I+    ++      +     +  T      L+      + D  +R
Sbjct: 1   MQFTKMHGLGNDFILIEDFDKNNLANGAELAVRLCNRKTGIGADGLVFILPSETADIQMR 60

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK--ENRDGS--ISVD 119
           I N DGSE + CGN +RC  R+L     +K+++   ET+ GI + +  EN  G   + VD
Sbjct: 61  IFNPDGSEPEMCGNAIRCFARYLYDHGIVKKQTIRVETLAGIRIPRIIENPAGEALVEVD 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MGEP L+   IP+     K+  +     PVN     N   VSMGNPH + FV D+   Y 
Sbjct: 121 MGEPELERGRIPMLGGPGKVVAEPL---PVNG-STYNVTCVSMGNPHCVIFV-DNAEDYP 175

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A+ G  +  H  F    N+   +V +   + +R WERG G+T ACG+ ACAS VA+   
Sbjct: 176 VAAIGPRVETHTAFPNKTNVEFVQVLNENEVRMRVWERGAGITMACGTGACASAVAAHLN 235

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             T R V V + GG L I W  +NHV+M G A   ++G
Sbjct: 236 GFTGREVIVHLDGGDLFIRWAQDNHVYMMGPAAYVFKG 273


>gi|95928476|ref|ZP_01311223.1| Diaminopimelate epimerase [Desulfuromonas acetoxidans DSM 684]
 gi|95135266|gb|EAT16918.1| Diaminopimelate epimerase [Desulfuromonas acetoxidans DSM 684]
          Length = 282

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 147/283 (51%), Gaps = 23/283 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  + +D  G   ++      A+   D  HF    D ++LI        DA 
Sbjct: 3   FIKMHGAGNDYVYVD--GFQQDVHRPEELAVRISDR-HFGVGSDGLILI--LPSDCADAR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRK--SFTFETIRGIL---VAKENRDGSIS- 117
           +R+ N DGSE Q CGNG+RCV ++L  +   +    T ET+ G+L   V  +  + +IS 
Sbjct: 58  MRMFNADGSEAQMCGNGIRCVAKYLCDQQSDRGSQLTIETLAGVLSVDVTADTENPAISQ 117

Query: 118 --VDMGEPILDWKLIPLARSFDKMDRD-RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
             V+MG+P L    IP+  +  + D+     I   N  F  +   VSMGNPH + +V DD
Sbjct: 118 VTVNMGQPRLQRGQIPM--TGPQQDQALEVEIRVKNRTFTAS--CVSMGNPHCVVYV-DD 172

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +  +D+A +G LL  HP+F E +N+    + S   +  RTWERG G T ACG+ A A  V
Sbjct: 173 VEQFDVAYWGALLENHPLFPERINVEFVEIISGSEVRQRTWERGAGETLACGTGASAVTV 232

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           A     +T R +   + GG L +E+ D+  V MTG A++ + G
Sbjct: 233 AGFLTGRTQRTIRNHLRGGVLTLEYCDDETVMMTGPAEQVFTG 275


>gi|42784120|ref|NP_981367.1| diaminopimelate epimerase [Bacillus cereus ATCC 10987]
 gi|81568769|sp|Q72YE7|DAPF_BACC1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|42740051|gb|AAS43975.1| diaminopimelate epimerase [Bacillus cereus ATCC 10987]
          Length = 288

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVDQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|89091914|ref|ZP_01164869.1| diaminopimelate epimerase [Oceanospirillum sp. MED92]
 gi|89083649|gb|EAR62866.1| diaminopimelate epimerase [Oceanospirillum sp. MED92]
          Length = 280

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 144/280 (51%), Gaps = 8/280 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V F KM G+GN  +V+D+      +T   +  L   +    FDQ++++    +  +D  
Sbjct: 2   LVRFTKMHGLGNDFMVLDLVTQRVKVTPKLVKKLGDRNFGVGFDQLLIVEPPSEPDIDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT-SRMKRKS-FTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV++CGNG RC  +F+   R+  KS    +T  G +  K + D  + V+MG
Sbjct: 62  YRIFNQDGSEVENCGNGARCFAKFVRDKRLTGKSEVVVQTANGQMTLKIHPDKRVEVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF-VVSMGNPHAIFFVEDDLYHYDL 180
            PIL    +P  ++  K       + P++    +     +SMGNPH +  V D   +  +
Sbjct: 122 APILAPVDVPF-QADQKATTYAIDV-PLSQGDQQVELSAISMGNPHGVLIV-DSTENAPV 178

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G  L  H  F    N+   +V S   ++LR +ERGVG T ACG+ ACA+VVA     
Sbjct: 179 ETLGPALEAHERFPAKANIGFMQVISRNEVNLRVFERGVGETIACGTGACAAVVAGKLRG 238

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
             +  V+V + GG L IEWH +   V MTG A   +EG++
Sbjct: 239 VLDMPVTVHLPGGDLEIEWHGEGQPVIMTGPATTVYEGQI 278


>gi|154492518|ref|ZP_02032144.1| hypothetical protein PARMER_02152 [Parabacteroides merdae ATCC
           43184]
 gi|154087743|gb|EDN86788.1| hypothetical protein PARMER_02152 [Parabacteroides merdae ATCC
           43184]
          Length = 274

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 144/289 (49%), Gaps = 32/289 (11%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++ M     N    AI   +       D ++LI   + A  D  +
Sbjct: 5   IRFTKMHGAGNDYIYVNTMAFPVRNPEELAIRLSAPHTGIGSDGLVLIGSSKIA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI---------LVAKENRD 113
           RI N DGSE   CGN  RC+ +++  +    +K+ T ET+ GI         L       
Sbjct: 63  RIFNADGSEAMMCGNASRCIGKYVYDKRLTNKKNITLETLSGIKELQLTTRKLSGPHEEV 122

Query: 114 GSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
             ++VDMG P++    + +         D F+ G           V+SMGNPH + FVED
Sbjct: 123 TEVTVDMGCPVIGETALEIEAG------DYFYTG----------TVISMGNPHLVIFVED 166

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            + + +L   G LL  HP+F    N+   +  S + + ++ WERG G+T ACG+ ACA+ 
Sbjct: 167 -ITNINLPVIGPLLECHPLFPNRTNVEFVQALSTDEVRMKVWERGSGITQACGTGACATA 225

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           VAS    KT R   V M GG L I W +++ HV+MTG A K +EG+L+I
Sbjct: 226 VASAVRGKTGRKTKVVMDGGPLTIHWDESSGHVYMTGGAVKVFEGELEI 274


>gi|165976961|ref|YP_001652554.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|229807484|sp|B0BRC5|DAPF_ACTPJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|165877062|gb|ABY70110.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 274

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 138/283 (48%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 NLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GIMQGVLDNNVQVDLSGGSLQIEWEGVGHPLYMTGDATHIYDG 270


>gi|300117992|ref|ZP_07055749.1| diaminopimelate epimerase [Bacillus cereus SJ1]
 gi|298724646|gb|EFI65331.1| diaminopimelate epimerase [Bacillus cereus SJ1]
          Length = 288

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    +  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGRMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|284929063|ref|YP_003421585.1| diaminopimelate epimerase [cyanobacterium UCYN-A]
 gi|284809522|gb|ADB95227.1| diaminopimelate epimerase [cyanobacterium UCYN-A]
          Length = 279

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 145/284 (51%), Gaps = 19/284 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F K +G+GN  ++ID R    +    +   +    N HF    D ++ +    D   D  
Sbjct: 3   FFKYQGLGNDFILIDNR--SSSELLLSSGQILKMCNRHFGIGADGVIFLLS-GDKVSDYG 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISVD 119
           + I N DGSE + CGNG+RC++ F+++        K +  +T+ GI+ A+      + V+
Sbjct: 60  MHIFNSDGSEPEMCGNGIRCLISFISNLENFEQTNKIYRIKTLAGIIKAELQTQTQVRVE 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLYH 177
           MG P+   K IP   S    D+D   I     +  +N  V  V+MGNPH I FVED    
Sbjct: 120 MGTPLFLNKQIPTTLS----DKDNTVINYPLEIEKKNWLVTCVNMGNPHCITFVEDTNL- 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            +L   G L   H  F E +N     +     L +R WERG G T ACG+ ACASVVA  
Sbjct: 175 INLEKLGPLFEYHSAFPERINTEFIEIVRPNHLKMRVWERGAGATLACGTGACASVVAGV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLD 280
             ++  R  +V++ GG LLIEW  D+N V+MTG A++ + G+ +
Sbjct: 235 ITNRAERVCTVELPGGNLLIEWVEDSNKVYMTGSAERVFIGEYN 278


>gi|163748704|ref|ZP_02155957.1| diaminopimelate epimerase [Shewanella benthica KT99]
 gi|161331814|gb|EDQ02618.1| diaminopimelate epimerase [Shewanella benthica KT99]
          Length = 274

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 148/281 (52%), Gaps = 21/281 (7%)

Query: 11  MEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D   RI 
Sbjct: 1   MHGLGNDFMVVD--GVTQNVFFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           N DG EV+ CGNG RC  RF+ ++    ++     T  G L  +  +DG+++V+MG P+L
Sbjct: 59  NADGGEVEQCGNGARCFARFVRNKGLTNKQKIKVSTSNGKLTLRLEQDGNVTVNMGIPVL 118

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVN------HLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           +   IP    F+    ++ ++   +        FL     VSMGNPH +  VED +   D
Sbjct: 119 EPSKIP----FNAKRPEKTYLLQTDTAESKMQTFLCG--AVSMGNPHCVLDVED-IQAAD 171

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G LL +H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 172 VEGIGALLTQHERFPKGVNVGFMQVINSGHIKLRVYERGAAETLACGTGACAAVVVGQLQ 231

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            K ++ V V + GG L I W  +   ++MTG A+  ++G++
Sbjct: 232 GKLDKRVRVDLPGGTLTINWDGEGKPLWMTGPAEHVYDGQI 272


>gi|326942757|gb|AEA18653.1| diaminopimelate epimerase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 288

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGFVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FVED
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFVED 175

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 176 -VEKAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|307250808|ref|ZP_07532737.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306857167|gb|EFM89294.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
          Length = 274

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 137/283 (48%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFFVEDDL 175
           PI +   +P  A  F+K            +  LR         VVSMGNPH +  VED +
Sbjct: 121 PIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQVED-I 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V  
Sbjct: 168 NLAPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                  +  V V + GG L IEW    H ++M G+A   ++G
Sbjct: 228 GIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMAGDATHIYDG 270


>gi|323702031|ref|ZP_08113699.1| diaminopimelate epimerase [Desulfotomaculum nigrificans DSM 574]
 gi|323532913|gb|EGB22784.1| diaminopimelate epimerase [Desulfotomaculum nigrificans DSM 574]
          Length = 281

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 147/288 (51%), Gaps = 20/288 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F K+ G+GN  ++++  G  + +  D I       +  F    D ++L+ D      D  
Sbjct: 3   FTKVHGLGNDFILVNA-GMGEGLPDDYITLAPKMCDRRFGIGADGLVLLLD--SGVADVR 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA----KENRDGSIS 117
           +RIIN DGSE + CGN +RCV ++L     +++     ET+ GI+V     K  R  ++ 
Sbjct: 60  MRIINSDGSEAEMCGNAIRCVAKYLYEHGIVRKDEIKVETLAGIIVPQIIQKNGRVEAVR 119

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P L+ + IP+  +  ++  +   +      F      VSMGNPH + FV D L  
Sbjct: 120 VDMGAPRLERQEIPMLGTPGQVVNEPLQVN--GQTFKIT--AVSMGNPHCVIFVPD-LSV 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G  +  HP F    N+   +V S   + +  WERG G T ACG+ ACA V  +G
Sbjct: 175 IPLNQIGPQIETHPAFPRKTNVEFVQVLSPTEVRMMVWERGAGPTMACGTGACA-VATAG 233

Query: 238 CLHK-TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
            L+  T R+V+V + GG L IEW DN  ++MTG A++ + G+  +  G
Sbjct: 234 VLNGLTARSVTVHLPGGSLHIEWADNGRLYMTGPAEEVFNGEYIVYNG 281


>gi|167630192|ref|YP_001680691.1| diaminopimelate epimerase [Heliobacterium modesticaldum Ice1]
 gi|229807510|sp|B0TGR9|DAPF_HELMI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167592932|gb|ABZ84680.1| diaminopimelate epimerase [Heliobacterium modesticaldum Ice1]
          Length = 281

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 145/286 (50%), Gaps = 15/286 (5%)

Query: 6   VDFAKMEGIGNKILVIDM--RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F KM G+GN  +V++       D    + I     D +       LI  F     D  
Sbjct: 1   MEFVKMHGLGNDFIVVNAMEPPLLDREDWEEIAVRICDRHYGIGGDGLILLFPSDKADIR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS-----I 116
            RI+N DGSE + CGNG+RC+ R++  R  + ++    ET+ GI+V +   D +     +
Sbjct: 61  WRILNSDGSEPEMCGNGIRCLARYVYERGIVAKRRIEVETLAGIIVPEIITDAAGAVTGV 120

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEP L    IP+             +G      +R    +SMGNPH + +V +D+ 
Sbjct: 121 CVDMGEPRLQRHQIPMVGPEGPAVNQELVVG---DAVVRV-TALSMGNPHCLIYV-NDID 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              + + G  +  HP F    N+   +V + + + +R WERG G T ACG+ ACA+VV S
Sbjct: 176 EAPVTTLGPKVEVHPAFPAKTNVEFVQVVAPDEVQMRVWERGAGPTLACGTGACATVVGS 235

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
                T+R V+V + GG L IEW  +NN V+MTG A + + G+L +
Sbjct: 236 VLNGYTDRKVTVHLAGGPLHIEWREENNRVYMTGPAVEVFRGELPL 281


>gi|159906120|ref|YP_001549782.1| diaminopimelate epimerase [Methanococcus maripaludis C6]
 gi|254767112|sp|A9AB27|DAPF_METM6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|159887613|gb|ABX02550.1| Diaminopimelate epimerase [Methanococcus maripaludis C6]
          Length = 277

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 146/282 (51%), Gaps = 15/282 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN  + +D          + I+   +D +       L+        D  +R+ 
Sbjct: 3   FTKMHGLGNDYIYVDAISQKIE-NPNEISRFVSDRHFGIGSDGLVLILPSDLADFKMRMF 61

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISVDMG 121
           N DGSE + CGN +RCV +F+  +    + + T ET+ GI V +   +      + VDMG
Sbjct: 62  NSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTIENDKVVLVKVDMG 121

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EPIL  + IP L+     +D +   I   ++ +  N   VS+GNPHAI ++E+ +  + L
Sbjct: 122 EPILKAETIPVLSEKHPVIDEE---ITAKDYCY--NFTCVSIGNPHAITYIEN-VEEFPL 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L   H  F    N+    +    ++ +R WERG G T ACG+ ACA +VAS    
Sbjct: 176 EKIGPLFEIHEKFPRKTNVEFVELIDDSTVKMRVWERGAGETLACGTGACAVLVASVLKG 235

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              R  +VK+LGG L IEW++ +NH++MTG A   +EG++DI
Sbjct: 236 YVGRKATVKLLGGDLTIEWNESDNHIYMTGPATTVFEGEIDI 277


>gi|255658378|ref|ZP_05403787.1| diaminopimelate epimerase [Mitsuokella multacida DSM 20544]
 gi|260849709|gb|EEX69716.1| diaminopimelate epimerase [Mitsuokella multacida DSM 20544]
          Length = 278

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 142/283 (50%), Gaps = 18/283 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSD--AINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           F+K +G GN  +++D   C     SD  A      D +       +++       D  +R
Sbjct: 3   FSKWQGCGNDFVLVD---CFKENVSDFAAFAKKVCDRHYGIGGDGVLYVLPSDKADFRMR 59

Query: 66  IINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETIRGILVAK----ENRDGSISVD 119
           I N DGSE + CGNG+RC  R+L      +++ FT ET  GILV +      +   + VD
Sbjct: 60  IFNTDGSEAEMCGNGIRCFARYLHDFGLTEKEEFTVETGAGILVPRLQIEAGKVTGVRVD 119

Query: 120 MGEPILDWKLIPLAR-SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MGEP+L+ + IP+     +++  +   +    +        VSMGNPH + FVED    +
Sbjct: 120 MGEPVLEGEKIPVTGFGMNRVIEEDIEVKGKTYKMT----CVSMGNPHCVIFVED-AEAF 174

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G     HP F    N     V   + + +R WERG  +T ACG+ +CA+ VA   
Sbjct: 175 PIYELGASFESHPAFPRKTNTEFVEVRDRQHVRMRVWERGAAVTLACGTGSCATGVAGVL 234

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
             +T+R V V++ GG L +EW +  NHVFMTG A+  + G++D
Sbjct: 235 TGRTDRKVEVELDGGKLTVEWDEATNHVFMTGPAELVFTGEID 277


>gi|167625817|ref|YP_001676111.1| diaminopimelate epimerase [Shewanella halifaxensis HAW-EB4]
 gi|167355839|gb|ABZ78452.1| Diaminopimelate epimerase [Shewanella halifaxensis HAW-EB4]
          Length = 286

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 149/283 (52%), Gaps = 14/283 (4%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDAS 59
           S+++ F KM G+GN  +V+D  G   N+  + D I  L+  +    FDQ++L+    D  
Sbjct: 10  STLIQFTKMHGLGNDFMVVD--GVTQNVFFSPDQIKRLADRNFGVGFDQLLLVEPPYDPD 67

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV+ CGNG RC  RF+ ++    +      T  G +  +  RDG ++
Sbjct: 68  LDFHYRIFNADGSEVEQCGNGARCFARFVRNKGLTHKHKIRVSTSSGKITLRLERDGKVT 127

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P+L+   IP   +  K+++    +             VSMGNPH +    DD+  
Sbjct: 128 VNMGIPVLEPSKIPF--TAKKVEKTYLLLASSGTYLCG---AVSMGNPHCVI-EVDDVAA 181

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+ + G  L  H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV   
Sbjct: 182 ADVDTIGAELTNHERFPKGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGI 241

Query: 238 CLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              K +R V V + GG L+I W  +   ++MTG A+  ++G++
Sbjct: 242 QQGKLDRNVCVDLPGGSLMINWDGEGKPLWMTGPAEHVYDGQI 284


>gi|160896900|ref|YP_001562482.1| diaminopimelate epimerase [Delftia acidovorans SPH-1]
 gi|160362484|gb|ABX34097.1| Diaminopimelate epimerase [Delftia acidovorans SPH-1]
          Length = 286

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 146/286 (51%), Gaps = 14/286 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +++     L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETAGPLGLSAAQYRFLAHRQFGVGADQILTVRPSPAEGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC  R++  +    +     +T+ G++  + + DG ++VDMG+
Sbjct: 63  VIHNADGGEVEQCGNGARCFARYVHDKGLTGKSVIRVQTLAGLIAPELHADGRVTVDMGQ 122

Query: 123 PILDWKLIP------LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P+L+  L+P      + R      +    +G    +++     VSMGNPHA+  V DD+ 
Sbjct: 123 PVLEPSLVPFNGADLVPRPLGAAQQWPLQLGDEATVWIAP---VSMGNPHAVQLV-DDVD 178

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
           H  +A++G L+ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 179 HAPVATWGPLIERHVRFPQRVNAGFMQIVDRGQIRLRVYERGAGETLACGTGACAAVVAG 238

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
                 +  V V   GG L IEW D   V MTG A+  +EG++++ 
Sbjct: 239 IRWGLLDARVDVHTRGGRLTIEW-DGGAVRMTGPAEFVFEGQIEVP 283


>gi|119383149|ref|YP_914205.1| diaminopimelate epimerase [Paracoccus denitrificans PD1222]
 gi|119372916|gb|ABL68509.1| diaminopimelate epimerase [Paracoccus denitrificans PD1222]
          Length = 275

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 142/279 (50%), Gaps = 19/279 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDA 58
           QS  + F KM G+GN  +VID R        DA    +  D      FDQ+ +I   ++A
Sbjct: 9   QSIPLPFMKMHGLGNDFVVIDSR--RTGALPDAATVAAIADRHRGVGFDQLAVILPGENA 66

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISV 118
             DA +   N DGS   +CGN  RCV RFL      ++    T   +L A++  D    V
Sbjct: 67  --DARLVFFNADGSLSAACGNATRCVARFLMDETGARALRLATDHAVLAAEDAGDRLTRV 124

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG P+LDW  IPLA      D D  H+ PV      +P    MGNPH  FFV D     
Sbjct: 125 NMGAPVLDWAGIPLAE-----DVDTLHL-PVPG----DPVATGMGNPHMTFFVPD-AAAV 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL  FG     HP++ +  N+ + +V S + + LR WERG G+T A GS +CA+VVA+  
Sbjct: 174 DLERFGPAHEHHPLYPQRTNIELVQVVSPDEIILRIWERGTGITLASGSCSCAAVVAAAR 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
              T R V V + GG L I+W ++  V+MTG     ++G
Sbjct: 234 RGLTGRRVRVNVPGGVLEIDWREDG-VWMTGPTAHVFDG 271


>gi|260774851|ref|ZP_05883753.1| diaminopimelate epimerase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609276|gb|EEX35431.1| diaminopimelate epimerase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 276

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 141/281 (50%), Gaps = 20/281 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + D I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCITQNIFFSPDLIRRLA-DRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DGSEV+ CGNG RC  RF+  RMK    + S +  T +G ++     D  ++V+MG
Sbjct: 64  IFNADGSEVEQCGNGARCFARFV--RMKGLTNKYSISVSTKKGKMILSIEEDDQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI--GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F     ++ +I       LF      VSMGNPH +  V DD    D
Sbjct: 122 VPEFEPNKIP----FKAKQTEKTYILRAEEKTLFCG---AVSMGNPHVVTVV-DDTQTAD 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G LL  H  F E VN    +V S   ++LR +ERG G T ACGS AC +V      
Sbjct: 174 VDTLGPLLESHERFPERVNAGFMQVLSRNEVNLRVYERGAGETQACGSGACGAVAVGIVQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              +  V+V + GG L I W      ++MTG A   ++G+L
Sbjct: 234 ELLDEKVTVNLPGGSLKISWQGPGKPLYMTGPATHVFDGQL 274


>gi|238923849|ref|YP_002937365.1| diaminopimelate epimerase [Eubacterium rectale ATCC 33656]
 gi|259595055|sp|C4Z900|DAPF_EUBR3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|238875524|gb|ACR75231.1| diaminopimelate epimerase [Eubacterium rectale ATCC 33656]
          Length = 285

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 149/293 (50%), Gaps = 30/293 (10%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  + +++    + +   A  ++   D  HF    D ++ I     A  D  
Sbjct: 3   FTKMHGCGNDYVYVNL--FEEKLDDPARVSIYVSDR-HFGIGSDGLITIGPSDKA--DFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +RI N DGSE + CGNG+RCV +++       +   + ET  GI    L  +EN+   + 
Sbjct: 58  MRIYNADGSEAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVEENKVSQVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHI--GPVN------HLFLRNPFVVSMGNPHAIF 169
           VDMGEPIL    IP+ ++      D + +   P++      H+       VSMGNPHA+ 
Sbjct: 118 VDMGEPILTPGDIPVVKADGSAYSDDYRVIDEPISAGNREWHMTC-----VSMGNPHAVV 172

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           FV DD+  ++L  +G L   H MF +  N     + S     +R WERG   T ACG+  
Sbjct: 173 FV-DDVAGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWERGSAETWACGTGT 231

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           CA+V+A     KT+  V V + GG L IE+  + NHVFMTG A + + G++DI
Sbjct: 232 CATVMACILNKKTDNKVLVHLRGGDLTIEYIPETNHVFMTGPATEVFSGEIDI 284


>gi|126696309|ref|YP_001091195.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9301]
 gi|126543352|gb|ABO17594.1| Diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9301]
          Length = 286

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 150/287 (52%), Gaps = 20/287 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F K +G GN  +VID RG   + N  ++ I  +    N  F    D ++ I + ++ +
Sbjct: 4   ITFEKYQGNGNDFVVIDSRGNDLYKNYKTNKIFDIKQICNRQFGIGADGVIFIEEPKEDN 63

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGS 115
               I I N DGSE Q CGNG+RC+V +L    +   K   +  ET  G+ +AK   D  
Sbjct: 64  YAKMI-IFNSDGSEAQMCGNGIRCLVEYLHLNDSMNNKNIEYKIETKAGLKIAKYIND-E 121

Query: 116 ISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           I+V MG PIL+ + IP  + +  + +    F    +   F    + V MGNPH IFFV+D
Sbjct: 122 ITVKMGVPILECQNIPTTIEKKINSIPSHEF----IEKDFNNMGYAVGMGNPHLIFFVKD 177

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    L+  G +L K+ +F E  N+   ++ + +++ ++ WERG G T ACG+ ACA  
Sbjct: 178 -IESIILSRLGPILEKNELFPEKTNVHFCQILNRDNIKVKVWERGAGPTLACGTGACAIH 236

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
           VA+  L   N    V + GG L I+W  D+  V MTG AKK + G +
Sbjct: 237 VAAYKLGLCNSQTIVTLPGGNLKIDWSKDDCEVMMTGNAKKVFSGSM 283


>gi|228963958|ref|NP_486088.2| diaminopimelate epimerase [Nostoc sp. PCC 7120]
 gi|22256738|sp|Q8YVD0|DAPF2_ANASP RecName: Full=Diaminopimelate epimerase 2; Short=DAP epimerase 2
          Length = 279

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 147/295 (49%), Gaps = 39/295 (13%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           ++F K  G+GN  ++ID R      IT +   A+   D  HF    D ++     ++ + 
Sbjct: 3   IEFTKYHGLGNDFILIDNRASKTPAITPE--KAVEMCDR-HFGIGADGVIFALPGENGT- 58

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLT-----SRMKRKSFTFETIRGILVAKENRDGS 115
           D  +RI N DGSE + CGNG+RC+  FL      SR K  ++   T+ G++  +   DG 
Sbjct: 59  DYTMRIFNSDGSEPEMCGNGIRCLAAFLADLEGLSRNK-DTYRIHTLAGVITPQLTPDGQ 117

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF----------VVSMGNP 165
           I VDMG P L    IP              +G  +   +  P            VSMGNP
Sbjct: 118 IKVDMGLPRLLAGEIPTT------------LGAADGKVINQPLEVEGQTWEVTCVSMGNP 165

Query: 166 HAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAAC 225
           H I FVED +    L   G     HP F +  N    +V S + L +R WERG G+T AC
Sbjct: 166 HCITFVED-VAAIPLEIIGPKFEHHPAFPQRTNTEFIQVVSRDYLKMRVWERGAGITLAC 224

Query: 226 GSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           G+ ACAS+VA+    +++R  +V++ GG L IEW + +  ++MTG A + + GKL
Sbjct: 225 GTGACASLVAAVLTGRSDRLATVELPGGPLEIEWSEVDQRIYMTGPADRVFTGKL 279


>gi|149177050|ref|ZP_01855658.1| diaminopimelate epimerase [Planctomyces maris DSM 8797]
 gi|148844115|gb|EDL58470.1| diaminopimelate epimerase [Planctomyces maris DSM 8797]
          Length = 279

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 139/279 (49%), Gaps = 17/279 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS---TDDNTHFDQIMLIHDFQDASVDAFI 64
           F KM G GN  + ++   C +    + I +L+   +D +T      LI        DA +
Sbjct: 3   FTKMHGAGNDYVYVN---CFEETLPEDIASLAIAVSDRHTGIGSDGLILICPSEKADAQM 59

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGNG+RCV +++       +++   ET  G+L       GS    + V
Sbjct: 60  RMFNADGSESEMCGNGVRCVAKYVYDHGISNQQTLKIETGAGVLSLDLELAGSKVSQVRV 119

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG+PIL    IP     D        +G    L +     VSMGNPH I FV++   H+
Sbjct: 120 NMGKPILTSAEIPTLLPGDPPVNAPLEVG-AQTLEVT---CVSMGNPHCITFVDEVNDHW 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G  +  HPMF   VN     V S   L +R WERG G T ACG+ ACAS VA   
Sbjct: 176 -VHGIGPQVEVHPMFPRRVNAEFIEVISPAELKMRVWERGSGETQACGTGACASAVAGVL 234

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
             ++ R V + + GG L +EW DN+ VFMTG A + ++G
Sbjct: 235 TGRSERNVLIHLPGGDLRLEWADNDEVFMTGPAVEVYQG 273


>gi|291527977|emb|CBK93563.1| diaminopimelate epimerase [Eubacterium rectale M104/1]
          Length = 285

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 148/293 (50%), Gaps = 30/293 (10%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  + +++    + +   A  ++   D  HF    D ++ I        D  
Sbjct: 3   FTKMHGCGNDYVYVNL--FEEKLDDPARVSIYVSDR-HFGIGSDGLITIG--PSGKADFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +RI N DGSE + CGNG+RCV +++       +   + ET  GI    L  +EN+   + 
Sbjct: 58  MRIYNADGSEAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVEENKVSQVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHI--GPVN------HLFLRNPFVVSMGNPHAIF 169
           VDMGEPIL    IP+ ++      D + +   P++      H+       VSMGNPHA+ 
Sbjct: 118 VDMGEPILTPGDIPVVKADGSAYSDDYRVIDEPISAGNREWHMTC-----VSMGNPHAVV 172

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           FV DD+  ++L  +G L   H MF +  N     + S     +R WERG   T ACG+  
Sbjct: 173 FV-DDVAGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWERGSAETWACGTGT 231

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           CA+V+A     KT+  V V + GG L IE+  + NHVFMTG A + + G++DI
Sbjct: 232 CATVMACILNKKTDNKVLVHLRGGDLTIEYIPETNHVFMTGPATEVFSGEIDI 284


>gi|48428755|gb|AAT42404.1| diaminopimelate epimerase [Collimonas fungivorans Ter331]
          Length = 280

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 142/284 (50%), Gaps = 21/284 (7%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G GN  +VID    H + T      L         DQ++++   Q   VD   RI N 
Sbjct: 1   MHGAGNDFVVIDAIHQHVDFTPAQWQRLGDRRFGVGADQMLVVEKSQAEGVDFRYRIYNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG R  V+F+T +    +++   ET+ GI+  K   DG I+V MG P+L  
Sbjct: 61  DGGEVEQCGNGARAFVKFVTDKGLTSKRAIRVETMSGIIEPKLEDDGRITVAMGAPVL-- 118

Query: 128 KLIPLARSFDKMDRDRFHIG-----PVN----HLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
              P A  FD  + D   +G     P++     +++    VVSMGNPHA+  VED     
Sbjct: 119 --APAAVPFDASNLDSRAMGEDTLWPLDVQGKQVWIS---VVSMGNPHAVQVVEDSEAAP 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            LA  G L+  HP F   VN    ++    S+ LR +ERG G T ACG+ ACA+VVA   
Sbjct: 174 VLAE-GPLIEHHPRFPRRVNAGFMQIVDRHSIKLRVFERGAGETLACGTGACAAVVAGIR 232

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               +  V+V+  GG L I W      V MTG A   +EG+++I
Sbjct: 233 RGLLDSPVAVQTHGGELSIAWAGGQQAVMMTGPAVSVFEGEIEI 276


>gi|238789381|ref|ZP_04633167.1| Diaminopimelate epimerase [Yersinia frederiksenii ATCC 33641]
 gi|238722524|gb|EEQ14178.1| Diaminopimelate epimerase [Yersinia frederiksenii ATCC 33641]
          Length = 274

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 140/278 (50%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D  +D  
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLA-DRHTGVGFDQMLVVEPPYDPELDFH 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MG
Sbjct: 60  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EP  D + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+   ++
Sbjct: 120 EPNFDPQTVP----FRAAKAEKTYILRAAEHTVLCG--VVSMGNPHCVMQV-DDVSVANV 172

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G  L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V       
Sbjct: 173 ALLGPELESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQE 232

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
             +  V V++ GG L I W    H ++MTG A   ++G
Sbjct: 233 LLSEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 270


>gi|299068297|emb|CBJ39518.1| diaminopimelate epimerase [Ralstonia solanacearum CMR15]
          Length = 292

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 139/286 (48%), Gaps = 19/286 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      + T +   A++   + HF    DQ++L+       VD  
Sbjct: 5   FTKMHGAGNDFVVLDGIATPIDFTPEQWRAIA---DRHFGVGADQLLLVERSTRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG
Sbjct: 62  YRIFNHDGGEVEQCGNGARCFVKFVTDRGLTDKRTIRVEVMNGIATLTMQPDGQVTVDMG 121

Query: 122 EPILDWKLIPLAR---SFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLY 176
            P+ +   +P            RD  H   +N    R  ++  VSMGNPHA+  V DD  
Sbjct: 122 APVFEAARLPFVPDGLPTRVEGRDTQHALQING---RTAWLSTVSMGNPHAVQVV-DDAQ 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 178 AFPVREDGPLIESHAVFPRRVNAGFMEIADRHAIRLRVYERGAGETLACGTGACAAVVAG 237

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V V   GG L I W  +   V MTG A   +EG LD+
Sbjct: 238 IRRGLLDSPVKVATHGGDLTIAWAGEGEPVMMTGPATTVFEGTLDL 283


>gi|301056426|ref|YP_003794637.1| diaminopimelate epimerase [Bacillus anthracis CI]
 gi|300378595|gb|ADK07499.1| diaminopimelate epimerase [Bacillus cereus biovar anthracis str.
           CI]
          Length = 288

 Score =  148 bits (374), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 149/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   F  ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFAIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|319637644|ref|ZP_07992410.1| diaminopimelate epimerase [Neisseria mucosa C102]
 gi|317400799|gb|EFV81454.1| diaminopimelate epimerase [Neisseria mucosa C102]
          Length = 283

 Score =  148 bits (374), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 140/278 (50%), Gaps = 7/278 (2%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V++ +    D + +             FDQ +++      +VD   RI
Sbjct: 6   FTKMHGLGNDFMVVNAIEQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDAVDFRYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++V+MG+P 
Sbjct: 66  FNADGREVEQCGNGARCFARFVADKGLTDKTEILVETAKGIIVPKLLDNGLVTVNMGKPR 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
                IP   +  + +    HI  V  L       V+MGNPHA+  V D++    +  +G
Sbjct: 126 FMPSEIPFVPAHGETEDALTHIVLVG-LESVPVSCVNMGNPHAVILV-DNVETAPVDHWG 183

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS--GCLHKT 242
           + +  H  F E VN+   ++    S+ LR +ERGVG T ACG+ ACA+VVA     L K 
Sbjct: 184 SAIESHEQFPERVNVGFMQIEDELSVRLRVFERGVGETQACGTGACAAVVAGVRNGLLKA 243

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              V V + GG L I W +   V MTG A+  +EG+L 
Sbjct: 244 GAPVRVTLPGGELFISWEEGGDVQMTGPAETVFEGELQ 281


>gi|94499871|ref|ZP_01306407.1| diaminopimelate epimerase [Oceanobacter sp. RED65]
 gi|94428072|gb|EAT13046.1| diaminopimelate epimerase [Oceanobacter sp. RED65]
          Length = 278

 Score =  148 bits (374), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 136/282 (48%), Gaps = 10/282 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H     + +  LS       FDQ++++    +  VD  
Sbjct: 2   LLKFTKMHGLGNDFMVVDLVTQHFAFRPEFVRQLSDRQFGIGFDQLLIVEPPSNPEVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+       +     ET  GI+     +DG + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVHDVRLTAKNPIKVETSSGIIELNIEQDGDVVVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIG-PVNHLFLRNPF-VVSMGNPHAIFFVEDDLYHYD 179
                 +  P    F+    +R+ +  P+N       F  VSMGNPH +  V DD++   
Sbjct: 122 AA----RFSPSDLPFNAEQAERYQVQVPLNDGNYTAEFGAVSMGNPHCVMVV-DDIHSEL 176

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  L  H  F + VN    ++ +   +DLR +ERG G T ACG+ ACA+V  +   
Sbjct: 177 VNQLGPQLEGHEQFPKRVNAGFMQIKNRNEMDLRVYERGAGWTLACGTGACAAVAVAHKW 236

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              +  V V + GG L I W     V M G   + ++G+L +
Sbjct: 237 GLVDDEVKVNLPGGALTIRWDGEGDVIMKGPVVRVFDGRLQV 278


>gi|206970158|ref|ZP_03231111.1| diaminopimelate epimerase [Bacillus cereus AH1134]
 gi|116062043|dbj|BAF34654.1| diaminopimelate epimerase [Bacillus cereus]
 gi|206734735|gb|EDZ51904.1| diaminopimelate epimerase [Bacillus cereus AH1134]
          Length = 288

 Score =  148 bits (374), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERVNVEFIEILNNDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|20807956|ref|NP_623127.1| diaminopimelate epimerase [Thermoanaerobacter tengcongensis MB4]
 gi|22256735|sp|Q8R9S4|DAPF_THETN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|20516527|gb|AAM24731.1| Diaminopimelate epimerase [Thermoanaerobacter tengcongensis MB4]
          Length = 274

 Score =  148 bits (374), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 150/283 (53%), Gaps = 20/283 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN  +VI+     D  +  A+           D ++++     A  D  +RI 
Sbjct: 3   FTKMHGLGNDFIVIEAVEGVD-YSELAVKLCDRHFGIGADGLLVVEPSHIA--DIKMRIF 59

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK---EN-RDGSISVDMG 121
           N DGSE + CGNG RC  +++  +  + ++  T ET+ G+++ +   EN +  S+ V MG
Sbjct: 60  NADGSEAEMCGNGSRCFAKYVYEKGIVSKQKMTVETLAGVIMPELFVENGKIKSVKVYMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
            PI +   IP+     K ++ +F   PV      +  +   V +G PH I FV       
Sbjct: 120 SPIFESSKIPV-----KSEKQKFIDEPVKIDGKTYRLSS--VRVGVPHTILFV-SSFEES 171

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G  + K  +F EG N+   +V   E++ +RTWERGVGLT ACGS A AS V S  
Sbjct: 172 FMKELGPKIEKSSLFPEGTNVDFVKVEDEENISVRTWERGVGLTLACGSGASASAVVSSL 231

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           L +T R+V+V    G LL+EW ++N ++++GE ++ + G+++I
Sbjct: 232 LGRTRRSVNVHFKAGVLLVEWKEDNSIYLSGEVEEVFRGEIEI 274


>gi|302872514|ref|YP_003841150.1| diaminopimelate epimerase [Caldicellulosiruptor obsidiansis OB47]
 gi|302575373|gb|ADL43164.1| diaminopimelate epimerase [Caldicellulosiruptor obsidiansis OB47]
          Length = 278

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 152/293 (51%), Gaps = 42/293 (14%)

Query: 8   FAKMEGIGNKILVIDMRG-------------CHDNITSDAINALSTDDNTHFDQIMLIHD 54
           F+KM G+GN  +VID RG             CH +I   A            D I+L+ D
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNLLAKKMCHRHIGVGA------------DGILLVLD 50

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE-- 110
            + A  D  +RIIN DGSE + CGNG+RC  +++  R  +K+  F  ET+ GI+  +   
Sbjct: 51  SKLA--DIRMRIINSDGSEAEMCGNGIRCFSKYVFERGIVKKDKFKVETLAGIIEPQLIL 108

Query: 111 NRDG---SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVS--MGNP 165
           N  G    + V+MG+P    K IP+     + D +   I     +  +   + S  MG P
Sbjct: 109 NDYGLVEKVRVNMGKPSFKRKDIPM-----QGDPESDAINTSIEVEGKEYKITSLLMGVP 163

Query: 166 HAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAAC 225
           H + FV DD+   D+ + G  + KH +F    N++  +V    ++ +RTWERG G T AC
Sbjct: 164 HTVLFV-DDVEKVDIYTLGPKIEKHEVFPRKTNVNFVQVIDKNNIKVRTWERGAGATFAC 222

Query: 226 GSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           G+ +CASV+AS     T + V+V +  G L IEW D+  VFMTG A++ + G+
Sbjct: 223 GTGSCASVIASNLNGFTEKKVNVHLYFGMLEIEWQDDGTVFMTGPAEEVFVGE 275


>gi|33862988|ref|NP_894548.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9313]
 gi|81577635|sp|Q7V7M5|DAPF_PROMM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33634905|emb|CAE20891.1| Diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9313]
          Length = 303

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 148/290 (51%), Gaps = 24/290 (8%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINA----LSTDDNTHF----DQIMLIHDFQ 56
           M+ F+K +G+GN  L+ID R   D +T   IN     +    + HF    D ++L    +
Sbjct: 4   MLQFSKYQGLGNDFLLIDGR--EDQLTQQVINPDPAWVRKICDRHFGIGADGLILALPPR 61

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLT---SRMKRKSFTFETIRGILVAKENRD 113
            A  D  ++I N DGS  + CGNG+RC+ RFL      +  + +  ET+ GI+      D
Sbjct: 62  -ADGDLRMQIFNADGSLAEMCGNGIRCLTRFLADIEGDLCVQRWNIETLAGIICPVLQED 120

Query: 114 GSISVDMGEPILDWKLIPLARSFDK--MDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFF 170
           G I VDMG P LD + IP   +     + +   H+G  + H+       V MGNPH I  
Sbjct: 121 GQICVDMGTPFLDPESIPTTLTIGSAGLPQGECHLGSTSLHVA-----AVGMGNPHLIVP 175

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           VED L +    ++G  L KH  F    N+   ++ S   L++R WERG G T ACG+ AC
Sbjct: 176 VED-LENIPFENWGQRLEKHHAFPAKTNVHFLKIHSPNQLEIRVWERGSGPTLACGTGAC 234

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           AS+VA+  L  ++    V + GG L I W      VFMTG A+  ++G L
Sbjct: 235 ASLVATCLLGLSDDHAEVLLPGGVLQISWPGRRGSVFMTGPAEPIFDGVL 284


>gi|158335501|ref|YP_001516673.1| diaminopimelate epimerase [Acaryochloris marina MBIC11017]
 gi|189082824|sp|B0C312|DAPF_ACAM1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|158305742|gb|ABW27359.1| diaminopimelate epimerase [Acaryochloris marina MBIC11017]
          Length = 283

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 136/286 (47%), Gaps = 24/286 (8%)

Query: 6   VDFAKMEGIGNKILVIDMR-GCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           V+F K +G+GN  ++ID R      +T D A+     +     D ++      +   D  
Sbjct: 3   VEFTKYQGLGNDFILIDNRHQAQPCLTPDQAVQMCDRNFGIGGDGVIFALP-PEGDTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRK-----SFTFETIRGILVAKENRDGSISV 118
           +RI N DGSE + CGNG+RC+ RFL     +      ++   T+ G +      DG + V
Sbjct: 62  MRIYNSDGSEPEMCGNGIRCLARFLAHLEGKPLQTDITYRIHTLAGTITPSLQADGLVKV 121

Query: 119 DMGEPILDWKLIP--LARSFDKMDRDRFHIG----PVNHLFLRNPFVVSMGNPHAIFFVE 172
           DMG P L  + IP  L    D +      +     PV          VSMGNPH I FV 
Sbjct: 122 DMGPPFLVPQEIPTTLGEGTDPVVNQPLEVAGQSWPVT--------CVSMGNPHCITFV- 172

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DDL   D  + G     HP+F + +N    +V   + L +  WERG G T ACG+ ACA 
Sbjct: 173 DDLEAIDFQTLGPQFEHHPVFPQRINTEFIQVIRPDYLKMLVWERGAGPTLACGTGACAV 232

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
           +VA     K+    ++++ GG L I W  +   VFMTG A+K + G
Sbjct: 233 LVAGVLTGKSQSQATIELPGGPLQIRWAGEGQSVFMTGPAEKVFTG 278


>gi|166030591|ref|ZP_02233420.1| hypothetical protein DORFOR_00254 [Dorea formicigenerans ATCC
           27755]
 gi|166029593|gb|EDR48350.1| hypothetical protein DORFOR_00254 [Dorea formicigenerans ATCC
           27755]
          Length = 288

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 150/291 (51%), Gaps = 28/291 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+G+GN  + ++   C      +         N HF    D +++I+  + A  D  
Sbjct: 9   FTKMQGLGNDYVYVN---CFKEKIDNPPEVAKIVSNRHFGIGSDGLIMINPSKVA--DFE 63

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DGS  + CGNG+RCV +++       +   + ET+ GI    L  K+ +   + 
Sbjct: 64  MEMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTHISVETLGGIKYLDLTVKDGKVALVR 123

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVN------HLFLRNPFVVSMGNPHAIFFV 171
           VDMGEP LD + IP+       + DR     +       H+       VSMGNPH + ++
Sbjct: 124 VDMGEPELDPEKIPIIMKGYSDETDRVLNAQIKVDGKEYHMT-----GVSMGNPHDVVYI 178

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            D++   D+   G     H  F + +N   ARV   +++++R WERG G T ACG+ ACA
Sbjct: 179 -DNVQGLDIEKIGPKFENHERFPQRINTEFARVIDRKTVEMRVWERGSGETLACGTGACA 237

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
             VAS     T R V +++LGG L IEW+ ++NHV+MTG A   ++G++++
Sbjct: 238 VAVASILNGYTEREVEIRLLGGNLQIEWNEEDNHVYMTGPATVVFDGEIEL 288


>gi|212551077|ref|YP_002309394.1| diaminopimelate epimerase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|254767088|sp|B6YS11|DAPF_AZOPC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|212549315|dbj|BAG83983.1| diaminopimelate epimerase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 275

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 137/272 (50%), Gaps = 15/272 (5%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G GN  + ID  +   D     AI           D ++LI      S    +R+
Sbjct: 3   FTKMHGAGNDYIYIDCFKEKIDCPEELAIRLSDRHKGIGSDGLVLIMPSDKCSFR--MRM 60

Query: 67  INCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGI----LVAKENRDGSISVDM 120
            N DGSE Q CGN +RCV +++      ++ + T ET+ G+    L    ++   + V+M
Sbjct: 61  FNSDGSEAQMCGNAIRCVGKYVYDNGYTRKLNITIETLAGVKQLELFPTNDKIRKVKVNM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+PIL  K IP+    +K+  +         +       VSMGNPH + FVE  +   D+
Sbjct: 121 GKPILLAKDIPVIWEKEKLIYETIDFSSEQWILT----AVSMGNPHVVIFVEK-VSRLDV 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  +  HPMF E +N+    + SL    +R WERG G T ACG+ ACA++VAS    
Sbjct: 176 KRIGKEIEHHPMFPEKINVDFVEILSLYHAKMRVWERGSGETQACGTGACAALVASVLNG 235

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEA 271
           K NR  ++ +LGG L +EW +   HVFMTG+A
Sbjct: 236 KLNRKATISLLGGDLELEWDEKTEHVFMTGDA 267


>gi|270264255|ref|ZP_06192522.1| diaminopimelate epimerase [Serratia odorifera 4Rx13]
 gi|270041904|gb|EFA15001.1| diaminopimelate epimerase [Serratia odorifera 4Rx13]
          Length = 274

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 135/277 (48%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  D + +P    F     +R +I     H  L    VVSMGNPH +  V DD+    + 
Sbjct: 121 PNFDPQAVP----FRATKEERTYIMRAAEHTVLCG--VVSMGNPHCVLQV-DDVKTAKVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   ++ S E + LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGAGETQACGSGACAAVAVGIQQEL 233

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
            +  V V++ GG L I W    N +FMTG A   ++G
Sbjct: 234 LSEEVHVELPGGSLHIRWKGPGNPLFMTGPATHVYDG 270


>gi|296161402|ref|ZP_06844209.1| diaminopimelate epimerase [Burkholderia sp. Ch1-1]
 gi|295888388|gb|EFG68199.1| diaminopimelate epimerase [Burkholderia sp. Ch1-1]
          Length = 295

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 144/288 (50%), Gaps = 15/288 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  +V+D      N+T   + AL+   + HF    DQ++L+     A VD
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALA---DRHFGVGADQLLLVEKPTVAGVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI NCDG EV+ CGNG RC V+F+  R    ++S   +  +G +      +G + VD
Sbjct: 60  FRYRIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTVTLTMQENGEVLVD 119

Query: 120 MGEPILDWKLIPLA-RSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P+ D + +P A +  +        + P++     R    VSMGNPHA+  V DD+  
Sbjct: 120 MGTPVFDPERVPFATKGLEGRREGADTLWPLDVSGTTRWISAVSMGNPHAVQVV-DDVEA 178

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A  
Sbjct: 179 FPVLVEGPVIERHARFPQRVNAGFMQIVGRSEIRLRVYERGAGETLACGTGACAAVAAGI 238

Query: 238 CLHKTNRAVSVKMLGGGLLIEW---HDNNHVFMTGEAKKEWEGKLDIK 282
              + +  V V   GG L I W    +   + M G A   +EG++++ 
Sbjct: 239 RRGRLDSPVLVHTHGGNLTISWDNTREGEPLLMAGPAVTVFEGEIELP 286


>gi|296113697|ref|YP_003627635.1| diaminopimelate epimerase [Moraxella catarrhalis RH4]
 gi|295921391|gb|ADG61742.1| diaminopimelate epimerase [Moraxella catarrhalis RH4]
 gi|326562437|gb|EGE12756.1| diaminopimelate epimerase [Moraxella catarrhalis 7169]
 gi|326562806|gb|EGE13101.1| diaminopimelate epimerase [Moraxella catarrhalis 46P47B1]
 gi|326563473|gb|EGE13736.1| diaminopimelate epimerase [Moraxella catarrhalis 103P14B1]
 gi|326569145|gb|EGE19207.1| diaminopimelate epimerase [Moraxella catarrhalis BC1]
 gi|326570631|gb|EGE20667.1| diaminopimelate epimerase [Moraxella catarrhalis BC7]
 gi|326571338|gb|EGE21355.1| diaminopimelate epimerase [Moraxella catarrhalis BC8]
 gi|326572967|gb|EGE22946.1| diaminopimelate epimerase [Moraxella catarrhalis CO72]
 gi|326573783|gb|EGE23740.1| diaminopimelate epimerase [Moraxella catarrhalis 101P30B1]
 gi|326574795|gb|EGE24729.1| diaminopimelate epimerase [Moraxella catarrhalis O35E]
          Length = 299

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 151/304 (49%), Gaps = 23/304 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+       FDQ++++       +D  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRMTLTPELIRLLADRRIGVGFDQLLIVEPPSRPDIDFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC   F+ +R    ++    ET  GI++   NR G + VDMG
Sbjct: 62  YRIFNADGSEVSQCGNGARCFASFVQARKLSFKQRLRVETSSGIIILSTNRYGWVQVDMG 121

Query: 122 EPILDWKLIPL-ARSFDKMDRD-RFHIG--PVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           +P  +   IP   ++  K+ R  R  +   PV        +V ++GNPHAI    DD+  
Sbjct: 122 KPKFEPDQIPFTPKTITKVGRAYRLDVDGIPVQL------YVANIGNPHAII-KVDDVLD 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---V 234
            D+   G L+  H  F E VN++  +V +   + +R +ERGVG T ACG+ ACASV   +
Sbjct: 175 ADVDRLGKLIESHEAFPERVNVNFVQVINQRHVRIRVYERGVGETQACGTGACASVATGI 234

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG-----KLDIKTGKWIKK 289
             G L +    +  ++ GG L I W D   + MTG     +EG      L    G  +  
Sbjct: 235 REGWLDE-GVDIRAQLYGGSLAIRWQDGYSLIMTGPTAFVYEGVFSPDGLAASAGIKLDP 293

Query: 290 NEDD 293
           N DD
Sbjct: 294 NADD 297


>gi|218233484|ref|YP_002369736.1| diaminopimelate epimerase [Bacillus cereus B4264]
 gi|226724204|sp|B7HBI0|DAPF_BACC4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218161441|gb|ACK61433.1| diaminopimelate epimerase [Bacillus cereus B4264]
          Length = 288

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 150/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|241760323|ref|ZP_04758418.1| diaminopimelate epimerase [Neisseria flavescens SK114]
 gi|241319201|gb|EER55679.1| diaminopimelate epimerase [Neisseria flavescens SK114]
          Length = 283

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 138/277 (49%), Gaps = 7/277 (2%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +V++ +    D + +             FDQ +++      +VD   RI
Sbjct: 6   FTKMHGLGNDFMVVNAINQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDAVDFRYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++V+MG+P 
Sbjct: 66  FNADGREVEQCGNGARCFARFVADKGLTDKTEILVETAKGIIVPKLLDNGLVTVNMGKPR 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
                IP   +  +      HI  V  L       V+MGNPHA+  V DD+    +  +G
Sbjct: 126 FMPSEIPFVPAHGENKDALTHIVLVG-LESVPVSCVNMGNPHAVILV-DDVETAPVEHWG 183

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS--GCLHKT 242
             +  H  F E VN+   +V    S+ LR +ERGVG T ACG+ ACA+VVA     L K 
Sbjct: 184 GAIESHEQFPERVNVGFVQVEDELSVRLRVFERGVGETQACGTGACAAVVAGVRNGLLKE 243

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              V V + GG L I W +   V MTG A+  +EG+L
Sbjct: 244 GAPVRVTLPGGELFISWEECGDVQMTGPAETVFEGEL 280


>gi|163942650|ref|YP_001647534.1| diaminopimelate epimerase [Bacillus weihenstephanensis KBAB4]
 gi|229807486|sp|A9VN01|DAPF_BACWK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|163864847|gb|ABY45906.1| Diaminopimelate epimerase [Bacillus weihenstephanensis KBAB4]
          Length = 288

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 154/293 (52%), Gaps = 23/293 (7%)

Query: 4   SMVDFAKMEGIGNKILVIDM-----RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDA 58
           S   F KM G+GN  + ++M     R     I ++ ++ ++T      D ++LI     A
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIREEDLAIVAEKVSNINTGIGA--DGMILICPSDVA 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENR 112
            V   +R+ N DGSE +SCGNG+RCV ++      ++ K FT ET+ GI+ A+    +++
Sbjct: 60  PVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEGKVFTIETLAGIVTAEVTVEDDK 117

Query: 113 DGSISVDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
                +DMG P L  + IP L        R+ F     NH +      VSMGNPHA+ FV
Sbjct: 118 VTLAKIDMGAPRLTREEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV 173

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+ +  L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA
Sbjct: 174 -DDVENAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACA 232

Query: 232 SVVASGCLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           +VVA+    K    + ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 233 AVVAAILNGKMEHGKEITVHLAGGDLMIAWTEEGNVLMKGPAEIICRGVYEYK 285


>gi|261379692|ref|ZP_05984265.1| diaminopimelate epimerase [Neisseria subflava NJ9703]
 gi|284797356|gb|EFC52703.1| diaminopimelate epimerase [Neisseria subflava NJ9703]
          Length = 283

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 140/280 (50%), Gaps = 7/280 (2%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V++ +    D + +             FDQ +++      +VD   
Sbjct: 4   LKFTKMHGLGNDFMVVNAINQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDAVDFRY 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++V+MG+
Sbjct: 64  RIFNADGREVEQCGNGARCFARFVADKGLTDKTEILVETTKGIIVPKLLDNGLVTVNMGK 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP   +  + +    HI  V  L       V+MGNPHA+  V D++    +  
Sbjct: 124 PRFMPSEIPFVPAHGENEDALTHIVLVG-LESVPVSCVNMGNPHAVILV-DNVETAPVEH 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS--GCLH 240
           +G  +  H  F E VN+   +V    S+ LR +ERGVG T ACG+ ACA+VVA     L 
Sbjct: 182 WGGAIESHEQFPERVNVGFLQVEDELSVRLRVFERGVGETQACGTGACAAVVAGVRNGLL 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           K    V V + GG L I W +   V MTG A+  +EG+L 
Sbjct: 242 KAGAPVRVTLPGGELFISWEEGGDVQMTGPAETVFEGELQ 281


>gi|121595979|ref|YP_987875.1| diaminopimelate epimerase [Acidovorax sp. JS42]
 gi|120608059|gb|ABM43799.1| diaminopimelate epimerase [Acidovorax sp. JS42]
          Length = 315

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 145/300 (48%), Gaps = 36/300 (12%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +T      L+   + HF    DQI+++     A +D
Sbjct: 26  IRFTKMQGAGNDFVVLDETQGRLGLTPAQYRFLA---DRHFGVGADQILIVRPSPGAGID 82

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG +V+ CGNG RC  R++  +    + +   +T+ G++      DG ++VD
Sbjct: 83  FEYVIHNADGGQVEQCGNGARCFARYVRDKGLTAQDTIRVQTMAGVIAPHLTADGRVTVD 142

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRN-PF--------------VVSMGN 164
           MG P L+   +P          D   + PV+    +  P               VVSMGN
Sbjct: 143 MGRPELEPARVPF---------DTTGLAPVSQGSGQKWPLALDGQASAATILIAVVSMGN 193

Query: 165 PHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAA 224
           PHA+  V DD+    +A  G L+  HP F + VN    ++ +   + LR +ERG G T A
Sbjct: 194 PHAVQLV-DDVDTAPVAQTGPLIESHPRFPQRVNAGYLQIVNRGEVRLRVYERGAGETLA 252

Query: 225 CGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           CG+ ACA+VVA   L   +  V V   GG L I+W     + VFMTG A   +EG++DI 
Sbjct: 253 CGTGACAAVVAGIRLGLLDARVQVHTRGGLLTIDWAGGLQDPVFMTGPATTVFEGEIDIP 312


>gi|298490598|ref|YP_003720775.1| diaminopimelate epimerase ['Nostoc azollae' 0708]
 gi|298232516|gb|ADI63652.1| diaminopimelate epimerase ['Nostoc azollae' 0708]
          Length = 279

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 144/284 (50%), Gaps = 17/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K  G+GN  ++ID R     + +    A+   D  HF    D ++     Q+   D
Sbjct: 3   IEFTKYHGLGNDFILIDNRSSLTPVITPQ-QAVKWCDR-HFGIGADGVIFALPGQN-DTD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLT-----SRMKRKSFTFETIRGILVAKENRDGSI 116
             +RI N DGSE + CGNG+RC+  FLT     SR K   +   T+ G++  +   DG +
Sbjct: 60  YTMRIFNSDGSEPEMCGNGIRCLAAFLTELEGISRTK-DYYRIHTLAGVITPQLTHDGQV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMG P L  + IP   +F   D    ++         +   VSMGNPH I F+ED + 
Sbjct: 119 KVDMGLPRLLAQEIP--TTFAPADNKVINLPLEVAGTTWDVTCVSMGNPHCITFIED-VA 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L   G     HP F + +NL    + +   L +R WERG G+T ACG+ ACA +VA 
Sbjct: 176 AIPLEKIGPKFEHHPAFPQRINLEFIEIVNRNYLKMRVWERGAGITLACGTGACAVLVAG 235

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
               K +R  ++++ GG L IEW + +  ++MTG A++ + GK 
Sbjct: 236 VLNDKCDRTATIELPGGPLEIEWSEIDQRIYMTGPAERVFIGKF 279


>gi|326563211|gb|EGE13479.1| diaminopimelate epimerase [Moraxella catarrhalis 12P80B1]
          Length = 299

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 151/304 (49%), Gaps = 23/304 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+       FDQ++++       +D  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRMTLTPELIRLLADRRIGVGFDQLLIVEPPSRPDIDFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC   F+ +R    ++    ET  GI++   NR G + VDMG
Sbjct: 62  YRIFNADGSEVSQCGNGARCFASFVQARKLSFKQRLRVETSSGIIILSTNRYGWVQVDMG 121

Query: 122 EPILDWKLIPL-ARSFDKMDRD-RFHIG--PVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           +P  +   IP   ++  K+ R  R  +   PV        +V ++GNPHAI    DD+  
Sbjct: 122 KPKFEPDQIPFTPKTITKVGRAYRLDVDGIPVQL------YVANIGNPHAII-KVDDVLD 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---V 234
            D+   G L+  H  F E VN++  +V +   + +R +ERGVG T ACG+ ACASV   +
Sbjct: 175 ADVDRLGKLIESHEAFPERVNVNFVQVINQRHVRIRVYERGVGETQACGTGACASVATGI 234

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG-----KLDIKTGKWIKK 289
             G L +    +  ++ GG L I W D   + MTG     +EG      L    G  +  
Sbjct: 235 REGWLDE-GVDIRAQLYGGSLAIRWQDGYSLIMTGPTAFVYEGVFSPDGLAASAGIKLDP 293

Query: 290 NEDD 293
           N DD
Sbjct: 294 NADD 297


>gi|90408776|ref|ZP_01216921.1| diaminopimelate epimerase [Psychromonas sp. CNPT3]
 gi|90310120|gb|EAS38260.1| diaminopimelate epimerase [Psychromonas sp. CNPT3]
          Length = 275

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 100/279 (35%), Positives = 145/279 (51%), Gaps = 9/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM+G+GN  +VID       ++  AI  L+  +    FDQ++L+    D  +D   
Sbjct: 3   IQFSKMQGLGNDFMVIDNITQSVFLSKTAIQRLADRNFGIGFDQLLLVEPPYDPELDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF  L    +++     T +G +  K  +DG+I+VDMG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKLKGLTQKRVINVSTAKGKIQLKIEQDGNITVDMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI D   IP      K +   + +    H  +    VVSMGNPH +  V DD+    + +
Sbjct: 123 PIFDPHKIPFVA---KKEEKTYILRVQEHTVICG--VVSMGNPHCVVLV-DDIDSAPVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F   VN+S   + S +   LR WERGVG T ACG+ ACA+ V      K 
Sbjct: 177 LGPLLENHERFPNKVNVSFLEIKSPDYAKLRVWERGVGETLACGTGACAAAVIGQLQGKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               ++++ GG L   W     V MTG A+  ++G++ I
Sbjct: 237 ATHCTIELPGGKLKFFWQMGQSVRMTGAAEFVFDGQIQI 275


>gi|123440586|ref|YP_001004580.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166225763|sp|A1JI90|DAPF_YERE8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|122087547|emb|CAL10328.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 274

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 137/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  + + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+   ++A
Sbjct: 121 PNFEPQSVP----FRAAKAEKTYILRAAEHTVLCG--VVSMGNPHCVMQV-DDVSVANVA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQEL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
               V V++ GG L I W    H ++MTG A   ++G
Sbjct: 234 LGEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 270


>gi|225630874|ref|YP_002727665.1| diaminopimelate epimerase [Wolbachia sp. wRi]
 gi|254767123|sp|C0R4N2|DAPF_WOLWR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|225592855|gb|ACN95874.1| diaminopimelate epimerase [Wolbachia sp. wRi]
          Length = 262

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 150/266 (56%), Gaps = 17/266 (6%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           +F KM G GN  ++ID   C  N  +     ++  +    DQ+++I +   A  D F+ I
Sbjct: 8   NFIKMHGTGNNFVIID--SCSANDLNWNYKKIANQNGC--DQVIVITNSSLA--DCFMHI 61

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETI-RGILVAKENRDGSISVDMGEPIL 125
            N DGS+ + CGN  RCV   L S    +  T E + + IL   +  D SI V+MG+P+L
Sbjct: 62  YNADGSKAEMCGNAARCVGYLLMSEKGTEYITIELVNKRILECFKVGDKSIKVNMGKPLL 121

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+      + D  H+ P+    L++P  V++GNPH +FFV D +    L S G 
Sbjct: 122 KWHKIPLST-----ECDTLHL-PIELEMLKDPVAVNIGNPHIVFFV-DSVNEIPLQSLGP 174

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL-HKTNR 244
            L  H +F + +N+SIA+V     + LR WERG G+TA+CGSAACA++V S    + T +
Sbjct: 175 KLENHALFPQKINISIAQVEKSGEIALRVWERGTGITASCGSAACAALVTSTLRGYLTVQ 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGE 270
             SV + GG LLIEW +N  VFMTG+
Sbjct: 235 QTSVNLPGGKLLIEWANN--VFMTGD 258


>gi|312135799|ref|YP_004003137.1| diaminopimelate epimerase [Caldicellulosiruptor owensensis OL]
 gi|311775850|gb|ADQ05337.1| diaminopimelate epimerase [Caldicellulosiruptor owensensis OL]
          Length = 278

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 152/293 (51%), Gaps = 42/293 (14%)

Query: 8   FAKMEGIGNKILVIDMRG-------------CHDNITSDAINALSTDDNTHFDQIMLIHD 54
           F+KM G+GN  +VID RG             CH +I   A            D I+L+ D
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNFLAKRMCHRHIGVGA------------DGILLVLD 50

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE-- 110
            + A  D  +RIIN DGSE + CGNG+RC  +++  R  +K+  F  ET+ GI+  +   
Sbjct: 51  SKLA--DIRMRIINSDGSEAEMCGNGIRCFSKYVFERGIVKKDKFKVETLAGIIEPQLIL 108

Query: 111 NRDG---SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVS--MGNP 165
           N  G    + V+MG+P    K IP+     + D +   I     +  +   + S  MG P
Sbjct: 109 NDYGLVEKVRVNMGKPSFKRKDIPM-----QGDPESDAINTPIEVEGKEYKITSLLMGVP 163

Query: 166 HAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAAC 225
           H + FV DD+   D+ + G  + KH +F    N++  +V    ++ +RTWERG G T AC
Sbjct: 164 HTVLFV-DDVEKVDIYTLGPNIEKHEVFPRKTNVNFVQVIDKNNIKVRTWERGAGATFAC 222

Query: 226 GSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           G+ +CASV+A+     T R  +V +  G L IEW D++ VFMTG A++ + G+
Sbjct: 223 GTGSCASVIAANLNGLTERKANVHLYFGTLEIEWQDDDTVFMTGPAEEVFVGE 275


>gi|186474847|ref|YP_001856317.1| diaminopimelate epimerase [Burkholderia phymatum STM815]
 gi|229807493|sp|B2JJY4|DAPF_BURP8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|184191306|gb|ACC69271.1| Diaminopimelate epimerase [Burkholderia phymatum STM815]
          Length = 286

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 145/285 (50%), Gaps = 16/285 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      N+T   + AL+   N HF    DQ++++       VD  
Sbjct: 5   FTKMHGAGNDFVVLDGYTQPLNLTETQVRALA---NRHFGVGADQLLVVEKPTVDGVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT-SRMK-RKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+  SR+  ++S   +  +G++      +G + VDMG
Sbjct: 62  YRIFNCDGGEVEHCGNGARCFVKFVRDSRLTDKRSVRVQVQKGVITLTMQDNGEVVVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDR---DRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
            P+ +   +P   S  +  R   D  +   VN    R   VVSMGNPHA+  V DD+  +
Sbjct: 122 APVFEPVQVPFDASGVEARREGNDTLYALEVNGE-TRWVSVVSMGNPHAVQVV-DDVEAF 179

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G ++  HP F + VN    ++     + LR +ERG G T ACG+ ACA+V A   
Sbjct: 180 PVLVDGPVIETHPRFPQRVNAGFMQIVGRSEVKLRVYERGAGETLACGTGACAAVAAGIR 239

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDI 281
               +  V V   GG L I W+    + + M G A   +EG++++
Sbjct: 240 RGLLDAPVKVHTHGGTLTITWNGESASSLMMAGPAATVFEGEIEL 284


>gi|156935866|ref|YP_001439782.1| diaminopimelate epimerase [Cronobacter sakazakii ATCC BAA-894]
 gi|166224257|sp|A7MQK2|DAPF_ENTS8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|156534120|gb|ABU78946.1| hypothetical protein ESA_03749 [Cronobacter sakazakii ATCC BAA-894]
          Length = 274

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 133/276 (48%), Gaps = 10/276 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPDMIRRLADRHQGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V   N D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKREIRVSTANGRMVLTVNEDEQVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ +  L+P     +K ++          +      VVSMGNPH +  V DD+    + +
Sbjct: 121 PVFEPSLVPF--RANKAEKTYIMRAAEQTVLCG---VVSMGNPHCVIQV-DDVATAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E  N+   +V + E + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLMESHERFPERANIGFMQVMNTEHIRLRVFERGAGETQACGSGACGAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
              V V + GG L I W    N +FMTG A   ++G
Sbjct: 235 AAQVRVDLPGGRLDIAWKGPGNPLFMTGPATHVYDG 270


>gi|58698204|ref|ZP_00373125.1| diaminopimelate epimerase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58535285|gb|EAL59363.1| diaminopimelate epimerase [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 263

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 150/266 (56%), Gaps = 17/266 (6%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           +F KM G GN  ++ID   C  N  +     ++  +    DQ+++I +   A  D F+ I
Sbjct: 9   NFIKMHGTGNNFVIID--SCSANDLNWNYKKIANQNGC--DQVIVITNSSLA--DCFMHI 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETI-RGILVAKENRDGSISVDMGEPIL 125
            N DGS+ + CGN  RCV   L S    +  T E + + IL   +  D SI V+MG+P+L
Sbjct: 63  YNADGSKAEMCGNAARCVGYLLMSEKGTEHITIELVNKRILECFKVGDKSIKVNMGKPLL 122

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+      + D  H+ P+    L++P  V++GNPH +FFV D +    L S G 
Sbjct: 123 KWHKIPLST-----ECDTLHL-PIELEMLKDPVAVNIGNPHIVFFV-DSVNEIPLQSLGP 175

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL-HKTNR 244
            L  H +F + +N+SIA+V     + LR WERG G+TA+CGSAACA++V S    + T +
Sbjct: 176 KLENHALFPQKINISIAQVEKSGEIALRVWERGTGITASCGSAACAALVTSTLRGYLTVQ 235

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGE 270
             SV + GG LLIEW +N  VFMTG+
Sbjct: 236 QTSVNLPGGKLLIEWANN--VFMTGD 259


>gi|187927149|ref|YP_001897636.1| diaminopimelate epimerase [Ralstonia pickettii 12J]
 gi|309780149|ref|ZP_07674900.1| diaminopimelate epimerase [Ralstonia sp. 5_7_47FAA]
 gi|229813252|sp|B2UD25|DAPF_RALPJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|187724039|gb|ACD25204.1| Diaminopimelate epimerase [Ralstonia pickettii 12J]
 gi|308920852|gb|EFP66498.1| diaminopimelate epimerase [Ralstonia sp. 5_7_47FAA]
          Length = 292

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 139/286 (48%), Gaps = 19/286 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      + T +   A++   + HF    DQ++L+       VD  
Sbjct: 5   FTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIA---DRHFGVGADQLLLVERSTRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG
Sbjct: 62  YRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNGIATLTMQDDGQVTVDMG 121

Query: 122 EPILD---WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLY 176
            P+ +      +P          D  H   +N    R  ++  VSMGNPHA+  V DD  
Sbjct: 122 APVFEAARLPFLPEGLPTRTQGDDTQHALQING---RTEWLSTVSMGNPHAVQIV-DDTE 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G L+  H +F   VN    ++    S+ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 178 AFPVLEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGETLACGTGACAAVVAG 237

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V V   GG L I W  D   V MTG A   +EG LD+
Sbjct: 238 IRRGLLDSPVKVATHGGDLTIAWAGDGQPVMMTGPATTVFEGTLDL 283


>gi|152977227|ref|YP_001376744.1| diaminopimelate epimerase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189082825|sp|A7GUE1|DAPF_BACCN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|152025979|gb|ABS23749.1| Diaminopimelate epimerase [Bacillus cytotoxicus NVH 391-98]
          Length = 288

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 146/291 (50%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHF--DQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   H      A+ A    + NT    D ++LI   + A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEHIPEEELALVAEKVSNRNTGIGADGMILICPSEVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI-- 116
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+   +  I  
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETIFTIETLAGIVTAEVTVENDIVT 119

Query: 117 --SVDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    +P L        R+ F      + F      VSMGNPHA+ FV D
Sbjct: 120 LVKIDMGAPRLTRAELPMLGEGETPFIREDFLFHNQRYAFT----AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + +   ++ R WERG G+T ACG+ ACASV
Sbjct: 175 DVEKAPLTTLGPVLENHEMFPERVNVEFIEILNETEMNFRVWERGSGVTQACGTGACASV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +   V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMITWTEEGTVMMKGPAEVICHGVYEYK 285


>gi|58584775|ref|YP_198348.1| diaminopimelate epimerase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75497789|sp|Q5GSB8|DAPF_WOLTR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|58419091|gb|AAW71106.1| Diaminopimelate epimerase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 259

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/263 (38%), Positives = 149/263 (56%), Gaps = 17/263 (6%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           +M G GN  ++ID R    +I +   N     +    DQI++I +   ++ D F+ I N 
Sbjct: 8   RMYGTGNNFVIIDSR----SINNLNWNYREIANQNGCDQIIVITN--SSAADCFMHIYNA 61

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETI-RGILVAKENRDGSISVDMGEPILDWK 128
           DG EV+ CGN  RCV   + S    +  T E + + IL   +    SI V+MG+P+  W 
Sbjct: 62  DGGEVEMCGNAARCVGYLIMSEKSTEYATIELVNKRILECFKVGGRSIKVNMGKPLFKWH 121

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPL+   D +     H+ P+    L++P  V++GNPH +FFV D++    L S G  L 
Sbjct: 122 EIPLSAKCDPL-----HL-PIELEMLKDPVAVNIGNPHMVFFV-DNISEIPLQSLGPKLE 174

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL-HKTNRAVS 247
           KH +F + VN++IA+V     + LR WERG G+TA+CGSAACA+++AS    +   R  S
Sbjct: 175 KHTLFPKKVNVNIAQVEKSGEISLRVWERGTGITASCGSAACAALIASVLRGYLITRQTS 234

Query: 248 VKMLGGGLLIEWHDNNHVFMTGE 270
           V + GG LLIEW DN  +FMTG+
Sbjct: 235 VNLPGGKLLIEWPDN--IFMTGD 255


>gi|168703359|ref|ZP_02735636.1| diaminopimelate epimerase [Gemmata obscuriglobus UQM 2246]
          Length = 280

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 145/298 (48%), Gaps = 38/298 (12%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G+GN  + +D         +D         + HF    D ++LI   + A  D
Sbjct: 1   MQFTKMHGLGNDYVYVDC--VRQKPPADPAALARAVSDRHFGIGSDGLILICPSEKA--D 56

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILV----AKENRDGS 115
           A +R+ N DGSE + CGNG+RCV +F+  R    +     ET RG+L      +  +   
Sbjct: 57  ARMRMFNADGSESEMCGNGVRCVAKFVHDRGIATKPRLKIETGRGVLTLDLEVRAGKAER 116

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFL---RNPF---VVSMGNPHAIF 169
           + V+MGEPIL+   IP                PVN   +     P+    VSMGNPHA+ 
Sbjct: 117 VRVNMGEPILESAKIPTTLPGAP---------PVNAKLVCAAPTPWEVTCVSMGNPHAVI 167

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           +  DD+   +L   G  L   P F   +N+   +V S   + +RTWERG G+T ACG+ A
Sbjct: 168 YC-DDVAKVELEQVGPKLEHAPEFPRRINVHFVQVHSPNEVTMRTWERGSGVTLACGTGA 226

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKW 286
           C+  VA    H+T R +   + GG L +EW + +N V+MTG A        ++ TG+W
Sbjct: 227 CSVCVAGVLTHRTGRKLLAHLPGGDLELEWSETDNCVYMTGPAT-------EVFTGEW 277


>gi|78779296|ref|YP_397408.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9312]
 gi|78712795|gb|ABB49972.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9312]
          Length = 286

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 148/287 (51%), Gaps = 20/287 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           ++F K +G GN  +VID RG   + N  S+ I  +    N  F    D ++ I +  + +
Sbjct: 4   INFEKYQGNGNDFVVIDSRGNDLYKNYKSNKIFDIKQICNRQFGIGADGVIFIEEPNEDN 63

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGS 115
               I I N DGSE Q CGNG+RC+V +L    +   K   +  ET  G+ +AK   D  
Sbjct: 64  YAKMI-IFNSDGSEAQMCGNGIRCLVEYLHVNDSMNNKNIEYKIETKAGLKIAKYIND-E 121

Query: 116 ISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           I+V MG PIL+ + IP  + +  + +    F    +   F    + V MGNPH IFFV+D
Sbjct: 122 ITVKMGVPILESQNIPTTIEKKINSIPSHEF----IEKNFNNMGYAVGMGNPHLIFFVKD 177

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    L   G +  K+ +F E  N+   ++ + +++ ++ WERG G T ACG+ ACA  
Sbjct: 178 -IESIVLYRLGPIFEKNELFPEKTNVHFCQIINRDNIKVKVWERGAGPTLACGTGACAIH 236

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
           VA+  L   N    V + GG L I+W  D+  V MTG AKK + G +
Sbjct: 237 VAAYKLGLCNPQTIVTLPGGNLKIDWSKDDFEVMMTGNAKKVFSGSM 283


>gi|229014125|ref|ZP_04171246.1| Diaminopimelate epimerase [Bacillus mycoides DSM 2048]
 gi|229135766|ref|ZP_04264537.1| Diaminopimelate epimerase [Bacillus cereus BDRD-ST196]
 gi|229169661|ref|ZP_04297362.1| Diaminopimelate epimerase [Bacillus cereus AH621]
 gi|228613804|gb|EEK70928.1| Diaminopimelate epimerase [Bacillus cereus AH621]
 gi|228647691|gb|EEL03755.1| Diaminopimelate epimerase [Bacillus cereus BDRD-ST196]
 gi|228747079|gb|EEL96961.1| Diaminopimelate epimerase [Bacillus mycoides DSM 2048]
          Length = 288

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 153/293 (52%), Gaps = 23/293 (7%)

Query: 4   SMVDFAKMEGIGNKILVIDM-----RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDA 58
           S   F KM G+GN  + ++M     R     I ++ ++ ++T      D ++LI     A
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIREEDLAIVAEKVSNINTGIGA--DGMILICPSDVA 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENR 112
            V   +R+ N DGSE +SCGNG+RCV ++      ++ K FT ET+ GI+ A+    +++
Sbjct: 60  PVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEGKVFTIETLAGIVTAEVTVEDDK 117

Query: 113 DGSISVDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
                +DMG P L  + IP L        R+ F     NH +      VSMGNPHA+ FV
Sbjct: 118 VTLAKIDMGAPRLTREEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV 173

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA
Sbjct: 174 -DDVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACA 232

Query: 232 SVVASGCLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           +VVA+    K    + ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 233 AVVAAILNGKMEHGKEITVHLAGGDLMIAWTEEGNVLMKGPAEIICRGVYEYK 285


>gi|57864906|gb|AAW57080.1| diaminopimelate epimerase 2 [cyanobacterium endosymbiont of
           Rhopalodia gibba]
          Length = 279

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 135/279 (48%), Gaps = 9/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQD-ASVDAFI 64
           + F K  G+GN +++I  R  +  + S   +    D +       +I       + D  +
Sbjct: 3   IAFTKYHGLGNDLILIHNRLSNSPLVSPEQSVKMCDRHFGIGADGVIFALPGIGNTDYTM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISVDM 120
           RI+N DGSE Q CGNG+RC+ R +          K+++  T  G++  +   +G + VDM
Sbjct: 63  RILNPDGSEPQMCGNGIRCLARLIAQLEGGETLGKTYSIHTPTGVISPRLEAEGQVRVDM 122

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L    IP              +     L+L     VSMGNPH I FVED     DL
Sbjct: 123 GTPYLFAHEIPTTLGNPNETVINKPLAVAGKLWLVT--CVSMGNPHCITFVEDA-SAIDL 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G     H MF E +N     V   + L +R WERG G T ACG+ ACASVVA     
Sbjct: 180 AVLGLQFEYHQMFPERINTEFIEVVRPDYLKMRVWERGAGATLACGTGACASVVAGVLTE 239

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGK 278
              R  +V++ GG L+IEW + +N ++MTG+A+  + G 
Sbjct: 240 NCARNCTVELPGGCLMIEWSEVDNRLYMTGQAQLVFTGS 278


>gi|332159816|ref|YP_004296393.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607641|emb|CBY29139.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664046|gb|ADZ40690.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862563|emb|CBX72717.1| diaminopimelate epimerase [Yersinia enterocolitica W22703]
          Length = 274

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 137/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  + + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+   ++A
Sbjct: 121 PNFEPQSVP----FRAAKAEKTYILRAAEHTVLCG--VVSMGNPHCVMQV-DDVSVANVA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAIGIQQEL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
               V V++ GG L I W    H ++MTG A   ++G
Sbjct: 234 LGEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 270


>gi|75758928|ref|ZP_00739039.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218900087|ref|YP_002448498.1| diaminopimelate epimerase [Bacillus cereus G9842]
 gi|228968042|ref|ZP_04129049.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|226724203|sp|B7IMV5|DAPF_BACC2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|74493602|gb|EAO56707.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218543171|gb|ACK95565.1| diaminopimelate epimerase [Bacillus cereus G9842]
 gi|228791665|gb|EEM39260.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar sotto
           str. T04001]
          Length = 288

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 149/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLVLVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + +   ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNDAEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|33520022|ref|NP_878854.1| diaminopimelate epimerase [Candidatus Blochmannia floridanus]
 gi|81666875|sp|Q7VRM5|DAPF_BLOFL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33504368|emb|CAD83261.1| diaminopimelate epimerase [Candidatus Blochmannia floridanus]
          Length = 276

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 103/287 (35%), Positives = 152/287 (52%), Gaps = 26/287 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  ++ID         SD I +LS       FDQ++++    D ++D   RI
Sbjct: 3   FSKMHGLGNDFVIIDSITQKVYFNSDKIRSLSNRFYGIGFDQLLVVEPPYDPNIDFHCRI 62

Query: 67  INCDGSEVQSCGNGMRCVVRF-----LTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
            N DGSEV  CGNG+RCV RF     LT++  +K  + T+  +  +L ++      ISV+
Sbjct: 63  YNADGSEVYQCGNGIRCVARFVCIKKLTNKQHIKISTDTYSMMLSVLDSE-----FISVN 117

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED-DLYHY 178
           MGEPI D   IP    F    +  + +   N   L    VVS+GNPH +  VE  DL   
Sbjct: 118 MGEPIFDPIKIPF---FSTQYQKMYVLFVPNFTILCG--VVSIGNPHCVILVEQVDL--V 170

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VA 235
            +   G++L  H  F +  N+S  ++ S  ++ LR +ERG G T ACGSAACA+V   + 
Sbjct: 171 PVTVLGSILENHHCFPKKANISFMQIISQNNIKLRVYERGSGETKACGSAACAAVAIGIQ 230

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            G L K N +V V + GG L I W    + ++M G A   ++G +++
Sbjct: 231 QGLLKK-NISVQVNLPGGDLFISWKGLGYPLYMIGSATYIYDGCINL 276


>gi|256821401|ref|YP_003145364.1| diaminopimelate epimerase [Kangiella koreensis DSM 16069]
 gi|256794940|gb|ACV25596.1| diaminopimelate epimerase [Kangiella koreensis DSM 16069]
          Length = 276

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 146/281 (51%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F+KM+G+GN  +V+D       +    I  L+  +    FDQ++++   Q    D  
Sbjct: 2   IMPFSKMQGLGNDFVVVDAISQPVYLNQGQIAKLAHRNFGIGFDQLLIVEAPQHPESDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSE   CGNG R V +++  +    ++     T    + A    +G +++DMG
Sbjct: 62  FRIFNADGSEAGHCGNGARAVAKYVRQKGLTWKRQLRLSTNTATMQATLEDNGLVTIDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P L+   IPL R  +K        G +++        VSMGNPH +  V D++    + 
Sbjct: 122 KPRLEPAQIPL-RFAEKQTLYSIDAGGISYKV----GAVSMGNPHCVLKV-DNVEKAPVQ 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L++H  F    N    ++   +++ LR +ERGVG T ACG+ ACA+VV +     
Sbjct: 176 TVGPMLSQHKYFPSQANAGFMQIVDRQNIKLRVYERGVGETLACGTGACAAVVVARLQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           T+  V V + GG L I W  + + VFM+G AK  +EG+++I
Sbjct: 236 TDDKVKVMLPGGSLWITWQGEGSRVFMSGPAKVVFEGQVEI 276


>gi|325111163|ref|YP_004272231.1| diaminopimelate epimerase [Planctomyces brasiliensis DSM 5305]
 gi|324971431|gb|ADY62209.1| diaminopimelate epimerase [Planctomyces brasiliensis DSM 5305]
          Length = 281

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 143/292 (48%), Gaps = 23/292 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASVDAFIR 65
           F KM G GN  + +D+      + +  +    +D +T    D ++LI     A  DA +R
Sbjct: 3   FTKMHGAGNDYVYVDLFREELPVDAPELARQVSDRHTAIGSDGLILIQPSDKA--DARMR 60

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGSISVD 119
           + N DGSE + CGNG+RCV +++      +++  T ET  G+L  +    + R   + V+
Sbjct: 61  MFNADGSEAEMCGNGLRCVAKYVYDHDIARKEELTLETGAGLLTVQVFPEDGRVKQVRVN 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG+PIL+   IP   + D        +G            VSMGNPH I FV D L    
Sbjct: 121 MGQPILESAKIPTTLAGDPPVEADLQVGDQTLKVT----CVSMGNPHCITFV-DKLSDEW 175

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + KH +F   VN     V S   L++R WERG G T ACG+ ACA  VA    
Sbjct: 176 VHGVGPQVEKHTVFPNRVNAEFIEVISPTELNMRVWERGSGETMACGTGACAVAVAGVLS 235

Query: 240 HKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIKTGKWIKKN 290
            +  R V++ +LGG L +EW  +   VFMTG A       +++ +G+W   N
Sbjct: 236 GRCERKVTIHLLGGDLELEWSEETGEVFMTGPA-------VEVYSGEWTGGN 280


>gi|189461606|ref|ZP_03010391.1| hypothetical protein BACCOP_02265 [Bacteroides coprocola DSM 17136]
 gi|189431716|gb|EDV00701.1| hypothetical protein BACCOP_02265 [Bacteroides coprocola DSM 17136]
          Length = 266

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 139/284 (48%), Gaps = 28/284 (9%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G GN  + ++ +R   DN    ++           D ++LI     A  D  +
Sbjct: 3   IEFTKMHGAGNDYIYVNTLRYPIDNPEELSVEWSRYHTGIGSDGLVLICPSDQA--DFKM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK-----ENRDGSIS 117
           RI N DGSE + CGN  RC+ ++L       +     ET+ GI +       +N   S++
Sbjct: 61  RIFNADGSEARMCGNASRCIGKYLYEEGLTNKTDIQLETLSGIKILHLHLNDKNTVESVT 120

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P  D   + L   +                       VSMGNPH + FV D++  
Sbjct: 121 VDMGIPT-DIHEVALGEGY----------------IASKGIAVSMGNPHLVIFV-DEINK 162

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G  L  HP+F + VN+   +V +   + +R WERG G+T ACG+ ACA+ VAS 
Sbjct: 163 IKLEEVGPALEHHPLFPDRVNVEFVQVLTDSKVRMRVWERGSGITQACGTGACATAVASA 222

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              +  R  S+ M GG L IEW  +NH++MTG A K ++GK++I
Sbjct: 223 FTDRCGRKSSIVMDGGTLEIEWAGDNHIYMTGPATKVFDGKIEI 266


>gi|291524551|emb|CBK90138.1| diaminopimelate epimerase [Eubacterium rectale DSM 17629]
          Length = 285

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 148/293 (50%), Gaps = 30/293 (10%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  + +++    + +   A  ++   D  HF    D ++ I     A  D  
Sbjct: 3   FTKMHGCGNDYVYVNL--FEEKLGDPARVSIYVSDR-HFGIGSDGLITIGPSDKA--DFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +RI N DGSE + CGNG+RCV +++       +   + ET  GI    L  +EN+   + 
Sbjct: 58  MRIYNADGSEAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVEENKVSQVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHI--GPVN------HLFLRNPFVVSMGNPHAIF 169
           VDMGEPIL    IP+ ++      D + +   P++      H+       VSMGNPHA+ 
Sbjct: 118 VDMGEPILTPGDIPVVKADGSAYGDDYRVIDEPISAGNREWHMTC-----VSMGNPHAVV 172

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           FV DD+  ++L  +G L   H MF +  N     + S     +R WERG   T ACG+  
Sbjct: 173 FV-DDVAGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWERGSAETWACGTGT 231

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           CA+V+A     KT+  V V + GG L IE+    NHVFMTG A + + G++DI
Sbjct: 232 CATVMACILNKKTDNKVLVHLRGGDLTIEYIPKTNHVFMTGPATEVFSGEIDI 284


>gi|113866258|ref|YP_724747.1| diaminopimelate epimerase [Ralstonia eutropha H16]
 gi|123134519|sp|Q0KF42|DAPF_RALEH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|113525034|emb|CAJ91379.1| diaminopimelate epimerase [Ralstonia eutropha H16]
          Length = 288

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 147/291 (50%), Gaps = 25/291 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F KM G GN  +V+D  G H  I  T     AL++    HF    DQI+++       
Sbjct: 3   LQFTKMHGAGNDFVVLD--GIHQQIDLTPAQWRALAS---RHFGVGADQILIVEKPSRPD 57

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI+N DGSEV+ CGNG RC VRF+T +    ++S   E + G++      DG ++
Sbjct: 58  VDFRYRIVNADGSEVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNGVITLTLQDDGQVT 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDR----DRFHIGPVNHLFLRNPF--VVSMGNPHAIFFV 171
           VDMG P L+   +P  R+     R    D  +   VN    R  +  VVSMGNPHA+  V
Sbjct: 118 VDMGAPELEPARVPF-RAEGLPTRAEGADTLYGLEVNG---RTEWISVVSMGNPHAVQVV 173

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+ ++ +   G ++  H  F   VN    +V    ++ LR +ERG G T ACG+ ACA
Sbjct: 174 -DDVENFPVLQDGPVVEHHAAFPNRVNAGFMQVQDRHAIRLRVYERGAGETLACGTGACA 232

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
           +VVA       +  V V   GG L I W      V MTG A   +EG +D+
Sbjct: 233 AVVAGIRRGLLDSPVRVHTHGGDLTIAWDGGAEPVRMTGPATTVFEGSIDL 283


>gi|307257602|ref|ZP_07539362.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306863905|gb|EFM95828.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
          Length = 279

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 139/288 (48%), Gaps = 24/288 (8%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M  + + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  
Sbjct: 1   MIGNNMQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPE 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + 
Sbjct: 61  LDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVR 120

Query: 118 VDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF------VVSMGNPHAIFF 170
           V+MG PI +   +P  A  F+K            +  LR         VVSMGNPH +  
Sbjct: 121 VNMGGPIWEPAQVPFTANKFEK------------NYILRTDLQTVLCGVVSMGNPHCVLQ 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           VED +    +   G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC
Sbjct: 169 VED-INLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +V         +  V V + GG L IEW    H ++MTG+A   ++G
Sbjct: 228 GAVAVGIMQGVLDNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDG 275


>gi|218442032|ref|YP_002380361.1| diaminopimelate epimerase [Cyanothece sp. PCC 7424]
 gi|226724206|sp|B7KH06|DAPF_CYAP7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218174760|gb|ACK73493.1| Diaminopimelate epimerase [Cyanothece sp. PCC 7424]
          Length = 281

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 145/287 (50%), Gaps = 19/287 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K  G+GN  ++ID R   + + S  +     D   HF    D ++ +     +  D
Sbjct: 3   IEFTKYHGLGNDFILIDNRHGSEPMVSPEMAVEMCDR--HFGIGADGVIFVLP-GTSQTD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKR----KSFTFETIRGILVAKENRDGSIS 117
             +RI N DGSE + CGNG+RC+ +F+    K     KS+  +T+ G++  +      ++
Sbjct: 60  YQMRIFNSDGSEPEMCGNGIRCLAQFIAELEKTTEVGKSYRIDTLGGLMTPRLEAQEQVT 119

Query: 118 VDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P L    IP  L    +K+      +   + L       VSMGNPH I FVED +
Sbjct: 120 VDMGLPRLLGSEIPTTLVSRTEKVIDQPIEVAGQSWLVT----CVSMGNPHCITFVED-V 174

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L + G     H  F +  N     V   + L +R WERG G+T ACG+ ACASVVA
Sbjct: 175 KSIALETIGPQFEHHVAFPQRTNTEFIEVLRPDYLKMRVWERGAGITLACGTGACASVVA 234

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
                K++R  +V++ GG L I W + + HV+MTG AK+ + G  ++
Sbjct: 235 GVLTGKSDRRCTVELPGGCLSIYWSETDGHVYMTGPAKRVFTGVYEM 281


>gi|119475310|ref|ZP_01615663.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2143]
 gi|119451513|gb|EAW32746.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2143]
          Length = 276

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 148/290 (51%), Gaps = 28/290 (9%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           ++ F KM+G+GN  +V+D+     N+ ++ +  L+   + HF    DQ++++       V
Sbjct: 2   LLRFTKMQGLGNDFVVLDLVTQRFNLQAEHVRKLA---DRHFGIGCDQLLVVETPMQPDV 58

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI N DG+EV+ CGNG RC  +F+  +    +     ET  GI+      D  I V
Sbjct: 59  DFRYRIYNGDGNEVEQCGNGARCFAKFVRDKKLTGKNKIRVETNSGIIELSVMEDRQIRV 118

Query: 119 DMGEPILDWKLIPLARSFDK------MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
           +MG+P+L+   IP   S         +D +   I             VS+GNPHAI  VE
Sbjct: 119 NMGKPLLEPADIPFTASKRANTYTLLVDDEEVSIS-----------AVSVGNPHAIITVE 167

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           D +    ++  G  +  H  F + VN+   +V S + ++LR +ERG G T ACGS ACA+
Sbjct: 168 D-IDTAPVSILGPAIECHTDFPQRVNVGFMQVVSRKEINLRVFERGAGETLACGSGACAA 226

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +V+       ++ ++  + GG L +EWH   H V MTG A   +EG++ +
Sbjct: 227 MVSGQLQGLLDQQITANLSGGSLTLEWHGEGHPVMMTGPASNVFEGQITL 276


>gi|197287149|ref|YP_002153021.1| diaminopimelate epimerase [Proteus mirabilis HI4320]
 gi|229813240|sp|B4F1X7|DAPF_PROMH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|194684636|emb|CAR46550.1| diaminopimelate epimerase [Proteus mirabilis HI4320]
          Length = 274

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 148/284 (52%), Gaps = 18/284 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLANRHTGVGFDQLLVVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF-----LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
           RI N DGSEV  CGNG RC  RF     LT++ + K  T ++ R  L   +N D  + V+
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNKREIKVST-QSGRMTLHVMDNED--VCVN 117

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MGEP  + + +P  A+  +K     + I  +    L    VVSMGNPH +  VED +   
Sbjct: 118 MGEPEFEPQKVPFRAQKVEKT----YIIRAMERTVLCG--VVSMGNPHCVIQVED-IKTA 170

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++ S G++L +H  F E  N+   +V    +L LR +ERG G T ACGS ACA+V     
Sbjct: 171 EVESLGSVLEQHERFPERANIGFMQVVDRNTLHLRVFERGAGETQACGSGACAAVAVGIS 230

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
               +R V V + GG L IEW    N ++MTG A   ++G + +
Sbjct: 231 QGLLDRKVKVNLPGGSLSIEWKGTGNPLYMTGPAVHIYDGTIQL 274


>gi|261823391|ref|YP_003261497.1| diaminopimelate epimerase [Pectobacterium wasabiae WPP163]
 gi|261607404|gb|ACX89890.1| diaminopimelate epimerase [Pectobacterium wasabiae WPP163]
          Length = 274

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 142/278 (51%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  + + +P    F  +  ++ +I   + H  L    VVSMGNPH +  V DD+    + 
Sbjct: 121 PNFEPQQVP----FRAVKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQV-DDVETAKVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F E  N+   ++   +++ LR +ERG G T ACGS ACA+ VA G L  
Sbjct: 174 TLGPLLESHERFPERANIGFMQIVDSQTVRLRVYERGAGETQACGSGACAA-VAVGILQG 232

Query: 242 TNRA-VSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
           +  A V V + GG L I+W    H +FMTG A   ++G
Sbjct: 233 SLSAKVRVSLPGGELDIQWDGPGHPLFMTGPATHVYDG 270


>gi|27905004|ref|NP_778130.1| diaminopimelate epimerase [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|29839276|sp|P59582|DAPF_BUCBP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|27904402|gb|AAO27235.1| diaminopimelate epimerase [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 286

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 148/284 (52%), Gaps = 17/284 (5%)

Query: 2   QSSMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           +S  + F+KM G+GN  ++I+ M      +TS+ I  LS       FDQ++L+ + ++ +
Sbjct: 8   KSVKIKFSKMHGLGNDFIIINAMMQKTFPVTSNIIQNLSNRYTGIGFDQLLLVENSKNVN 67

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N +G+EV  CGNG RC   F  L    K+++    T    L+     +G++ 
Sbjct: 68  IDFHYRIFNANGTEVSQCGNGARCFALFVLLKKLTKKRTLYVSTNTTTLILNVLNNGNVC 127

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P    K I      + ++     I  VN +   N  +VS+GNPH I +V ++L  
Sbjct: 128 VDMGVPCFKLKNI---FGENIIENSLHSIKFVNKII--NYDLVSIGNPHCIIYV-NNLKK 181

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---V 234
           Y +   G  L+ H +F EG+N++   V S   + LR +ERGVG T ACGS ACASV   +
Sbjct: 182 YPVKKIGFYLSTHKIFPEGINVNFVEVLSKNEIALRVYERGVGETLACGSGACASVALGI 241

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
             G L      V V +L G L I W   +  ++MTG A   ++G
Sbjct: 242 QQGLLF---NEVQVNLLNGILKINWKGGSEKLYMTGPAVHVYDG 282


>gi|223673992|pdb|3EJX|A Chain A, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673993|pdb|3EJX|B Chain B, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673994|pdb|3EJX|C Chain C, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673995|pdb|3EJX|D Chain D, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673996|pdb|3EJX|E Chain E, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673997|pdb|3EJX|F Chain F, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223674010|pdb|3EKM|A Chain A, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674011|pdb|3EKM|B Chain B, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674012|pdb|3EKM|C Chain C, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674013|pdb|3EKM|D Chain D, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674014|pdb|3EKM|E Chain E, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674015|pdb|3EKM|F Chain F, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
          Length = 317

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 140/289 (48%), Gaps = 17/289 (5%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-V 60
           ++ ++ F K  G+GN  +++D R   +   +    A   D N       +I      +  
Sbjct: 23  ETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVNGT 82

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC  RF   L +   + SFT  T  G++V +   DG + 
Sbjct: 83  DYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQVK 142

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE----- 172
           VDMG PIL  + +P   S +K +        V      N   VSMGNPH I F +     
Sbjct: 143 VDMGTPILKAQDVPTKLSGNKGEA-VVEAELVVDGVSWNVTCVSMGNPHCITFGKKGGPN 201

Query: 173 ---DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
              DDL   +L   G     H MF    N     V S   L +R WERG G T ACG+ A
Sbjct: 202 LKVDDL---NLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWERGAGATLACGTGA 258

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEG 277
           CA VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G
Sbjct: 259 CALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYG 307


>gi|124023206|ref|YP_001017513.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9303]
 gi|123963492|gb|ABM78248.1| Diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9303]
          Length = 323

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 145/289 (50%), Gaps = 22/289 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINA----LSTDDNTHF----DQIMLIHDFQ 56
           M+ F+K +G+GN  ++ID R     ++   IN     +    + HF    D ++L    +
Sbjct: 1   MLQFSKYQGLGNDFVLIDGR--EGQLSDQVINPDPAWVRKICDRHFGIGADGLILALPPR 58

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLT---SRMKRKSFTFETIRGILVAKENRD 113
            A  D  ++I N DGS  + CGNG+RC+ RFL      +  + +  ET+ GI+      D
Sbjct: 59  -ADGDLRMQIFNADGSLAEMCGNGIRCLTRFLADIDGDLCAQRWNIETLAGIICPILQED 117

Query: 114 GSISVDMGEPILDWKLIPLARSFDK--MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           G I VDMG P LD + IP   +     + +   H+G  +     N   V MGNPH I  V
Sbjct: 118 GQICVDMGSPFLDPESIPTTLTIGSAGLPQGECHLGGTS----LNVAAVGMGNPHVIVPV 173

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
           ED L       +G +L KH  F    N+   ++ S   L++R WERG G T ACG+ ACA
Sbjct: 174 ED-LESIPFEKWGQILEKHQTFPAKTNVHFLKIHSTNQLEIRVWERGSGPTLACGTGACA 232

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           S+VA+  L  ++    V + GG L I W      VFMTG A+  ++G L
Sbjct: 233 SLVAACLLGLSDDHAEVLLPGGVLQISWPGRRGSVFMTGPAEPVFDGVL 281


>gi|227357158|ref|ZP_03841527.1| diaminopimelate epimerase [Proteus mirabilis ATCC 29906]
 gi|227162690|gb|EEI47657.1| diaminopimelate epimerase [Proteus mirabilis ATCC 29906]
          Length = 274

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 148/284 (52%), Gaps = 18/284 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLANRHTGVGFDQLLVVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF-----LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
           RI N DGSEV  CGNG RC  RF     LT++ + K  T ++ R  L   +N D  + V+
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKREIKVST-QSGRMTLHVMDNED--VCVN 117

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MGEP  + + +P  A+  +K     + I  +    L    VVSMGNPH +  VED +   
Sbjct: 118 MGEPEFEPQKVPFRAQKVEKT----YIIRAMERTVLCG--VVSMGNPHCVIQVED-IKTA 170

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++ S G++L +H  F E  N+   +V    +L LR +ERG G T ACGS ACA+V     
Sbjct: 171 EVESLGSVLEQHERFPERANIGFMQVVDRNTLHLRVFERGAGETQACGSGACAAVAVGIS 230

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
               +R V V + GG L IEW    N ++MTG A   ++G + +
Sbjct: 231 QGLLDRKVKVNLPGGSLSIEWKGTGNPLYMTGPAVHIYDGTIQL 274


>gi|22299837|ref|NP_683084.1| diaminopimelate epimerase [Thermosynechococcus elongatus BP-1]
 gi|29839316|sp|Q8DGM2|DAPF_THEEB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|22296021|dbj|BAC09846.1| diaminopimelate epimerase [Thermosynechococcus elongatus BP-1]
          Length = 286

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 148/291 (50%), Gaps = 25/291 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F K +G+GN  L+ID R   + + +        D   HF    D ++ +      S D
Sbjct: 3   LSFQKYQGLGNDFLLIDNRHQEELLLTPEQAQFWCD--RHFGVGADGVIFLLRGTGES-D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS-----FTFETIRGILVAKENRDGSI 116
             +R+ N DGS  Q CGNG+RC+ +F+ +   R +     +  +T+ G++V +   DG +
Sbjct: 60  YRMRMYNADGSVAQMCGNGIRCLAKFIFALEGRSAGEIVRYRIDTLAGLIVPEVQADGQV 119

Query: 117 SVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           +VDMG+P L  + IP  LA +  K+      +G    L       VSMGNPH + FVED 
Sbjct: 120 TVDMGKPRLLAQQIPTTLAAADQKVVDVPLTVGDRQWLVT----CVSMGNPHCVTFVED- 174

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +   DLA  G     HP F +  N    +V   + L +R WERG G+T ACG+ ACA++V
Sbjct: 175 VAALDLAVLGPQFEHHPAFPQRTNTEFVQVLGSDRLRMRVWERGAGMTLACGTGACATLV 234

Query: 235 A---SGCLHKT--NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           A   +GCL         +V++ GG L I W   + H++MTG A   + G L
Sbjct: 235 AAVLTGCLSPGGDQAQATVELPGGDLQIRWDLPSQHLYMTGPALAVFSGTL 285


>gi|45358480|ref|NP_988037.1| diaminopimelate epimerase [Methanococcus maripaludis S2]
 gi|74554659|sp|Q6LYS1|DAPF_METMP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|44921238|emb|CAF30473.1| Diaminopimelate epimerase [Methanococcus maripaludis S2]
          Length = 277

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 144/282 (51%), Gaps = 15/282 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN  + +D          + I+   +D +       L+        D  +R+ 
Sbjct: 3   FTKMHGLGNDYIYVDAISQKIE-NPNEISKFVSDRHFGIGSDGLVLILPSDVADFKMRMF 61

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISVDMG 121
           N DGSE + CGN +RCV +F+  +    + + T ET+ GI V +   +      + VDMG
Sbjct: 62  NSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTIENGKVVLVKVDMG 121

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EPIL  + IP L+     +D +   I   ++ +  N   VSMGNPHAI ++E+ +  + L
Sbjct: 122 EPILKAEEIPVLSEKHPVIDEE---ITAKDYCY--NFTCVSMGNPHAITYIEN-VDEFPL 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L   H  F    N+    +    ++ +R WERG G T ACG+ ACA + AS    
Sbjct: 176 EKIGPLFEIHEKFPRKTNVEFVELIDKNTVKMRVWERGAGETLACGTGACAVLTASVLKG 235

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              R  +VK+LGG L IEW++ + H++MTG A   +EG++DI
Sbjct: 236 YVGRKATVKLLGGDLTIEWNEFDKHIYMTGPATTVFEGEIDI 277


>gi|320101594|ref|YP_004177185.1| diaminopimelate epimerase [Isosphaera pallida ATCC 43644]
 gi|319748876|gb|ADV60636.1| diaminopimelate epimerase [Isosphaera pallida ATCC 43644]
          Length = 293

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 140/289 (48%), Gaps = 20/289 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHF----DQIMLIHDFQDAS-VD 61
           F KM GIGN  + I      D    D  +AL+    + HF    D ++L+   +  S  D
Sbjct: 5   FVKMHGIGNDYIYIS---GFDQPIPDDPSALAVRIADRHFGVGGDGLILVLPPEPGSEAD 61

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTS---------RMKRKSFTFETIRGILVAKENR 112
           A +R+ N DGSE   CGNG+RCV +FL           R+K K     ++   +    +R
Sbjct: 62  AVMRMFNADGSEGGMCGNGIRCVAKFLYDSGYVRAPRIRVKTKGAGVLSLDLEIDPASDR 121

Query: 113 DGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
              + V+MG PIL    IP     D        +             VSMGNPH + FVE
Sbjct: 122 VRRVRVEMGAPILRASAIPTTLPGDPPLDYPIAVTYDGKTITYRGTAVSMGNPHLVMFVE 181

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           D +   DL   G LL +H  F + VN+ +A+V + +   +RTWERG G+T ACG+ ACA 
Sbjct: 182 D-VASIDLERIGPLLERHEAFPDRVNVHVAQVDAPDVARMRTWERGSGITLACGTGACAV 240

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLD 280
           +VA     +T RA  + + GG L +EW  D   V MTG A   +EG  D
Sbjct: 241 LVAGVLTGRTARAARIHLPGGALDLEWPRDGETVIMTGPAVTVFEGVWD 289


>gi|148239598|ref|YP_001224985.1| diaminopimelate epimerase [Synechococcus sp. WH 7803]
 gi|147848137|emb|CAK23688.1| Diaminopimelate epimerase [Synechococcus sp. WH 7803]
          Length = 368

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 148/289 (51%), Gaps = 20/289 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-----DNTHF----DQIMLIHDF 55
           M+ F+K +G+GN  ++++ R   D   S++I +  +D      +  F    D ++L    
Sbjct: 1   MLQFSKYQGLGNDFILVEGR---DGRLSESIVSPDSDWVRKICDRRFGLGGDGLILALPP 57

Query: 56  QDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFETIRGILVAKENR 112
           Q    +  +RI N DGSE + CGNG+RC+ RFL         +S++ ET  G+++ +  +
Sbjct: 58  QGQG-ELRMRIFNADGSEAEMCGNGIRCLARFLADSDGDSPGRSWSIETPAGMIIPELQQ 116

Query: 113 DGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
           DG I VDMG P L  +++P   S D     R  +         +   V MGNPH +  V 
Sbjct: 117 DGQIRVDMGAPFLKPEMVPTLLSPDAKGLPRGEVS--REGLTLSLAAVGMGNPHVVVPV- 173

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DDL      + G  L   P+F    N+   +V   + L++R WERG G T ACG+ ACA+
Sbjct: 174 DDLEAIPFEALGAQLECDPLFPAKTNVHFLKVHGRQHLEIRVWERGAGPTLACGTGACAT 233

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLD 280
           +VA+  +  ++   +V + GG L I W D    VFMTG A   ++G ++
Sbjct: 234 LVAAVLMGLSDSEATVVLPGGPLSIRWSDQQGSVFMTGPAVAVFDGVMN 282


>gi|224542137|ref|ZP_03682676.1| hypothetical protein CATMIT_01312 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524974|gb|EEF94079.1| hypothetical protein CATMIT_01312 [Catenibacterium mitsuokai DSM
           15897]
          Length = 279

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 144/285 (50%), Gaps = 22/285 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           M+ F KMEGIGN  +  D  G + ++ +D    +    N H     D +++I      + 
Sbjct: 1   MLKFLKMEGIGNDYVYFD--GINQDVPTDE-TFIKKVSNRHIGIGSDGVIII--LPSETC 55

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDG--- 114
           D  +R+ N DGSE + CGNG+RC  +F+  +    + +   ET+ GI   + N  DG   
Sbjct: 56  DFRMRMFNLDGSEGKMCGNGIRCFSKFVYDQGLTDKTTLKIETLAGIRTCELNVEDGKVT 115

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           S+ VDMGEPI     IP+  S  +M      I    +        VSMGNPH I +V  D
Sbjct: 116 SVCVDMGEPITLCSDIPVNYSKVEMVNAPIEIDGNTYYCT----AVSMGNPHVIQYV--D 169

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
              +D+ + G       +F E VN    +V   E L +R WERG G T ACG+ ACA + 
Sbjct: 170 TLDFDIEAIGPKFEHASLFPESVNTEFVKVVDREHLKMRVWERGSGETMACGTGACAVMY 229

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           AS   +K +  V V++LGG L IE  D   +FMTG A+  +EG L
Sbjct: 230 ASYLNNKCDEKVDVELLGGHLQIELRDKK-IFMTGPARTTFEGTL 273


>gi|288941803|ref|YP_003444043.1| diaminopimelate epimerase [Allochromatium vinosum DSM 180]
 gi|288897175|gb|ADC63011.1| diaminopimelate epimerase [Allochromatium vinosum DSM 180]
          Length = 278

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 136/287 (47%), Gaps = 28/287 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH---FDQIMLIHDFQDASVDAFI 64
           F KM+G+GN  +V D  G    +  DA  A    D       DQI+L+   +    D   
Sbjct: 5   FTKMQGLGNDFVVFD--GVRQRVDLDAGFARLLADRRFGIGCDQILLVEPPRLPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +    +      T  G +      DG + VDMG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVRDQGLTDKDEIPVGTAAGAIRLYLEPDGQVRVDMGA 122

Query: 123 PILDWKLIPLARSFDKMD-------RDR-FHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           P      IP +   +  D        DR   IG            +SMGNPHA+  V DD
Sbjct: 123 PAFTPARIPFSVETETADATYPLEIEDRTLTIG-----------ALSMGNPHAVLIV-DD 170

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    +A+ G L+  HP F   VN    ++    ++ LR  ERG G T ACG+ ACA+VV
Sbjct: 171 VESAPVATLGPLIEHHPDFPRRVNAGFMQILGPNAIRLRVHERGAGETLACGTGACAAVV 230

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLD 280
           +     + +  V V + GG L+IEW    H V+MTG A   +EG+++
Sbjct: 231 SGRRRGRLDERVRVALPGGELVIEWRGPGHPVWMTGPAVNVFEGEIE 277


>gi|254246906|ref|ZP_04940227.1| Diaminopimelate epimerase [Burkholderia cenocepacia PC184]
 gi|124871682|gb|EAY63398.1| Diaminopimelate epimerase [Burkholderia cenocepacia PC184]
          Length = 309

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 143/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGA 79

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 80  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDQRSVRVQVMKGLITLTLQDNGEVVV 139

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P  A   D     R  + P++     R    VSMGNPHA+  V DD+ 
Sbjct: 140 DMGAPVFAPAQVPFDAAGLDSRQEGRDTLWPLDVGGATRWISTVSMGNPHAVQVV-DDVE 198

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 199 AYPVLEEGPLIERHARFPQRVNAGFMQIVSRREVKLRVYERGAGETLACGTGACAAVAAG 258

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 259 IRRGLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPATTVFEGEIDL 307


>gi|15231841|ref|NP_190926.1| diaminopimelate epimerase family protein [Arabidopsis thaliana]
 gi|75263858|sp|Q9LFG2|DAPF_ARATH RecName: Full=Diaminopimelate epimerase, chloroplastic; Short=DAP
           epimerase; Flags: Precursor
 gi|6729509|emb|CAB67665.1| diaminopimelate epimerase-like protein [Arabidopsis thaliana]
 gi|22022530|gb|AAM83223.1| AT3g53580/F4P12_280 [Arabidopsis thaliana]
 gi|23505901|gb|AAN28810.1| At3g53580/F4P12_280 [Arabidopsis thaliana]
 gi|332645592|gb|AEE79113.1| diaminopimelate epimerase [Arabidopsis thaliana]
          Length = 362

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 142/292 (48%), Gaps = 23/292 (7%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-V 60
           ++ ++ F K  G+GN  +++D R   +   +    A   D N       +I      +  
Sbjct: 74  ETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVNGT 133

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC  RF   L +   + SFT  T  G++V +   DG + 
Sbjct: 134 DYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQVK 193

Query: 118 VDMGEPILDWKLIPLARSFDKMD---RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE-- 172
           VDMG PIL  + +P   S +K +        +  V+     N   VSMGNPH I F +  
Sbjct: 194 VDMGTPILKAQDVPTKLSGNKGEAVVEAELVVDGVSW----NVTCVSMGNPHCITFGKKG 249

Query: 173 ------DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
                 DDL   +L   G     H MF    N     V S   L +R WERG G T ACG
Sbjct: 250 GPNLKVDDL---NLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWERGAGATLACG 306

Query: 227 SAACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEG 277
           + ACA VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G
Sbjct: 307 TGACALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYG 358


>gi|121533712|ref|ZP_01665539.1| Diaminopimelate epimerase [Thermosinus carboxydivorans Nor1]
 gi|121307703|gb|EAX48618.1| Diaminopimelate epimerase [Thermosinus carboxydivorans Nor1]
          Length = 279

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 150/283 (53%), Gaps = 19/283 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F K  G GN  ++++  G  + I   A  A+   D  HF    D ++++   Q A  D
Sbjct: 1   MQFTKWHGQGNDFVIVN--GFQEKIEDYAQAAVKICDR-HFGIGADGLVIVGPSQVA--D 55

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGS 115
             +RI N DGSE + CGN  RCV R++       +   T ET+ G     L+ +     +
Sbjct: 56  FRMRIFNSDGSEAEMCGNVTRCVARYVYEYGLTDKTKITLETLAGPIKPELIFENGVLRT 115

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEP L    IP+     + D +  ++  + +    +   VSMGNPH I FV DD+
Sbjct: 116 VRVDMGEPRLKRAQIPM---IGEPDSEAINVPLIVNDKTYDITCVSMGNPHCIIFV-DDV 171

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              +LA+ G L+  HP F    N+   +V +   + +R WERG G+T ACG+ A A++VA
Sbjct: 172 DEINLAAVGPLIENHPTFPRKTNVEFVQVLNDHEMRMRVWERGAGITLACGTGASATLVA 231

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
           +    KT R  ++ + GG L++EW ++NHV+M+G A + + G+
Sbjct: 232 AVLNGKTGRVATIHLDGGDLVLEWGNDNHVYMSGPAVEVFRGE 274


>gi|29655253|ref|NP_820945.1| diaminopimelate epimerase [Coxiella burnetii RSA 493]
 gi|154706485|ref|YP_001425375.1| diaminopimelate epimerase [Coxiella burnetii Dugway 5J108-111]
 gi|161830776|ref|YP_001596002.1| diaminopimelate epimerase [Coxiella burnetii RSA 331]
 gi|164685819|ref|ZP_01945724.2| diaminopimelate epimerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212213429|ref|YP_002304365.1| diaminopimelate epimerase [Coxiella burnetii CbuG_Q212]
 gi|212219479|ref|YP_002306266.1| diaminopimelate epimerase [Coxiella burnetii CbuK_Q154]
 gi|81628361|sp|Q83AD4|DAPF_COXBU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082831|sp|A9KGY8|DAPF_COXBN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082832|sp|A9N9J6|DAPF_COXBR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807497|sp|B6J395|DAPF_COXB2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807498|sp|B6J630|DAPF_COXB1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|29542525|gb|AAO91459.1| diaminopimelate epimerase [Coxiella burnetii RSA 493]
 gi|154355771|gb|ABS77233.1| diaminopimelate epimerase [Coxiella burnetii Dugway 5J108-111]
 gi|161762643|gb|ABX78285.1| diaminopimelate epimerase [Coxiella burnetii RSA 331]
 gi|164601335|gb|EAX33603.2| diaminopimelate epimerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212011839|gb|ACJ19220.1| diaminopimelate epimerase [Coxiella burnetii CbuG_Q212]
 gi|212013741|gb|ACJ21121.1| diaminopimelate epimerase [Coxiella burnetii CbuK_Q154]
          Length = 276

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 138/283 (48%), Gaps = 22/283 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V+F KM+G GN  +VID       +T+  I  ++       FDQ+++I   ++ SVD   
Sbjct: 3   VNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHF 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC+ RF+ +     R+     T+  +L  K   DG +SV MG 
Sbjct: 63  RIFNADGSEVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGV 122

Query: 123 PILDWKLIP-----LARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P  +   IP     +A  +D  +D     +G           VV++GNPHAI  VE  + 
Sbjct: 123 PRFEPTEIPFIASGVANFYDIAVDNQIVKLG-----------VVNIGNPHAIIPVER-IN 170

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             ++   G  L+ H  F EG N+   +V   +++ LR +ERG G T ACGS ACA+V   
Sbjct: 171 AEEVGKLGARLSVHECFPEGANVGFMQVIDPQNIRLRVYERGTGETLACGSNACAAVAVG 230

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGK 278
                    V V   GG L I+W      V MTG A   + G+
Sbjct: 231 RRCGLLQERVVVSQPGGSLTIDWQGPLTPVTMTGPATTVFCGE 273


>gi|254421846|ref|ZP_05035564.1| diaminopimelate epimerase [Synechococcus sp. PCC 7335]
 gi|196189335|gb|EDX84299.1| diaminopimelate epimerase [Synechococcus sp. PCC 7335]
          Length = 271

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 120/230 (52%), Gaps = 14/230 (6%)

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKR-------KSFTFETIRGILVAKENRD 113
           D  +RI N DGSE + CGNG+RC+ +F+    +        KS+   T+ GI+  +   D
Sbjct: 42  DYSMRIYNSDGSEPEMCGNGIRCLAKFIADLEEEHNEPTLPKSYGVHTLAGIIRPELKPD 101

Query: 114 GSISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           G ++VDMGEPIL  + IP  L +   K+  +   +   N         VSMGNPH I FV
Sbjct: 102 GQVTVDMGEPILTAREIPTTLGQPDGKVIDETLTVAGENWQVT----CVSMGNPHCITFV 157

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+    LA  G     H  F   +N     V   + L ++ WERG G T ACG+  CA
Sbjct: 158 -DDVEAVPLADIGPRFEHHEAFPARINTEFVEVVRPDFLRMKVWERGAGPTLACGTGTCA 216

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            VVA+    K +R  +V++ GG L IEW +NN V+MTG A   + G + +
Sbjct: 217 LVVAAVLNGKCDRQTTVELPGGNLEIEWANNNRVYMTGPATLVFSGDVAV 266


>gi|91781473|ref|YP_556679.1| diaminopimelate epimerase [Burkholderia xenovorans LB400]
 gi|123169125|sp|Q146W2|DAPF_BURXL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91685427|gb|ABE28627.1| diaminopimelate epimerase [Burkholderia xenovorans LB400]
          Length = 287

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 144/288 (50%), Gaps = 15/288 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  +V+D      N+T   + AL+   + HF    DQ++L+     A VD
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALA---DRHFGVGADQLLLVEKPTVAGVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI NCDG EV+ CGNG RC V+F+  R    ++S   +  +G +      +G + VD
Sbjct: 60  FRYRIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTITLTMQENGEVLVD 119

Query: 120 MGEPILDWKLIPLA-RSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P+ D + +P A +  +        + P++     R   VVSMGNPHA+  V  D+  
Sbjct: 120 MGTPVFDPERVPFATKGLEGRREGADTLWPLDVSGTTRWISVVSMGNPHAVQVV-GDVEA 178

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + + + G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A  
Sbjct: 179 FPVLAEGPVIERHARFPQRVNAGFMQIVGRNEIRLRVYERGAGETLACGTGACAAVAAGI 238

Query: 238 CLHKTNRAVSVKMLGGGLLIEW---HDNNHVFMTGEAKKEWEGKLDIK 282
                +  V V   GG L I W    +   + M G A   +EG++++ 
Sbjct: 239 RRGLLDSPVRVHTHGGDLTISWDSTREGEPLLMAGPAVTVFEGEIELP 286


>gi|282898651|ref|ZP_06306639.1| Diaminopimelate epimerase [Cylindrospermopsis raciborskii CS-505]
 gi|281196519|gb|EFA71428.1| Diaminopimelate epimerase [Cylindrospermopsis raciborskii CS-505]
          Length = 279

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 147/286 (51%), Gaps = 21/286 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K  G+GN  ++ID R C          A+   D  HF    D ++     Q  + D
Sbjct: 3   IEFTKYHGLGNDFILIDNR-CDLTPLITPEMAIRMCDR-HFGIGADGVIFALPGQKGT-D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLT-----SRMKRKSFTFETIRGILVAKENRDGSI 116
             +RI N DGSE + CGNG+RC+  FLT     SR K   +   T+ G++  +   DG +
Sbjct: 60  YTMRIFNSDGSEPEMCGNGIRCLAAFLTELEGISRSK-DYYLIHTLAGVIRPQLTDDGQV 118

Query: 117 SVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            VDMG P L  + IP  LA    K+      IG  N  +  +   VSMGNPH I FVED 
Sbjct: 119 RVDMGSPRLLAQEIPTTLAPGNSKIINLPLEIG--NQTW--HITCVSMGNPHCITFVED- 173

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    L   G     HP+F +  N    +V +   L +R WERG G+T ACG+ ACAS+V
Sbjct: 174 VASIPLEIIGPEFEHHPVFPQRTNTEFIQVVNPHHLKMRVWERGAGITLACGTGACASLV 233

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           A    +  +R   +++ GG L IEW + +  ++MTG A++ + GK+
Sbjct: 234 AGVLNNLCDRMAIIELPGGNLEIEWSETDQRIYMTGPAERVFTGKM 279


>gi|57234492|ref|YP_181475.1| diaminopimelate epimerase [Dehalococcoides ethenogenes 195]
 gi|57224940|gb|AAW39997.1| diaminopimelate epimerase [Dehalococcoides ethenogenes 195]
          Length = 284

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 149/292 (51%), Gaps = 21/292 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           + F K++ +GN  ++ID +G   + +  A++          D +MLI     A  D  +R
Sbjct: 1   MKFTKLQSVGNDFVLIDPQGEDKDWSKLALHMCHRHFGAGADGLMLI--LPSAKADFRMR 58

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM---KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           I N DGSE + CGNG+RC++ ++ +      R   + ET+ GI  A+   DG I   MG+
Sbjct: 59  IFNADGSEAEICGNGLRCLIHYIAANNLIGNRDELSIETLAGIRNAQIFADGRIRTTMGK 118

Query: 123 PILDWKLIPLARSFDKMDRDRFHIG--PVN----HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P+ +   IP+A   D    +   I   P+N     L L    +VSMGNPHAI F    + 
Sbjct: 119 PMFEAHQIPVAAEPDPKYYNGQLISDFPLNINNRRLLLS---LVSMGNPHAIHFCTKSVE 175

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + L   G L+  H  F +  N  +A +   E + +R WERGVG T  CGS A A  VA+
Sbjct: 176 EFPLGEVGPLVETHKAFPKRTNFEVANILDSEHIKVRVWERGVGETLGCGSGASAVAVAA 235

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
             L    + V +K+ GG L +EW  +N V++TG+A+        I TG+W+K
Sbjct: 236 QILGYVGKFVYIKLPGGTLGVEWDGHNDVYLTGKAEI-------IYTGEWLK 280


>gi|222112167|ref|YP_002554431.1| diaminopimelate epimerase [Acidovorax ebreus TPSY]
 gi|254767102|sp|B9MFT0|DAPF_DIAST RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|221731611|gb|ACM34431.1| diaminopimelate epimerase [Acidovorax ebreus TPSY]
          Length = 292

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 144/300 (48%), Gaps = 36/300 (12%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +T      L+   + HF    DQI+ +     A +D
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGRLGLTPAQYRFLA---DRHFGVGADQILTVRPSPGAGID 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG +V+ CGNG RC  R++  +    + +   +T+ G++      DG ++VD
Sbjct: 60  FEYVIHNADGGQVEQCGNGARCFARYVRDKGLTAQDTIRVQTMAGVIAPHLTADGRVTVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRN-PF--------------VVSMGN 164
           MG P L+   +P          D   + PV+    +  P               VVSMGN
Sbjct: 120 MGRPELEPARVPF---------DTTGLAPVSQGSGQKWPLALDGQASEATLLVAVVSMGN 170

Query: 165 PHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAA 224
           PHA+  V DD+    +A  G L+  HP F + VN    ++ +   + LR +ERG G T A
Sbjct: 171 PHAVQLV-DDVDTAPVAQTGPLIESHPRFPQRVNAGYLQIVNRGEVRLRVYERGAGETLA 229

Query: 225 CGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           CG+ ACA+VVA   L   +  V V   GG L I+W     + VFMTG A   +EG++DI 
Sbjct: 230 CGTGACAAVVAGIRLGLLDARVQVHTRGGLLTIDWAGGLQDPVFMTGPATTVFEGEIDIP 289


>gi|229020171|ref|ZP_04176945.1| Diaminopimelate epimerase [Bacillus cereus AH1273]
 gi|229026398|ref|ZP_04182755.1| Diaminopimelate epimerase [Bacillus cereus AH1272]
 gi|228734861|gb|EEL85499.1| Diaminopimelate epimerase [Bacillus cereus AH1272]
 gi|228741119|gb|EEL91343.1| Diaminopimelate epimerase [Bacillus cereus AH1273]
          Length = 288

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 153/293 (52%), Gaps = 23/293 (7%)

Query: 4   SMVDFAKMEGIGNKILVIDM-----RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDA 58
           S   F KM G+GN  + ++M     R     + ++ ++ ++T      D ++LI     A
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIREEDLALVAEKVSNINTGIGA--DGMILICPSDVA 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENR 112
            V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +++
Sbjct: 60  PVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEDDK 117

Query: 113 DGSISVDMGEPILDWKLIPLARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
                +DMG P L  + IP+    D    R+ F     NH +      VSMGNPHA+ FV
Sbjct: 118 VTLAKIDMGAPRLTREEIPMLGEGDTPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV 173

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA
Sbjct: 174 -DDVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACA 232

Query: 232 SVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           +VVA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 233 AVVAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHGVYEYK 285


>gi|297816660|ref|XP_002876213.1| diaminopimelate epimerase family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297322051|gb|EFH52472.1| diaminopimelate epimerase family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 362

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 142/293 (48%), Gaps = 25/293 (8%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-V 60
           ++ ++ F K  G+GN  +++D R   +   +    A   D N       +I      +  
Sbjct: 74  ETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVNGT 133

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC  RF   L +   + SFT  T  G++V +   DG + 
Sbjct: 134 DYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQVK 193

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR----NPFVVSMGNPHAIFFVE- 172
           VDMG PIL  + +P      K+  ++        L +     N   VSMGNPH I F + 
Sbjct: 194 VDMGTPILKAQDVPT-----KLPGNKGEAVVQAELVVDGESWNVTCVSMGNPHCITFGKK 248

Query: 173 -------DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAAC 225
                  DDL   +L   G    +H MF    N     V S   L +R WERG G T AC
Sbjct: 249 GGPNLKVDDL---NLPEIGPKFERHEMFPARTNTEFVEVLSHSHLKMRVWERGAGATLAC 305

Query: 226 GSAACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEG 277
           G+ ACA VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G
Sbjct: 306 GTGACALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYG 358


>gi|229105556|ref|ZP_04236190.1| Diaminopimelate epimerase [Bacillus cereus Rock3-28]
 gi|228677826|gb|EEL32069.1| Diaminopimelate epimerase [Bacillus cereus Rock3-28]
          Length = 288

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 151/292 (51%), Gaps = 21/292 (7%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQILEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VAS---GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+   G L    + ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKLEH-GKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|330444896|ref|ZP_08308551.1| diaminopimelate epimerase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489206|dbj|GAA03048.1| diaminopimelate epimerase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 276

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFVVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMILKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP+     + ++          LF       SMGNPH +  V D++   D+ +
Sbjct: 123 PIFEPNKIPMKAK--QAEKTYILRAGDQTLFCG---AASMGNPHCVTVV-DNVDTADVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNAGFMQVLDRNNVRLRVYERGAGETQACGSGACAAVAIGRLQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W  +   +FMTG A   ++G+ ++
Sbjct: 237 DENVKVSLPGGDLHIRWAGEGKPLFMTGPAAHVFDGQFNL 276


>gi|255282869|ref|ZP_05347424.1| diaminopimelate epimerase [Bryantella formatexigens DSM 14469]
 gi|255266643|gb|EET59848.1| diaminopimelate epimerase [Bryantella formatexigens DSM 14469]
          Length = 277

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 141/283 (49%), Gaps = 21/283 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM GIGN  + ++   C      D         + HF    D ++LI     +  D  
Sbjct: 3   FTKMHGIGNDYVYVN---CFKETVEDPEKTAILVSDRHFGIGSDGLILIK--PSSVADGK 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DGS+   CGNG+RCV +++       + S + ET  GI    L  +  +  ++ 
Sbjct: 58  MEMYNADGSQGAMCGNGIRCVAKYMYDYGITDKTSISVETKSGIKYLDLTVENGKVSAVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P+L    IP     + +  +      VN    R    VSMGNPHA+ +VED + H
Sbjct: 118 VNMGSPVLQAAAIPAVSEKETVIDEPV---TVNGREWRLT-CVSMGNPHAVTYVED-VKH 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+   G     HPMF + VN   A V    ++++R WERG G T ACG+ ACA+ VAS 
Sbjct: 173 LDIEKIGPEFEHHPMFPDRVNTEFAHVIDRHTVEMRVWERGSGETLACGTGACATAVASV 232

Query: 238 CLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
               T   V+VK+LGG L I W    N+V+MTG A   ++G++
Sbjct: 233 LNGYTEDEVTVKLLGGDLKIFWDRKENNVYMTGSATTVFDGEI 275


>gi|118480026|ref|YP_897177.1| diaminopimelate epimerase [Bacillus thuringiensis str. Al Hakam]
 gi|166224241|sp|A0RKC7|DAPF_BACAH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|118419251|gb|ABK87670.1| diaminopimelate epimerase [Bacillus thuringiensis str. Al Hakam]
          Length = 288

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 149/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGN HA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNSHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHGVYEYK 285


>gi|292669828|ref|ZP_06603254.1| diaminopimelate epimerase [Selenomonas noxia ATCC 43541]
 gi|292648625|gb|EFF66597.1| diaminopimelate epimerase [Selenomonas noxia ATCC 43541]
          Length = 279

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 138/282 (48%), Gaps = 19/282 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K +G GN  +++D     D    D         + HF    D +M++   + A  D
Sbjct: 1   MEFTKWQGCGNDFVIVDFL---DREPVDFAALAVRMCDRHFGVGADGLMIVCPSETA--D 55

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAK----ENRDGS 115
             +R  N DG+E + CGNG+RC  R L    R++R+ FT ETI G +V +         +
Sbjct: 56  IRMREFNPDGTEPEMCGNGIRCFARCLYDCGRIRREQFTIETIAGTMVPRILTESGEVTA 115

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEP+L    IP+ R F         I   +  +      VSMGNPH + FV DD 
Sbjct: 116 VEVDMGEPVLAGDAIPV-RGFGMEPVIAQPITVEDRTYAMT--CVSMGNPHCVIFV-DDA 171

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             + LA  G     HP F   +N     V   +   +R WERG G+T ACG+  CA++ A
Sbjct: 172 EGFPLAELGPKFENHPAFPRRINTEFVHVRDRKHARMRVWERGAGITLACGTGTCATLAA 231

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
                  +RA  +++ GG + + WH + H+FMTG A+  + G
Sbjct: 232 GVLCDVLDRAAEIEVDGGVIHVAWHADGHIFMTGPAEPVFAG 273


>gi|222530081|ref|YP_002573963.1| diaminopimelate epimerase [Caldicellulosiruptor bescii DSM 6725]
 gi|222456928|gb|ACM61190.1| diaminopimelate epimerase [Caldicellulosiruptor bescii DSM 6725]
          Length = 278

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 147/291 (50%), Gaps = 38/291 (13%)

Query: 8   FAKMEGIGNKILVIDMRG-------------CHDNITSDAINALSTDDNTHFDQIMLIHD 54
           F+KM G+GN  +VID RG             CH +I   A            D I+L+ D
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNLLAKKMCHRHIGVGA------------DGILLVLD 50

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL-----V 107
            + A  D  +RIIN DGSE + CGNG+RC  +++  R  +K   F  ET+ GI+     V
Sbjct: 51  SKLA--DIRMRIINSDGSEAEMCGNGIRCFAKYVFERGIVKSTKFKVETLAGIIEPELFV 108

Query: 108 AKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHA 167
            +      + V+MG+P    + IP+ +   K D     I    + +     +  MG PH 
Sbjct: 109 NEYGLVDKVKVNMGKPSFKREDIPM-QGDPKSDAINTSIVVDGNEYRITSLL--MGVPHT 165

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           I FV DDL   D+ + G  + KH +F    N++  +V    ++ +RTWERG G T ACG+
Sbjct: 166 ILFV-DDLEKVDIYTLGPKIEKHEVFPRKTNVNFVQVIDKNNIKVRTWERGAGATFACGT 224

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
            +CASV+A+       R  SV +  G L IEW D+  VFMTG A++ + G+
Sbjct: 225 GSCASVIAANLNGYAERKASVHLYFGILEIEWQDDGIVFMTGPAEEVFVGE 275


>gi|297537396|ref|YP_003673165.1| diaminopimelate epimerase [Methylotenera sp. 301]
 gi|297256743|gb|ADI28588.1| diaminopimelate epimerase [Methylotenera sp. 301]
          Length = 276

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 141/283 (49%), Gaps = 22/283 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F KM+G GN  +VI+       +T++ I  L+       FDQ++L+   + A  D   RI
Sbjct: 7   FTKMQGAGNDFIVINGIDQPFQLTAEQIQTLAHRQFGIGFDQLLLVETSKVA--DFKYRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSEV  CGNG RC VRF+  +    +   + ET  GI+  K   +G ++V+MG P 
Sbjct: 65  FNADGSEVAQCGNGARCFVRFVVDQKLSNKHEISVETASGIITPKLENNGLVTVNMGAPR 124

Query: 125 LDWKLIPL-----ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           L    +P      A S+     D+        + +     VSMGNPHA+  V DD+    
Sbjct: 125 LSPSEVPFIADAAANSYVLEVADQ-------QITIS---AVSMGNPHAVQIV-DDVEIAP 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G+ +  HP F E VN    ++     + LR +ERG G T ACG+ ACA+VVA   L
Sbjct: 174 VVALGSQIEVHPRFPERVNAGFMQIIDEHHIKLRVFERGSGETLACGTGACAAVVAGIQL 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            +    V V   GG L I W   N+ V MTG A   + G ++I
Sbjct: 234 GRLQSPVKVSARGGELHIAWQGGNSPVMMTGPAVAVFTGNIEI 276


>gi|89074450|ref|ZP_01160927.1| diaminopimelate epimerase [Photobacterium sp. SKA34]
 gi|89049738|gb|EAR55288.1| diaminopimelate epimerase [Photobacterium sp. SKA34]
          Length = 276

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 138/278 (49%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFVVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMLLKLENDNQVTVNMGG 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP+     + ++          LF       SMGNPH +  V D++   D+ +
Sbjct: 123 PIFEPSKIPMKAK--QAEKTYILRAGEQTLFCG---AASMGNPHCVTVV-DNVDTADVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNAGFMQVIDRNNVRLRVYERGAGETLACGSGACAAVAIGRSQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           +  V V + GG L I W  +   +FMTG A   ++G+ 
Sbjct: 237 DENVKVSLPGGDLYIRWAGEGKPLFMTGPAAHVFDGQF 274


>gi|313901739|ref|ZP_07835167.1| diaminopimelate epimerase [Thermaerobacter subterraneus DSM 13965]
 gi|313468001|gb|EFR63487.1| diaminopimelate epimerase [Thermaerobacter subterraneus DSM 13965]
          Length = 294

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 141/296 (47%), Gaps = 42/296 (14%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSD----AINALSTDDNTHF--DQIMLIHDF 55
           +   +   KM G+GN  L +D  G  + +  D    A+    +D N     D ++L+   
Sbjct: 4   ERRPIRLTKMHGLGNNYLFLD--GLAEPVPPDDDLPALARAVSDRNFGIGSDGLILVLPP 61

Query: 56  QDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRD 113
           +D      +RI N DGSE + CGNG+RC+ R +  R   +   F  ET  G +  + + D
Sbjct: 62  RDPGARFRMRIFNADGSEGEMCGNGIRCLARLVYDRGYTRETEFVVETGAGPIRPRLHLD 121

Query: 114 G----SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVV--------- 160
           G     ++VDMG P L+  +IP+A             GP     +  P  V         
Sbjct: 122 GHRVTGVTVDMGVPRLERGMIPMA-------------GPAGEQAVEVPLEVEAGGERSVF 168

Query: 161 -----SMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTW 215
                SMGNPH + FV DDL   DL   G     HP F + VN    RV + E + +R W
Sbjct: 169 TVTALSMGNPHCVVFV-DDLEAVDLERLGPAFEHHPAFPQRVNTHFTRVLNPERVRVRVW 227

Query: 216 ERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEA 271
           ERG G T ACG+ ACA  VA     +T R V+V++ GG L +EW  + HV+MTG A
Sbjct: 228 ERGSGPTLACGTGACAVAVAGALTGRTGRRVTVELPGGSLEVEWAGDGHVYMTGPA 283


>gi|326315548|ref|YP_004233220.1| diaminopimelate epimerase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323372384|gb|ADX44653.1| diaminopimelate epimerase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 297

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 142/297 (47%), Gaps = 23/297 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
            + F KM+G GN  +V+D       +T      L+   + HF    DQI+ +       +
Sbjct: 2   QIRFTKMQGAGNDFVVLDETQGRLGLTPAQYRYLA---DRHFGVGADQILTVRPSPADGI 58

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D    I N DG EV+ CGNG RC  R++  +    R +   +T+ G++  +   DG ++V
Sbjct: 59  DFEYVIHNADGGEVEQCGNGARCFARYVRDKGLTDRDTIRVQTLAGVIAPRLTEDGRVTV 118

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLF----------LRNPFVVSMGNPHA 167
           DMG P  D   +P  A   +   R      P++             + +  VVSMGNPHA
Sbjct: 119 DMGRPRFDPAEVPFDASGLESTVRGAGQTWPLDLGAGAGAGAQEGDVVDVAVVSMGNPHA 178

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           +  VED +    +A  G L+ +H  F + VN    ++     + LR +ERG G T ACG+
Sbjct: 179 VQLVED-VDTAPVARTGPLIERHVRFPQRVNAGYLQIEDRSRVRLRVYERGAGETLACGT 237

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWH--DNNHVFMTGEAKKEWEGKLDIK 282
            ACA+V A   L   +  V V+  GG L I W    +  VFMTG A   +EG++DI 
Sbjct: 238 GACAAVAAGIRLGLLDTRVDVRTRGGLLTIAWSGDPSESVFMTGPATTVFEGQIDIP 294


>gi|56551968|ref|YP_162807.1| diaminopimelate epimerase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|81598240|sp|Q5NNL4|DAPF_ZYMMO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56543542|gb|AAV89696.1| Diaminopimelate epimerase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 269

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 146/277 (52%), Gaps = 21/277 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +V+D R     +      ALS   N H     DQ+++I + ++ + D  
Sbjct: 5   FHKMHGLGNDFIVLDARKNPIQMNPALAQALS---NRHTGIGCDQLIIIGNGKNQA-DVS 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           + I N DGSEV++CGN  RCV  FL      +     T  G+L A+ + +G+  VDMG P
Sbjct: 61  MEIWNADGSEVEACGNATRCVPVFLG-----RDVIISTAAGLLDARLSDEGA-CVDMGRP 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W  IPLA + D +        PV    L+ P  V+MGNPH +F V+D          
Sbjct: 115 RLSWDEIPLAYAMDTLSM------PVAWEDLKEPTAVNMGNPHVVFVVDDVDAVD-FGRL 167

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           GN++    +F E +N++I  VT  + L +RTWERG GLT ACG+ ACA+ VA+      +
Sbjct: 168 GNMIEHDQLFPERINVNIVMVTGKDHLKMRTWERGAGLTRACGTGACATFVAAKRRRLVS 227

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
               + + GG L+++ +   H+ M G A   ++G+ D
Sbjct: 228 GKTQIDLPGGRLVLDENSEGHIIMRGPATYVFKGEAD 264


>gi|187922356|ref|YP_001893998.1| diaminopimelate epimerase [Burkholderia phytofirmans PsJN]
 gi|229807509|sp|B2T1P5|DAPF_BURPP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|187713550|gb|ACD14774.1| Diaminopimelate epimerase [Burkholderia phytofirmans PsJN]
          Length = 299

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 143/286 (50%), Gaps = 15/286 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      N+T   + AL+   + HF    DQ++L+     A VD  
Sbjct: 5   FTKMHGAGNDFVVLDGYTQPVNLTPAQVRALA---DRHFGVGADQLLLVEKPTVAGVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+  +    ++S   +  +G +      +G + VDMG
Sbjct: 62  YRIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKGTITLTMQENGEVLVDMG 121

Query: 122 EPILDWKLIPLA-RSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ D + +P A +           + P++ +   R   VVSMGNPHA+  V DD+  + 
Sbjct: 122 TPVFDPERVPFATKGLQGRGEGADTLWPLDVNGTTRWISVVSMGNPHAVQVV-DDVEAFP 180

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A    
Sbjct: 181 VLVEGPVIERHARFPQRVNAGFMQIVGRSEIKLRVYERGAGETLACGTGACAAVAAGIRR 240

Query: 240 HKTNRAVSVKMLGGGLLIEW---HDNNHVFMTGEAKKEWEGKLDIK 282
              +  V V   GG L I W     +  + M G A   +EG++++ 
Sbjct: 241 GLLDAPVLVHTHGGKLTITWDAAQADQPLLMAGPAATVFEGEIELP 286


>gi|325518791|gb|EGC98379.1| diaminopimelate epimerase [Burkholderia sp. TJI49]
          Length = 289

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 144/290 (49%), Gaps = 19/290 (6%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F+  R    R+S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVNDRGLTDRRSVRVQVMKGLITLTMQDNGEVVV 119

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDL 175
           DMG P+     +P  A   +     R  + P++ +  R  ++  VSMGNPHA+  V DD 
Sbjct: 120 DMGAPVFAPAQVPFDAAGLEGRAEGRDTLWPLD-VGGRTRWITTVSMGNPHAVQVV-DDA 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A
Sbjct: 178 EAYPVLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                  +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 238 GIRRGLLDSPVTVHTHGGTLTISWDGARDETAALMMAGPATTVFEGEIDL 287


>gi|163859105|ref|YP_001633403.1| diaminopimelate epimerase [Bordetella petrii DSM 12804]
 gi|163262833|emb|CAP45136.1| dapF [Bordetella petrii]
          Length = 304

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 140/289 (48%), Gaps = 19/289 (6%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDA 62
           +F KM G GN  +V+D      +IT +   AL+   + HF    DQI+L+        D 
Sbjct: 10  NFTKMHGAGNDFVVLDGVRQAIDITPERARALA---DRHFGIGADQILLVEPPTHPEADF 66

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC VRF+  +    R     E   GILV  E  D  ++VDM
Sbjct: 67  RYRIFNADGSEVEHCGNGARCFVRFVHEQRLSSRNPLRAEIATGILVLDEGDDEQVTVDM 126

Query: 121 GEPILDWKLIPL--------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
           G    D   +P         A+  D + +      P           V++ NPHA+  V 
Sbjct: 127 GVTRFDPAALPFDTAGLASAAQGSDTLWQLDLPDAPPGLPRSVQVSAVAISNPHAVQQV- 185

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DD+    +A+ G L+ +HP F+  VN    +V    S+ LR +ERG G T ACG+ ACA+
Sbjct: 186 DDVDAAPVAAIGPLIERHPRFARRVNAGFMQVLDRHSIRLRVYERGAGETLACGTGACAA 245

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           V A       +  V V   GG L ++W +  H+ MTG A   + G++DI
Sbjct: 246 VAAGIRRGLLDSPVRVHTRGGTLTVDW-NGEHLRMTGPATSVFTGQVDI 293


>gi|189349037|ref|YP_001944665.1| diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
 gi|221215805|ref|ZP_03588764.1| diaminopimelate epimerase [Burkholderia multivorans CGD1]
 gi|189333059|dbj|BAG42129.1| diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
 gi|221164341|gb|EED96828.1| diaminopimelate epimerase [Burkholderia multivorans CGD1]
          Length = 289

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 147/291 (50%), Gaps = 19/291 (6%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T+  + AL++    HF    DQ++L+        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALAS---RHFGIGADQLLLVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVV 119

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDL 175
           DMG P+   + +P  A   D     R  + P+  +  R  ++  VSMGNPHA+  V DD 
Sbjct: 120 DMGAPVFAPEQVPFDASGLDGRSEGRDTLWPL-EVGGRTRWISTVSMGNPHAVQVV-DDA 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A
Sbjct: 178 EAYPVLEEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIK 282
                  +  V+V   GG L I W     ++  + M G A   +EG++D+ 
Sbjct: 238 GIRRGLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVFEGEIDLP 288


>gi|167585127|ref|ZP_02377515.1| diaminopimelate epimerase [Burkholderia ubonensis Bu]
          Length = 289

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 143/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSSALPPLTEAQVRALA---NRHFGVGADQLLLVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F+  +    ++S   E ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVLDKRLTDKRSVRVEVMKGLITLTMQENGEVVV 119

Query: 119 DMGEPILDWKLIPLARS-FDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+ +   +P   +        R  + P++     R    VSMGNPHA+  V DD  
Sbjct: 120 DMGAPVFEPAQVPFETAGLAGRPEGRDTLWPLDVGGATRWISTVSMGNPHAVQVV-DDAE 178

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y + + G L+ +H  F++ VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 179 RYPVLAEGPLIERHARFAQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAAG 238

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 239 IRRGLLDSPVTVHTHGGTLTISWDGARDEAAPLMMAGPAATVFEGEIDL 287


>gi|268634733|gb|ACZ16581.1| diaminopimelate epimerase [uncultured bacterium]
          Length = 276

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 142/287 (49%), Gaps = 22/287 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V F KM+GIGN  +V+D       +    I+ L+  +    FDQ+++I   Q    D  
Sbjct: 2   IVPFTKMQGIGNDFMVVDAISQPVYLNQGQISQLAHRNFGIGFDQLLMIEAPQHPEADFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSE   CGNG R V +++  +    ++     T    +      +G I+++MG
Sbjct: 62  FRIFNADGSEAGHCGNGARAVAKYVRQKGLTWKRELRLSTNTATMNTVMEDNGLITINMG 121

Query: 122 EPILDWKLIPL--ARSFDKMDRD----RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           +P L+ + IPL  A+  +    D    R+ IG            VSMGNPH +  VED +
Sbjct: 122 KPRLEPEKIPLRFAQQSETYMIDAEGIRYKIG-----------AVSMGNPHCVLQVED-I 169

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +   G +L+ H  F    N+   +V     + LR +ERGVG T ACG+ ACA+VVA
Sbjct: 170 DKAAVGKVGPILSHHSYFPAQANVGFMQVVDSNEIKLRVFERGVGETLACGTGACAAVVA 229

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                  +  V V + GG L I W    + V+MTG AK  +EG++D+
Sbjct: 230 GRLQKILDEKVKVTLPGGSLWIRWAGKGSPVYMTGPAKVVFEGQIDV 276


>gi|221201914|ref|ZP_03574951.1| diaminopimelate epimerase [Burkholderia multivorans CGD2M]
 gi|221207580|ref|ZP_03580588.1| diaminopimelate epimerase [Burkholderia multivorans CGD2]
 gi|221172426|gb|EEE04865.1| diaminopimelate epimerase [Burkholderia multivorans CGD2]
 gi|221178334|gb|EEE10744.1| diaminopimelate epimerase [Burkholderia multivorans CGD2M]
          Length = 289

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 147/291 (50%), Gaps = 19/291 (6%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T+  + AL++    HF    DQ++L+        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALAS---RHFGIGADQLLLVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVV 119

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDL 175
           DMG P+   + +P  A   D     R  + P+  +  R  ++  VSMGNPHA+  V DD 
Sbjct: 120 DMGAPVFAPEQVPFDASGLDGRTEGRDTLWPL-EIGGRTRWISTVSMGNPHAVQVV-DDA 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A
Sbjct: 178 EAYPVLDEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIK 282
                  +  V+V   GG L I W     ++  + M G A   +EG++D+ 
Sbjct: 238 GIRRGLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVFEGEIDLP 288


>gi|33861445|ref|NP_893006.1| diaminopimelate epimerase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|33634022|emb|CAE19347.1| Diaminopimelate epimerase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 286

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 149/289 (51%), Gaps = 22/289 (7%)

Query: 8   FAKMEGIGNKILVIDMRGC--HDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           F K  G GN  ++ID R    +    SD    +    +  F    D ++ I +  D +  
Sbjct: 6   FEKYHGNGNDFIIIDSRNSNIYKKFLSDKKIDIKNLCDRQFGIGGDGVIFILE-PDRNNY 64

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRK----SFTFETIRGILVAKENRDGSIS 117
           A + I N DGSE Q CGNG+RC+V++L +  K       +  ET  GI +A+ N +G I+
Sbjct: 65  AKMIIYNSDGSEAQMCGNGIRCLVQYLHNFNKGSYSVSEYRIETKAGIKIAQYN-NGEIT 123

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPV---NHLFLRNPFVVSMGNPHAIFFVEDD 174
           V MG+PIL+ K IP      K+D     I         F +  + V MGNPH IFF++D 
Sbjct: 124 VKMGKPILETKSIP-----TKIDTKINSIPSCLFKEKNFEQQGYAVGMGNPHLIFFLQD- 177

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    L+  G +  KH +F E  N+  +++ + +++++R WERG G T ACG+ ACA  V
Sbjct: 178 ITKISLSLLGPVFEKHELFPEKTNVHFSQIINRDNINVRVWERGAGATLACGTGACAVHV 237

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
           A+  L   N    + + GG L+I W    + + MTG AKK + G   +K
Sbjct: 238 AAYKLGLCNSKTVINLPGGNLIINWSRSEDEILMTGNAKKVFSGTYILK 286


>gi|160878788|ref|YP_001557756.1| diaminopimelate epimerase [Clostridium phytofermentans ISDg]
 gi|160427454|gb|ABX41017.1| Diaminopimelate epimerase [Clostridium phytofermentans ISDg]
          Length = 304

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 158/303 (52%), Gaps = 40/303 (13%)

Query: 1   MQSSMV---DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIH 53
           +Q  MV    F KM+G GN  + ++   C +   +D         +  F    D ++LI 
Sbjct: 20  LQKGMVANMKFTKMQGCGNDYVYVN---CFEETINDPNGVAKKVSDRRFGIGSDGLILIK 76

Query: 54  DFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LV 107
             + A  D  + + N DGS+ + CGNG+RCV +++      ++ S   ET+ G+    L+
Sbjct: 77  PSEIA--DFTMHMYNADGSQGKMCGNGIRCVGKYVYDHGMTQKTSLAIETLGGVKYLALI 134

Query: 108 AKENRDGSISVDMGEPILDWKLIPLARSFDKM--------DRDRFHIGPVNHLFLRNPFV 159
               +   ++VDMGEP LD KLIP+A   +++        DR+ +  G            
Sbjct: 135 VDGGKVTEVTVDMGEPELDPKLIPIAVEEEQVVNMPITIADREFYITG------------ 182

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VS+GNPHA+ F+ED    + + ++G L  +HP+F E +N    ++   +++++R WERG 
Sbjct: 183 VSVGNPHAVTFIEDT-NSFPIENYGPLFEEHPLFPEKINTEFVQILDRKTVNMRVWERGS 241

Query: 220 GLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGK 278
             T ACG+ A  SV A+     T   V+V MLGG ++I +  + N +FMTG A   ++G+
Sbjct: 242 AETHACGTGATCSVYAAILNGLTEDEVTVHMLGGDVVIRYDREKNRLFMTGPAVTVFDGE 301

Query: 279 LDI 281
           +++
Sbjct: 302 IEL 304


>gi|170734435|ref|YP_001766382.1| diaminopimelate epimerase [Burkholderia cenocepacia MC0-3]
 gi|169817677|gb|ACA92260.1| Diaminopimelate epimerase [Burkholderia cenocepacia MC0-3]
          Length = 309

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 142/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGA 79

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    R+S   + ++G++      +G + V
Sbjct: 80  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDRRSVRVQVMKGLITLTLQDNGEVVV 139

Query: 119 DMGEPILDWKLIPLARS-FDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P   S  D        + P++     R    VSMGNPHA+  V DD+ 
Sbjct: 140 DMGAPVFAPAQVPFEPSGLDGRQEGNDTLWPLDVGGATRWISTVSMGNPHAVQVV-DDVE 198

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 199 AYPVLEEGPLIERHARFPQRVNAGFMQIVSRREVKLRVYERGAGETLACGTGACAAVAAG 258

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 259 IRRGLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPATTVFEGEIDL 307


>gi|229112384|ref|ZP_04241922.1| Diaminopimelate epimerase [Bacillus cereus Rock1-15]
 gi|228671032|gb|EEL26338.1| Diaminopimelate epimerase [Bacillus cereus Rock1-15]
          Length = 288

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 149/291 (51%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAGKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+  V D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVILV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|90414246|ref|ZP_01222226.1| diaminopimelate epimerase [Photobacterium profundum 3TCK]
 gi|90324693|gb|EAS41234.1| diaminopimelate epimerase [Photobacterium profundum 3TCK]
          Length = 276

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 137/280 (48%), Gaps = 14/280 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFMVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF  +     +      T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVWMKGLTNKYQVAVSTKAGKMLLKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF--VVSMGNPHAIFFVEDDLYHYDL 180
           P  +   IP    F     ++ +I  V     R  F  VVSMGNPH +  V DDL    +
Sbjct: 123 PEFEPSKIP----FRAKQTEKTYIMRVGE---RTIFCGVVSMGNPHCVTVV-DDLDLTGV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G L+  H  F E VN    +V S   + LR +ERG G T ACGS ACA+V       
Sbjct: 175 ETLGPLIESHERFPERVNAGFMQVVSRNEVKLRVYERGAGETQACGSGACAAVAVGYLQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
             +  V V + GG L I W  +   ++MTG     ++G++
Sbjct: 235 LLDENVKVSLPGGDLHISWAGEGKSLYMTGPVAHVFDGQI 274


>gi|225028432|ref|ZP_03717624.1| hypothetical protein EUBHAL_02706 [Eubacterium hallii DSM 3353]
 gi|224954276|gb|EEG35485.1| hypothetical protein EUBHAL_02706 [Eubacterium hallii DSM 3353]
          Length = 290

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 145/289 (50%), Gaps = 23/289 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM GIGN  + ++   C +    +         + HF    D ++LI     A  D  
Sbjct: 11  FTKMHGIGNDYVYVN---CFEESIKNPAEVSKFVSDRHFGIGSDGLILIS--PSAKADFR 65

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + I N DGS+ + CGNG+RCV +++       +   + ET+ GI    L  +  +  ++ 
Sbjct: 66  MNIYNADGSQAEMCGNGIRCVAKYVYDYGLTDKTEISVETLAGIKYLKLQVENGKVATVE 125

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           V+MG PIL+ K IP+A   + +      + G   H+       VSMGNPHAI F+ D++ 
Sbjct: 126 VNMGAPILEPKKIPVAVENNPVVDVPVEVKGKTYHMTC-----VSMGNPHAIIFM-DNVK 179

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             D+ + G     HP+F +  N     V    ++++R WERG   T ACG+ ACA+ VA 
Sbjct: 180 ELDIEAIGPYFENHPVFPKRTNTEFVEVLDKNTVNMRVWERGSDETLACGTGACATTVAC 239

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIKTG 284
              +KT   V+V +LGG L I W    N V+MTG A   ++G++ +  G
Sbjct: 240 ILNNKTEDEVTVHLLGGDLKIRWDRKENLVYMTGPATVVFDGEITLPEG 288


>gi|239813906|ref|YP_002942816.1| diaminopimelate epimerase [Variovorax paradoxus S110]
 gi|259595065|sp|C5CND4|DAPF_VARPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|239800483|gb|ACS17550.1| diaminopimelate epimerase [Variovorax paradoxus S110]
          Length = 294

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 144/293 (49%), Gaps = 20/293 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS-- 59
           + F KM+G GN  +V+D       +T+     L+   + HF    DQI+ +      +  
Sbjct: 3   IRFTKMQGAGNDFVVLDETRGTLGLTAAQYRFLA---DRHFGVGADQILTVRPPSKGAAE 59

Query: 60  -VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI 116
            VD    I N DG EV+ CGNG RC +RF+       + +   ET+ GI+  +   DG +
Sbjct: 60  GVDFQYVIHNADGGEVEQCGNGARCFMRFVREHHLTDKDTVRVETLAGIIEPRMGADGRV 119

Query: 117 SVDMGEPILDWKLIPL-ARSFDKMDRDRFH-----IGPVNHLFLRNPFVVSMGNPHAIFF 170
           +VDMG PI +   +P      D      +H     +G      + +  V+SMGNPHA+  
Sbjct: 120 TVDMGPPIFEPARVPFDTAGLDPQPTGSWHTWHLALGTHADSAIVSVAVLSMGNPHAVQV 179

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V D++    +A  G L+  HP F++ VN    +V     + LR +ERG G T ACG+ AC
Sbjct: 180 V-DNVDTAPVARQGPLIEHHPRFAQRVNAGFMQVVDRSHIKLRVFERGAGETLACGTGAC 238

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIK 282
           A+VVA   L    R V V+  GG L I W    H V MTG A   +EG +++ 
Sbjct: 239 AAVVAGIRLGLLERRVDVQTHGGVLTIGWEGEGHPVLMTGPATTVFEGDIEVP 291


>gi|124268429|ref|YP_001022433.1| diaminopimelate epimerase [Methylibium petroleiphilum PM1]
 gi|166225730|sp|A2SKV9|DAPF_METPP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|124261204|gb|ABM96198.1| diaminopimelate epimerase [Methylibium petroleiphilum PM1]
          Length = 296

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 143/290 (49%), Gaps = 17/290 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASVDAFI 64
           F KM+G GN  +V+D     + +T          D       DQ++++    +  +D   
Sbjct: 5   FTKMQGAGNDFVVLDA--TREPLTLSPAQYRYLADRRFGVGADQVLIVGASDEPGIDFTY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI+N DGSEV+ CGNG RC VR++      K+ +    T  G++  +   DG ++VDMG 
Sbjct: 63  RIVNADGSEVEQCGNGARCFVRYVREAGLTKKSAIRVRTAGGVIEPRWLVDGRVTVDMGA 122

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHL-FLRNPFVVSMGNPHAIF----FVEDDLY 176
           P+ +   +P  A      + + F + P++         VVSMGNPHA+     F    + 
Sbjct: 123 PVFEPARVPFDAAGLQPRELNGFALWPLDAADRTVEAAVVSMGNPHAVMNVAQFGSGGVD 182

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+ +H  F + VN    +V S   + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 183 EAPVAELGPLVERHTRFPQRVNAGFLQVLSDTHVKLRVYERGAGETLACGTGACAAVVAG 242

Query: 237 GCLH--KTNRAVSVKMLGGGLLIEW--HDNNHVFMTGEAKKEWEGKLDIK 282
             L   +    V V   GG L IEW    +  V+MTG A+  + G++D+ 
Sbjct: 243 IRLGWLRAGTPVDVDTRGGELTIEWAGRSDAPVWMTGPAESVYVGEIDLP 292


>gi|123968506|ref|YP_001009364.1| diaminopimelate epimerase [Prochlorococcus marinus str. AS9601]
 gi|123198616|gb|ABM70257.1| Diaminopimelate epimerase [Prochlorococcus marinus str. AS9601]
          Length = 286

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 148/287 (51%), Gaps = 20/287 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F K +G GN  ++ID RG   + N  ++ I  +    N  F    D ++ I +  + +
Sbjct: 4   ISFEKYQGNGNDFVIIDSRGNELYKNYKTNKIFDIKKICNRQFGVGADGVIFIEEPNEDN 63

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGS 115
               I I N DGSE Q CGNG+RC+V +L    +   +   +  ET  G+ +AK   D  
Sbjct: 64  YAKMI-IFNSDGSEAQMCGNGIRCLVEYLHVNDSMNNENIEYKIETKAGLKIAKYIND-E 121

Query: 116 ISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           I+V MG PIL+ + IP  + +  + +    F    +   F    + V MGNPH IFFV+D
Sbjct: 122 ITVKMGVPILEGQNIPTTIEKKINSIPSHEF----IEKDFSNMGYAVGMGNPHLIFFVKD 177

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    L+  G +  K+ +F E  N+   ++ + +++ ++ WERG G T ACG+ ACA  
Sbjct: 178 -IESIVLSRLGPIFEKNELFPEKTNVHFCQILNRDNIKVKVWERGAGPTLACGTGACAIH 236

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
           VA+  L   N    V + GG L I+W  D+  V MTG AKK + G +
Sbjct: 237 VAAYKLGLCNSQTIVTLPGGNLKIDWSEDDCEVMMTGNAKKVFSGSI 283


>gi|206558908|ref|YP_002229668.1| diaminopimelate epimerase [Burkholderia cenocepacia J2315]
 gi|198034945|emb|CAR50817.1| diaminopimelate epimerase [Burkholderia cenocepacia J2315]
          Length = 309

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 142/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTDAQVRALA---NRHFGIGADQLLLVEKPTVDGA 79

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 80  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVV 139

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P  A   D     R  + P++     R    VSMGNPHA+  V DD  
Sbjct: 140 DMGAPVFAPAQVPFDAAGLDGRQEGRDTLWPLDVGGATRWISTVSMGNPHAVQVV-DDAE 198

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 199 AYPVLEEGPLIERHARFPQRVNAGFMQIVSRREVKLRVYERGAGETLACGTGACAAVAAG 258

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 259 IRRGLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPATTVFEGEIDL 307


>gi|149912566|ref|ZP_01901100.1| diaminopimelate epimerase [Roseobacter sp. AzwK-3b]
 gi|149812972|gb|EDM72798.1| diaminopimelate epimerase [Roseobacter sp. AzwK-3b]
          Length = 292

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 140/275 (50%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     +T     AL+       FDQ+ +I   Q    DA +
Sbjct: 24  LPFMKMHGLGNDFVVLDARARSLEVTPALAIALADRHKGVGFDQLAVISQGQR---DAHL 80

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL     +      T RG L A +  +G  +V+MG+P 
Sbjct: 81  TFYNADGSTSAACGNATRCIARFLMDESGQGELCLTTDRGDLYALDRGEGMTAVNMGQPQ 140

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L+W+ IPLA + D ++       P+       P    MGNPH  FFVED      L  FG
Sbjct: 141 LEWQDIPLAEAMDTVEL------PIEG----GPSATGMGNPHCTFFVED-AEAIPLEQFG 189

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +  VT  + L +R WERGVG T A GS++CA+ VA+     T R
Sbjct: 190 PRYEHHPLYPERTNVQVVSVTGPDHLRMRVWERGVGHTLASGSSSCAAAVAAARRGLTGR 249

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG L I+W ++  V+MTG     ++G L
Sbjct: 250 KVRIDLDGGTLYIDWREDG-VWMTGPTAHVFDGVL 283


>gi|260752485|ref|YP_003225378.1| diaminopimelate epimerase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551848|gb|ACV74794.1| diaminopimelate epimerase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 269

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 145/277 (52%), Gaps = 21/277 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +V+D R     +      ALS   N H     DQ+++I + ++ + D  
Sbjct: 5   FHKMHGLGNDFIVLDARKNPIQMNPALAQALS---NRHTGIGCDQLIIIGNGKNQA-DVS 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           + I N DGSEV++CGN  RCV  FL      +     T  G+L A+ + +G+  VDMG P
Sbjct: 61  MEIWNADGSEVEACGNATRCVPVFLG-----RDVIISTAAGLLDARLSDEGA-CVDMGRP 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W  IPLA + D +        PV    L+ P  V+MGNPH +F V+D          
Sbjct: 115 RLSWDEIPLAYAMDTLSM------PVAWEDLKEPTAVNMGNPHVVFVVDDVDAVD-FGRL 167

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           GN++    +F E +N++I  VT    L +RTWERG GLT ACG+ ACA+ VA+      +
Sbjct: 168 GNMIEHDQLFPERINVNIVMVTGKNHLKMRTWERGAGLTRACGTGACATFVAAKRRRLVS 227

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
               + + GG L+++ +   H+ M G A   ++G+ D
Sbjct: 228 GKTQIDLPGGRLVLDENSEGHIIMRGPATYVFKGEAD 264


>gi|254526117|ref|ZP_05138169.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9202]
 gi|221537541|gb|EEE39994.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9202]
          Length = 286

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 147/287 (51%), Gaps = 20/287 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F K +G GN  +VID RG   + N  ++ I  +    N  F    D ++ I +  + +
Sbjct: 4   ITFEKYQGNGNDFIVIDSRGNDIYKNYKTNKIFDIKKICNRQFGIGADGVIFIEEPNEDN 63

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGS 115
               I I N DGSE Q CGNG+RC+V +L    +   K   +  ET  G+ +AK   D  
Sbjct: 64  YAKMI-IFNSDGSEAQMCGNGIRCLVEYLHLNDSMNNKNIEYKIETKAGLKIAKYIND-E 121

Query: 116 ISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           I+V MG PIL+ + IP  +    + +    F    +   F    + V MGNPH IFFV+D
Sbjct: 122 ITVKMGVPILESQNIPTKIENKINSIPSHEF----IQKNFKYIGYAVGMGNPHLIFFVQD 177

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            L    L+  G +   + +F E  N+   ++ + +++ ++ WERGVG T ACG+ ACA  
Sbjct: 178 IL-SIVLSKLGPIFENNELFPEKTNVHFCQILNRDNIKVKVWERGVGPTLACGTGACAIH 236

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
           VA+  L   N    V + GG L I+W  D+  V MTG AK+ + G +
Sbjct: 237 VAAYKLGLCNSQTIVTLPGGDLKIDWSKDDCEVMMTGNAKRVFSGSM 283


>gi|320539386|ref|ZP_08039055.1| diaminopimelate epimerase [Serratia symbiotica str. Tucson]
 gi|320030511|gb|EFW12521.1| diaminopimelate epimerase [Serratia symbiotica str. Tucson]
          Length = 274

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 135/277 (48%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAITQNVYFSPELIRRLSDRHLGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     +      T  G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVQLKGLTNKCELRVSTQSGRMVLNVTGNDQVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  D + +P    F     ++ +I     H  L    +VSMGNPH +  V DD+    +A
Sbjct: 121 PNFDPQAVP----FRATKAEKTYIMRAAEHTVLCG--IVSMGNPHCVLQV-DDVNTAKVA 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   ++ S E + LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGSGETQACGSGACAAVAVGIQQEL 233

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
            +  V V++ GG L I W    + +FMTG A   ++G
Sbjct: 234 LSEEVRVELPGGSLHIRWKGPGSPLFMTGPATHVYDG 270


>gi|148242289|ref|YP_001227446.1| diaminopimelate epimerase [Synechococcus sp. RCC307]
 gi|147850599|emb|CAK28093.1| Diaminopimelate epimerase [Synechococcus sp. RCC307]
          Length = 357

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 137/285 (48%), Gaps = 14/285 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
           F K +G+GN  +++D R      +  D    L         D ++L    Q    D  ++
Sbjct: 19  FRKYQGLGNDFILMDGRTTPLPEMGGDPAKELCDRRFGIGGDGLILALPPQQGG-DVRMQ 77

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFT---FETIRGILVAKENRDGSISVDMGE 122
           I+N DGSE + CGNG+RC  RFL       S T    ET  G+++ +      ++VDMGE
Sbjct: 78  ILNADGSEAEMCGNGIRCFARFLADLDGSASGTQWRVETPAGLMIPRLLEGDQVTVDMGE 137

Query: 123 PILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P L+   IP  LA      D +   +  ++         V MGNPHA+  V DDL   D 
Sbjct: 138 PFLEPASIPTNLAAGTPLPDGE-LQVAGISLQVA----AVGMGNPHAVVQV-DDLESLDF 191

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  L +HP F    N+   +V + + L +R WERG G T ACG+ ACA+VVA+    
Sbjct: 192 DRLGPALEQHPAFPARTNVHFVQVHAPDQLQVRVWERGAGPTLACGTGACATVVATHLRG 251

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGK 285
              R  +V++ GG L I+W   NH+ M G A   +EG L    G 
Sbjct: 252 ACARQATVQLPGGPLQIDWDSTNHIQMAGPAVFVFEGVLPAAGGS 296


>gi|260434560|ref|ZP_05788530.1| diaminopimelate epimerase [Synechococcus sp. WH 8109]
 gi|260412434|gb|EEX05730.1| diaminopimelate epimerase [Synechococcus sp. WH 8109]
          Length = 366

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 146/287 (50%), Gaps = 23/287 (8%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCH--DNITSDAINALSTDDNTHF----DQIMLIHDFQDA 58
           M+ F+K +G+GN  L+++ R     D+I+      +S   +  F    D ++L    Q A
Sbjct: 1   MLQFSKYQGLGNDFLILEGRQGQLPDSISDPDPAWVSRICDRRFGVGGDGLILALPPQ-A 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFETIRGILVAKENRDGS 115
             +  +RI+N DGSE + CGNG+RC+ R+L         + +  ET+ G++  +   D  
Sbjct: 60  EGELRMRILNADGSEAEMCGNGIRCLARYLADTDGDAPGRRWDIETLAGMIRPELMADRQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----VSMGNPHAIFFV 171
           + VDMG P L  + IP       M  D     P   L L +  +    V MGNPH +  V
Sbjct: 120 LRVDMGPPFLTPEAIPTT----VMPEDGL---PQGVLLLEDEQIRVASVGMGNPHVVVPV 172

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DDL      ++G  L  HP F    N+   +V S E L++R WERG G T ACG+ ACA
Sbjct: 173 -DDLASIPFDTWGAALEVHPAFPAKTNVHFLQVHSRERLEIRVWERGAGPTLACGTGACA 231

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           ++VA+  L   +    V + GG L+IEW D +  V MTG A+  ++G
Sbjct: 232 TLVAAVLLGLADDCAEVVLPGGPLMIEWRDRSGSVLMTGPAEAVFDG 278


>gi|296505379|ref|YP_003667079.1| diaminopimelate epimerase [Bacillus thuringiensis BMB171]
 gi|296326431|gb|ADH09359.1| diaminopimelate epimerase [Bacillus thuringiensis BMB171]
          Length = 288

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 146/281 (51%), Gaps = 19/281 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+  V D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVILV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAK 272
           VA+    K  R   ++V + GG L+I W +  +V M G A+
Sbjct: 235 VAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAE 275


>gi|157368431|ref|YP_001476420.1| diaminopimelate epimerase [Serratia proteamaculans 568]
 gi|167012038|sp|A8G852|DAPF_SERP5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|157320195|gb|ABV39292.1| Diaminopimelate epimerase [Serratia proteamaculans 568]
          Length = 274

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 134/276 (48%), Gaps = 10/276 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P   +    +   + +    H  L    VVSMGNPH +  V DD+    +  
Sbjct: 121 PNFDPQTVPFRAT---KEEKTYIMRAAEHTVLCG--VVSMGNPHCVLQV-DDVKTAKVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   ++ S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
           +  V V++ GG L I W    + +FMTG A   ++G
Sbjct: 235 SEEVHVELPGGSLHIRWKGPGSPLFMTGPATHVYDG 270


>gi|254462864|ref|ZP_05076280.1| diaminopimelate epimerase [Rhodobacterales bacterium HTCC2083]
 gi|206679453|gb|EDZ43940.1| diaminopimelate epimerase [Rhodobacteraceae bacterium HTCC2083]
          Length = 273

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 125/232 (53%), Gaps = 14/232 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V D R     +T   + A++       +DQ++ I +   A ++  +
Sbjct: 9   LPFMKMHGLGNDFVVFDERESGSVVTQALVIAMADRHMGVGYDQLVAIRNHDTADIE--L 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+  +  +R  ++  +  T RG+L A +   G I V+MG+P+
Sbjct: 67  VFWNADGSIAGACGNATRCIAGWDLARTGKEVLSIRTERGLLEAVDAGHGDIEVNMGQPM 126

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
            DW  +PLAR  D ++       P+       P   SMGNPH  FFV +D+   +L +FG
Sbjct: 127 TDWHEVPLAREMDTLEL------PIEG----KPTATSMGNPHCTFFV-NDVDAINLEAFG 175

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             +  HP+F E  N+ IA++     + +R WERGVG+T A GS++CA  VA+
Sbjct: 176 PTIEHHPLFPERTNVQIAQIIGPNQIRMRVWERGVGITLASGSSSCAVAVAA 227


>gi|260219996|emb|CBA27092.1| Diaminopimelate epimerase [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 302

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 143/290 (49%), Gaps = 17/290 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +T      L    + HF    DQI+ +       +D
Sbjct: 16  IQFTKMQGAGNDFVVLDETKGRLGLTPAHYRFLG---DRHFGVGADQILTVRPSPAEGID 72

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG+EV+ CGNG RC  RF+  +    +     +T++G++      DG ++VD
Sbjct: 73  FEYVIHNADGNEVEQCGNGSRCFARFVRDQGLTGKDRIRVKTMKGVIEPLLTPDGRVTVD 132

Query: 120 MGEPILDWKLIPL---ARSFDKMDR-DRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVED 173
           MG P+ +   IP      S   M     + + PV         V  VSMGNPHA+  V D
Sbjct: 133 MGAPVFNPADIPFDDSGLSLQAMGSWGNWPLAPVESAQAAPLLVATVSMGNPHAVTLVAD 192

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            +    +A+ G  +  +P F++GVN+   +V S   + LR +ERGVG T ACG+ ACA+V
Sbjct: 193 -VDAAPVATLGPQVQANPRFTQGVNVGFLQVVSRSQVRLRVYERGVGETLACGTGACAAV 251

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
           VA   L   +  V V+  GG L I W      VFMTG A   + G++++ 
Sbjct: 252 VAGIRLGLLDARVDVQTRGGMLTIAWEGMGASVFMTGPATTVFRGEIELP 301


>gi|149191482|ref|ZP_01869731.1| diaminopimelate epimerase [Vibrio shilonii AK1]
 gi|148834670|gb|EDL51658.1| diaminopimelate epimerase [Vibrio shilonii AK1]
          Length = 276

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 140/279 (50%), Gaps = 16/279 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + D I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCITQNVFFSPDLIRRLA-DRHTGVGFDQLLIVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +    + S +  T +G +V K   +  ++V+MG+P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVQMKGLTNKYSVSVSTKKGKMVLKLEENDLVTVNMGQP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHI--GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
             +   IP    F    +++ +I     + LF      VSMGNPH +  V D     D+ 
Sbjct: 124 EFEPNKIP----FKAKQKEKTYILRAGEHTLFCG---AVSMGNPHVVTVV-DSTEEADVD 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F E VN    +V S   ++LR +ERG G T ACGS AC +V        
Sbjct: 176 RLGPLLESHERFPERVNAGFMQVLSRHEVNLRVYERGAGETQACGSGACGAVAVGIVQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKL 279
            +  V+V + GG L I W    H   MTG A   ++G++
Sbjct: 236 LDENVTVHLPGGDLKISWKGEGHPLTMTGPATHVFDGQI 274


>gi|229175640|ref|ZP_04303148.1| Diaminopimelate epimerase [Bacillus cereus MM3]
 gi|228607781|gb|EEK65095.1| Diaminopimelate epimerase [Bacillus cereus MM3]
          Length = 288

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 147/291 (50%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQIPEEDLVLVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE +SCGNG+RCV ++      ++   F  ET+ GI+ A+    +G ++
Sbjct: 62  K--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFKIETLAGIVTAEVTVEEGKVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E VN+    + +   ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEQAPLTTLGPVLETHEMFPERVNVEFVEILNDAEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VAS    K  R   + V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VASILNGKMERGKEIIVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|254881595|ref|ZP_05254305.1| diaminopimelate epimerase [Bacteroides sp. 4_3_47FAA]
 gi|319642980|ref|ZP_07997614.1| diaminopimelate epimerase [Bacteroides sp. 3_1_40A]
 gi|254834388|gb|EET14697.1| diaminopimelate epimerase [Bacteroides sp. 4_3_47FAA]
 gi|317385345|gb|EFV66290.1| diaminopimelate epimerase [Bacteroides sp. 3_1_40A]
          Length = 280

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 146/290 (50%), Gaps = 22/290 (7%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDA 58
           ++ + F KM+G GN  + ++      +   D I A       H     D ++LI   + A
Sbjct: 2   ATTIKFTKMQGTGNDYIYVNTL---SSPLQDPIKAARKWSAYHTGIGADGLVLIGVSEKA 58

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI 116
             D  +RI N DGSE   CGN  RC+ +++  +    ++  T ET+ GI + K +    +
Sbjct: 59  --DFSMRIFNADGSEAMMCGNASRCIGKYVYEKGLTDKEVITLETLSGIKILKLHTGNGV 116

Query: 117 ----SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
               +VDMG P+L        ++   +       G       +  FV  MGNPH + FV 
Sbjct: 117 VKDVTVDMGTPLLSNPGQIATKTGGMLAETILADGKE----YKGTFVC-MGNPHVVIFV- 170

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           DD+   DL + G  L  HP+F E  N+    +   +SL +R WERG G+T ACG+ ACA+
Sbjct: 171 DDIKEVDLPAVGPKLENHPLFPERTNVEFVEILPDQSLRMRVWERGSGITMACGTGACAT 230

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
            VA+   HK  R   V+M GG L I W + + HV+MTG A K +EG++++
Sbjct: 231 AVAAVLNHKAGRKSWVRMDGGDLHIHWDEKDGHVYMTGPAGKVFEGEIEM 280


>gi|296127364|ref|YP_003634616.1| diaminopimelate epimerase [Brachyspira murdochii DSM 12563]
 gi|296019180|gb|ADG72417.1| diaminopimelate epimerase [Brachyspira murdochii DSM 12563]
          Length = 279

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 148/290 (51%), Gaps = 25/290 (8%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDN--ITSDAINALSTDDNTHF----DQIMLIHDFQDA 58
           +++F KM GIGN  + +D   C        DA+       + H+    D I+LI     A
Sbjct: 2   ILNFTKMHGIGNDYIYVD---CFKEKFTVEDAMKYSPILSHRHYSIGADGIILIMPSDKA 58

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENR 112
            V   +R+ N DGSE + CGNG+RCV ++   +   K      ET+RGIL AK    +N 
Sbjct: 59  DVQ--MRMFNYDGSESEMCGNGIRCVAKYAYDKGISKNNPMKIETLRGILDAKLFIKDNE 116

Query: 113 DGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV-VSMGNPHAIFFV 171
             S+ ++M  PIL+   IP       +D++     P+        F  VSMGNPH + FV
Sbjct: 117 ADSVEINMDSPILEGLKIPTT-----IDKNVIIDEPITFNGKTYYFTCVSMGNPHTVIFV 171

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+ + D+A  GN +  + +F    N+    V +   +  RTWERG G T ACG+ A A
Sbjct: 172 -DDVSNMDIADIGNYIENNTIFPNRTNVEFVEVINRGEVKQRTWERGSGETLACGTGASA 230

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             VA     +T+  +   +LGG L++ + +NN VFM GEA+  +EG + +
Sbjct: 231 VCVAGFISKRTDNIILNHLLGGDLILRY-ENNSVFMRGEARYSFEGSVKL 279


>gi|59713091|ref|YP_205867.1| diaminopimelate epimerase [Vibrio fischeri ES114]
 gi|75431420|sp|Q5E1W7|DAPF_VIBF1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|59481192|gb|AAW86979.1| diaminopimelate epimerase [Vibrio fischeri ES114]
          Length = 276

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 143/280 (51%), Gaps = 14/280 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   RI
Sbjct: 5   FSKMHGLGNDFMVVDCLTQNIFFSPDLIRRLADRHRGIGFDQLLVVEAPYDPETDFHYRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMGE 122
            N DGSEV+ CGNG RC  RF+  RMK    + S +  T +G ++ K   D  I+V+MGE
Sbjct: 65  FNADGSEVEQCGNGARCFARFV--RMKGLTNKTSISVSTKKGKMILKVEDDDQITVNMGE 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ +   IP    F     ++ ++  V+   L +   VSMGNPH +  V DD+  YD+  
Sbjct: 123 PVFEPNKIP----FKATQAEKTYLLRVDDKTLFSG-AVSMGNPHCVT-VVDDVDAYDVDK 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           +G L+  H  F E VN    ++ S   + LR +ERG G T ACGS AC +V         
Sbjct: 177 YGQLVESHERFPERVNAGFMQIISPNEVKLRVYERGAGETQACGSGACGAVAVGIMQELL 236

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W      +FMTG A   ++G+L I
Sbjct: 237 GEEVKVSLPGGDLHIVWQGPGKPLFMTGPATHVYDGQLSI 276


>gi|71278746|ref|YP_266845.1| diaminopimelate epimerase [Colwellia psychrerythraea 34H]
 gi|123634292|sp|Q48AR8|DAPF_COLP3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71144486|gb|AAZ24959.1| diaminopimelate epimerase [Colwellia psychrerythraea 34H]
          Length = 276

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 140/283 (49%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  LV+D    +  ++ + I   +  +    FDQ++++    D  +D  
Sbjct: 2   LVNFSKMHGLGNDFLVLDNVTQNVFLSPEQITKFANRNFGVGFDQLLVVEPPYDPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
            RI N DGSEV  CGNG RC  +F+  RMK    +      T  G +     RDG+ISV 
Sbjct: 62  YRIYNADGSEVGQCGNGARCFAKFV--RMKGLCNKHKIKVSTSTGKMNLHIERDGNISVT 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           M  P  + K IP      +     + +   +   L     VSMGNPH +  V D +   D
Sbjct: 120 MPVPQFEPKKIPFTA---QKTEGTYILRSESETVLCG--AVSMGNPHCVVTV-DSVAEAD 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + S G  L+ H  F E  N+    + S   + LR +ERG   T ACGS ACA+VV     
Sbjct: 174 VESLGKELSVHERFPEDANVGFMEIVSPNYIKLRVYERGAAETLACGSGACAAVVIGYMQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            K  + V+V++ GG L I W    H V M+G A   ++G++ I
Sbjct: 234 KKLAKQVTVELPGGKLRIFWQGPGHPVKMSGPATHVFDGQISI 276


>gi|255636095|gb|ACU18392.1| unknown [Glycine max]
          Length = 359

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 141/294 (47%), Gaps = 19/294 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-V 60
           +S  + FAK  G+GN  ++ID R   +   S        D N       +I      S  
Sbjct: 71  ESGFLHFAKYHGLGNDFVLIDNRDSSEPKISAEKAVQLCDRNFGVGADGVIFVLPGISGT 130

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC  +F   L +   R SFT  T  G+++ +   DG++ 
Sbjct: 131 DYTMRIFNSDGSEPEMCGNGVRCFAKFVSQLENLHGRHSFTIHTGAGLIIPEVLEDGNVR 190

Query: 118 VDMGEPILDWKLIPLARSFDK----MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           VDMGEPIL    +P     +K    +  +    G + H+       VSMGNPH + F  +
Sbjct: 191 VDMGEPILKASDVPTKLHANKDNAVVKSELVVDGVIWHVT-----CVSMGNPHCVTFSRE 245

Query: 174 D-----LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
                 +    LA  G     H +F    N    +V S   L +  WERG G T ACG+ 
Sbjct: 246 GSQNLLVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSNSHLKMCVWERGAGATLACGTG 305

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           ACA+VVA+    +  R  +V + GG L IEW  ++NHV+MTG A   + G L +
Sbjct: 306 ACATVVAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGSADVVYYGSLPL 359


>gi|265750458|ref|ZP_06086521.1| diaminopimelate epimerase [Bacteroides sp. 3_1_33FAA]
 gi|263237354|gb|EEZ22804.1| diaminopimelate epimerase [Bacteroides sp. 3_1_33FAA]
          Length = 280

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 150/288 (52%), Gaps = 18/288 (6%)

Query: 3   SSMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++ + F KM+G GN  + ++ +R    +    +I   S       D ++LI   +    D
Sbjct: 2   ATTIKFTKMQGAGNDYIYVNTLRHPIADPVRTSIKWSSCHTGIGSDGLVLIG--KSTKAD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDG----S 115
             +RI N DGSE   CGN  RC+ +++      +++  T ET+ GI + K + +      
Sbjct: 60  FSMRIFNADGSEAMMCGNASRCIGKYVYDNKLTQKEVITLETLSGIKILKLHTENGLVEE 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRF-HIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           ++VDM     D  L+  +R  +  D         V+    +  FV  MGNPH + F+ DD
Sbjct: 120 VTVDM-----DLPLLTNSRQINTPDGKMLAKTITVDGKEYKGTFVC-MGNPHLVIFI-DD 172

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           + + +L + G  L  HP+F E  N+    V    SL +R WERG G+T ACG+ ACA+ V
Sbjct: 173 IKNVNLPAIGPKLENHPLFPERTNVEFVEVLPDGSLRMRVWERGSGITMACGTGACATAV 232

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           A+   HKT R   V+M GG L + W++ + HV+MTG A K ++G+++I
Sbjct: 233 AAYLNHKTGRKSRVRMDGGDLQVHWNETDGHVYMTGPAVKVFDGEIEI 280


>gi|255671799|gb|ACU26532.1| diaminopimelate epimerase [Glycine max]
          Length = 359

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 141/294 (47%), Gaps = 19/294 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDAS-V 60
           +S  + FAK  G+GN  ++ID R   +   S        D N       +I      S  
Sbjct: 71  ESGFLHFAKYHGLGNDFVLIDNRDSSEPKISAEKAVQLCDRNFGVGADGVIFVLPGISGT 130

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC  +F   L +   R SFT  T  G+++ +   DG++ 
Sbjct: 131 DYTMRIFNSDGSEPEMCGNGVRCFAKFVSQLENLHGRHSFTIHTGAGLIIPEVLEDGNVR 190

Query: 118 VDMGEPILDWKLIPLARSFDK----MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           VDMGEPIL    +P     +K    +  +    G + H+       VSMGNPH + F  +
Sbjct: 191 VDMGEPILKXXDVPTKLHANKDNAVVKSELVVDGVIWHVT-----CVSMGNPHCVTFSRE 245

Query: 174 D-----LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
                 +    LA  G     H +F    N    +V S   L +  WERG G T ACG+ 
Sbjct: 246 GSQNLLVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSNSHLKMCVWERGAGATLACGTG 305

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           ACA+VVA+    +  R  +V + GG L IEW  ++NHV+MTG A   + G L +
Sbjct: 306 ACATVVAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGSADVVYYGSLPL 359


>gi|161526249|ref|YP_001581261.1| diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
 gi|160343678|gb|ABX16764.1| Diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
          Length = 387

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 147/292 (50%), Gaps = 19/292 (6%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T+  + AL++    HF    DQ++L+        
Sbjct: 101 LSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALAS---RHFGIGADQLLLVEKPTVDGA 157

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 158 DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVV 217

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDL 175
           DMG P+   + +P  A   D     R  + P+  +  R  ++  VSMGNPHA+  V DD 
Sbjct: 218 DMGAPVFAPEQVPFDASGLDGRSEGRDTLWPLE-VGGRTRWISTVSMGNPHAVQVV-DDA 275

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A
Sbjct: 276 EAYPVLEEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAA 335

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
                  +  V+V   GG L I W     ++  + M G A   +EG++D+  
Sbjct: 336 GIRRGLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVFEGEIDLPA 387


>gi|65316928|ref|ZP_00389887.1| COG0253: Diaminopimelate epimerase [Bacillus anthracis str. A2012]
 gi|228917567|ref|ZP_04081111.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229158537|ref|ZP_04286596.1| Diaminopimelate epimerase [Bacillus cereus ATCC 4342]
 gi|228624851|gb|EEK81619.1| Diaminopimelate epimerase [Bacillus cereus ATCC 4342]
 gi|228842047|gb|EEM87150.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 280

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 147/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEQAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVAS    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 277


>gi|241761946|ref|ZP_04760031.1| Diaminopimelate epimerase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373626|gb|EER63198.1| Diaminopimelate epimerase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 269

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 145/277 (52%), Gaps = 21/277 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +V+D R     +      ALS   N H     DQ+++I + ++ + D  
Sbjct: 5   FHKMHGLGNDFIVLDARKNPIQMNPALAQALS---NRHTGIGCDQLIIIGNGKNQA-DVS 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           + I N DGSEV++CGN  RCV  FL      +     T  G+L A+ + +G+  VDMG P
Sbjct: 61  MEIWNADGSEVEACGNATRCVPVFLG-----RDVIISTAAGLLDARLSDEGA-CVDMGRP 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W  IPLA + D +        PV    L+ P  V+MGNPH +F V+D          
Sbjct: 115 RLSWDEIPLAYAMDTLSM------PVAWEDLKEPTAVNMGNPHVVFVVDDVDAVD-FGRL 167

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           GN++    +F E +N++I  VT    L +RTWERG GLT ACG+ ACA+ VA+      +
Sbjct: 168 GNIIEHDQLFPERINVNIVMVTGKNHLKMRTWERGAGLTRACGTGACATFVAAKRRRLIS 227

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
               + + GG L+++ +   H+ M G A   ++G+ D
Sbjct: 228 GKTQIDLPGGRLVLDENSEGHIIMRGPATYVFKGEAD 264


>gi|228936237|ref|ZP_04099036.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228823353|gb|EEM69186.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 280

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 147/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEQAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVAS    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHGVYEYK 277


>gi|296136667|ref|YP_003643909.1| diaminopimelate epimerase [Thiomonas intermedia K12]
 gi|295796789|gb|ADG31579.1| diaminopimelate epimerase [Thiomonas intermedia K12]
          Length = 287

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 143/288 (49%), Gaps = 17/288 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           V F KM G GN  +V+D       + +  +  L+   + HF    DQI+L+       VD
Sbjct: 3   VAFTKMHGAGNDFVVLDATRSPLALNAAQLRLLA---DRHFGVGADQILLVEAAPSPEVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC V ++  +    ++    +T+ G++  +   DG ++VD
Sbjct: 60  FGYRIFNADGGEVEQCGNGARCFVAYVHGKGLTAKRRIRVQTLSGLIEPELQPDGRVTVD 119

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDLY 176
           MG P+ D   +P  A        D +   P++ L     +V  +SMGNPHA+  V DD+ 
Sbjct: 120 MGAPVFDLPRVPFEAHGLRPRQVDGWEQWPLD-LAGATAWVSVLSMGNPHAVQRV-DDVD 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G L+  HP F   VN    ++   + + LR WERG G T ACG+ ACA+VVA 
Sbjct: 178 TAPVLRDGPLIEHHPRFPRRVNAGFMQIVDAQHIRLRVWERGAGETLACGTGACAAVVA- 236

Query: 237 GCLHK-TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIK 282
           G  H     AV V+  GG L I W      V MTG A   ++G +D+ 
Sbjct: 237 GLRHGWLQGAVDVQTHGGELTISWAGAGQPVRMTGPAAFVFDGMIDLP 284


>gi|297180324|gb|ADI16542.1| diaminopimelate epimerase [uncultured bacterium HF4000_009C18]
          Length = 275

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 142/265 (53%), Gaps = 4/265 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           +D  KM+G+GN  ++ D R    ++T D I  +S   N   DQ++ I +  D + +  + 
Sbjct: 4   LDAYKMDGLGNDFIIFDKRKKSISLTKDQIIKISDRSNIGCDQVIFIDN--DKNNNTSLT 61

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             N DG E+ +CGNG RC    L      K  +  T  GIL A+      + ++MG+P  
Sbjct: 62  FYNSDGGEIAACGNGSRCTAYLLMKENNSKKISLRTKVGILQAELYDKNLVRINMGQPNF 121

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL++  D  +  +  I   +   +   F +S+GNPH IFFVED    ++L   G 
Sbjct: 122 KWGKIPLSKEMDNKNL-KIKINSTDDKEIEGGFSLSVGNPHIIFFVED-FNKFNLKEIGP 179

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            +  H  F E  N+++A + + + + ++ WERG GLT ACG+AACA+ VA   L    R 
Sbjct: 180 KIENHNYFPEKCNVTLASIKNKKHVKIKVWERGAGLTKACGTAACATAVAGAVLKLNERY 239

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGE 270
           V ++   G L I+W+ +N+++MTG+
Sbjct: 240 VDIEFQEGLLNIDWNADNNIYMTGK 264


>gi|50123103|ref|YP_052270.1| diaminopimelate epimerase [Pectobacterium atrosepticum SCRI1043]
 gi|81643660|sp|Q6CZG8|DAPF_ERWCT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|49613629|emb|CAG77080.1| diaminopimelate epimerase [Pectobacterium atrosepticum SCRI1043]
          Length = 274

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 141/278 (50%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  + + +P    F  +  ++ +I   + H  L    VVSMGNPH +  VED +    + 
Sbjct: 121 PNFEPQQVP----FRAVKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVED-VETAKVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F +  N+   +V   +++ LR +ERG G T ACGS ACA+ VA G L  
Sbjct: 174 TLGPLLESHERFPDRANIGFMQVVDSQTVRLRVYERGAGETQACGSGACAA-VAVGILQG 232

Query: 242 TNRA-VSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
              A V V + GG L I+W    H +FMTG A   ++G
Sbjct: 233 LLSAKVRVSLPGGELDIQWDGPGHPLFMTGPATHVYDG 270


>gi|241661657|ref|YP_002980017.1| diaminopimelate epimerase [Ralstonia pickettii 12D]
 gi|240863684|gb|ACS61345.1| diaminopimelate epimerase [Ralstonia pickettii 12D]
          Length = 292

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 135/286 (47%), Gaps = 19/286 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +V+D      + T +   A++   + HF    DQ++L+       VD  
Sbjct: 5   FTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIA---DRHFGVGADQLLLVERSTRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG
Sbjct: 62  YRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNGIATLTMQDDGQVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNP-----FVVSMGNPHAIFFVEDDLY 176
            P+ +   +P      +    R       H    N        VSMGNPHA+  V DD  
Sbjct: 122 APVFEAARLPF---LPEGLPTRVEGDDTQHALQINGRTEWLSTVSMGNPHAVQIV-DDTE 177

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G L+  H +F   VN    ++    S+ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 178 AFPVLEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGETLACGTGACAAVVAG 237

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                 +  V V   GG L I W      V MTG A   +EG LD+
Sbjct: 238 IRRGVLDSPVKVTTHGGDLTIAWAGGGQPVMMTGPATTVFEGTLDL 283


>gi|325982879|ref|YP_004295281.1| diaminopimelate epimerase [Nitrosomonas sp. AL212]
 gi|325532398|gb|ADZ27119.1| diaminopimelate epimerase [Nitrosomonas sp. AL212]
          Length = 275

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 145/284 (51%), Gaps = 19/284 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G+GN  +V+D      N+    I  L+   + HF    DQ++L+    +   D
Sbjct: 3   LKFTKMQGLGNDFVVVDGINQTVNLDRQQIRHLA---DRHFGIGCDQLLLVEK-AEGQAD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC VR++      +      ET+ G++  +   +G+I+V+
Sbjct: 59  FRYRIFNADGGEVEQCGNGARCFVRYVHDHGLTQNSEIRIETLSGVISPRLENNGNITVN 118

Query: 120 MGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG+PI + + IP +A       +      PV    L      SMGNPHA+  V  D+   
Sbjct: 119 MGKPIFEPERIPFIADQCALTYQLELPDSPVTICAL------SMGNPHAVRVV-TDIARA 171

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +A+ G L+ +H  F   VN+   +V     + LR +ERG G T ACG+ ACA+VVA   
Sbjct: 172 PVATEGALIEQHWRFPNKVNVGYLQVIDRNHIKLRVFERGAGETLACGTGACAAVVAGIT 231

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           L   +R V V   GG L I W      V+MTG A   +EG++++
Sbjct: 232 LGLLDRQVVVSTQGGELTISWQGYGEPVWMTGPAVTVFEGEINL 275


>gi|227114725|ref|ZP_03828381.1| diaminopimelate epimerase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 274

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 138/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  + + +P    F  +  ++ +I   + H  L    VVSMGNPH +  VED +    + 
Sbjct: 121 PNFEPQQVP----FRAVKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVED-VETAKVD 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F E  N+   +V    ++ LR +ERG G T ACGS ACA+V        
Sbjct: 174 TLGPLLESHERFPERANIGFMQVVDSHAVRLRVYERGAGETQACGSGACAAVAVGIQQGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            + +V V + GG L I+W    H +FMTG A   ++G
Sbjct: 234 LSASVRVSLPGGELDIQWDGPGHPLFMTGPATHVYDG 270


>gi|170700793|ref|ZP_02891784.1| Diaminopimelate epimerase [Burkholderia ambifaria IOP40-10]
 gi|170134280|gb|EDT02617.1| Diaminopimelate epimerase [Burkholderia ambifaria IOP40-10]
          Length = 294

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 143/294 (48%), Gaps = 22/294 (7%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVV 119

Query: 119 DMGEPILDWKLIPL------ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFV 171
           DMG P+     +P       A   D     R  + P++     R    VSMGNPHA+  V
Sbjct: 120 DMGAPVFAPAQVPFDTAGPGASGLDGRAEGRDTLWPLDVGGATRWISAVSMGNPHAVQVV 179

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+  Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA
Sbjct: 180 -DDVEAYPVLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACA 238

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
           +V A       +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 239 AVAAGIRRGLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPAATVFEGEIDL 292


>gi|73539904|ref|YP_294424.1| diaminopimelate epimerase [Ralstonia eutropha JMP134]
 gi|123626043|sp|Q476V3|DAPF_RALEJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|72117317|gb|AAZ59580.1| diaminopimelate epimerase [Ralstonia eutropha JMP134]
          Length = 288

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 144/287 (50%), Gaps = 17/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD--NITSDAINALSTDDNTHF----DQIMLIHDFQDAS 59
           + F KM G GN  +V+D  G H   ++T++   AL++    HF    DQ++++       
Sbjct: 3   LQFTKMHGAGNDFVVLD--GIHQKLDLTTEQWRALAS---RHFGVGADQMLIVEKPTRED 57

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV+ CGNG RC VRF+T +    ++S   E + G++      DG ++
Sbjct: 58  VDFRYRIFNADGSEVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNGVITLTLQDDGQVT 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV--VSMGNPHAIFFVEDDL 175
           VDMG P L+   +P       +      I     +  R  ++  VSMGNPHA+  V DD+
Sbjct: 118 VDMGAPELEPARVPFRPDGLPVRTQGEDIAYGLEINGRTAWISPVSMGNPHAVQVV-DDV 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
            ++ +   G L+  H  F   VN    +V    +  LR +ERG G T ACG+ ACA+VVA
Sbjct: 177 ENFPVLQDGPLIEHHATFPNRVNAGFLQVVDRHTARLRVFERGAGETLACGTGACAAVVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
                  +  V V   GG L I W      V MTG A   +EG +D+
Sbjct: 237 GIRRGLLDSPVKVHTHGGDLNIAWDGGAEPVRMTGPATTVFEGTIDL 283


>gi|300864689|ref|ZP_07109546.1| Diaminopimelate epimerase [Oscillatoria sp. PCC 6506]
 gi|300337350|emb|CBN54694.1| Diaminopimelate epimerase [Oscillatoria sp. PCC 6506]
          Length = 278

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 144/284 (50%), Gaps = 18/284 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K  G+GN  ++ID R  H +     +       + HF    D ++     Q+ + D
Sbjct: 3   IEFTKYHGLGNDFILIDNR--HQSEPILTLQQAEELCDRHFGIGGDGVIFALPGQNGT-D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSISV 118
             +RI N DGSE + CGNG+RC+ +F   L     +  +  +T+ G++  +   DG + V
Sbjct: 60  YTMRIYNSDGSEAEMCGNGIRCLAKFIADLEGVNAKTQYRIDTLAGVMTPELLADGQVKV 119

Query: 119 DMGEPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P L    IP   + +  DR      +      +L     VSMGNPH I FVED + 
Sbjct: 120 DMGIPRLLAAEIP--TTLESPDRKVVELPLEVAGQSWLVT--CVSMGNPHCITFVED-VS 174

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L + G L   H +F +  N    ++   + + +R WERG G+T ACG+ ACASVVA 
Sbjct: 175 AIALETIGPLFEHHAVFPQRTNTEFIQIIRRDYVKMRVWERGAGVTLACGTGACASVVAG 234

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
               K +R  +V++ GG L IEW   +  ++MTG A + + GK+
Sbjct: 235 VLAGKCDRIAAVELPGGILQIEWSQVDQRLYMTGPAVQVFAGKI 278


>gi|260596033|ref|YP_003208604.1| diaminopimelate epimerase [Cronobacter turicensis z3032]
 gi|260215210|emb|CBA27065.1| Diaminopimelate epimerase [Cronobacter turicensis z3032]
          Length = 274

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 133/276 (48%), Gaps = 10/276 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPEMIRRLADRHQGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V   N D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKREIRVSTANGRMVLTVNEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ +  L+P     +K ++          +      VVSMGNPH +  V DD+    + +
Sbjct: 121 PVFEPSLVPF--RANKAEKTYIMRAAEQTVLCG---VVSMGNPHCVIQV-DDVATAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E  N+   ++ + E + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLMESHERFPERANIGFMQIMNTEHIRLRVFERGAGETQACGSGACGAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
              V V + GG L I W    N +FMTG A   ++G
Sbjct: 235 AAQVRVDLPGGRLDIAWKGPGNPLFMTGPATHVYDG 270


>gi|169831756|ref|YP_001717738.1| diaminopimelate epimerase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|229807496|sp|B1I545|DAPF_DESAP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169638600|gb|ACA60106.1| Diaminopimelate epimerase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 278

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 137/279 (49%), Gaps = 11/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           ++F KM G+GN  ++++  G        A+     D         L+     A+ D  +R
Sbjct: 1   MEFTKMHGLGNDFVIVNGFGQSLPDDPGALARRVCDRRLGVGADGLVLLLPSAAADLRMR 60

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG---SISVDM 120
           + N DGSE + CGN +RCV  +   R  + +     ET+ G++  +   DG   ++ VDM
Sbjct: 61  VFNPDGSEPEMCGNAIRCVALYARRRGLVAKTQLEVETLAGLIRPEILLDGDRETVRVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L+   IP+      +  +    G  + +       VSMGNPH + F   DL     
Sbjct: 121 GRPRLERAEIPMRGPAGPVVGEVLDAGERSFMVT----AVSMGNPHCVVF-GADLDDAGF 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
             +G LL  HP F    N+    V S   + +R WERGVG T ACG+ ACA  VA     
Sbjct: 176 RKYGPLLEVHPAFPARTNVEFVEVLSPGEVAVRVWERGVGPTPACGTGACAVAVAGVLTG 235

Query: 241 KTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGK 278
           +T R V V++ GG LLIEW D+   V+M+G A++ ++GK
Sbjct: 236 RTARRVHVRLPGGVLLIEWPDDAGPVYMSGPAEEVFDGK 274


>gi|119510990|ref|ZP_01630111.1| diaminopimelate epimerase [Nodularia spumigena CCY9414]
 gi|119464335|gb|EAW45251.1| diaminopimelate epimerase [Nodularia spumigena CCY9414]
          Length = 279

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 143/285 (50%), Gaps = 19/285 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F K  G+GN  +++D R     + +    A+   D  HF    D ++     ++ + D
Sbjct: 3   IEFTKYHGLGNDFILVDNRASSLPVLTPE-QAIQLCDR-HFGIGADGVIFALPGENGA-D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENRDGSIS 117
             +RI N DGSE + CGNG+RC+ RF+         + S+   T+ G++  +   DG + 
Sbjct: 60  YTMRIFNSDGSEPEMCGNGIRCLGRFIADLEGESRNKDSYRIHTLAGMITPQLMADGQVK 119

Query: 118 VDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P L    IP  L  +  K+      +             VSMGNPH I FV  D+
Sbjct: 120 VDMGLPRLLAGEIPTTLGTAETKVINQPLEVAGQTWEVT----CVSMGNPHCITFV-SDV 174

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L   G     HP F + +N    +V S + + +R WERG G+T ACG+ ACAS+VA
Sbjct: 175 AAIPLEIIGPQFEHHPAFPQRINTEFIQVVSRDYVKMRVWERGAGITLACGTGACASLVA 234

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
                  +R  +V++ GG L IEW + +  ++MTG A+K + G+L
Sbjct: 235 GVLTGNCDRIATVELPGGPLQIEWSEIDQRIYMTGPAQKVFTGQL 279


>gi|297183608|gb|ADI19735.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 274

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 139/262 (53%), Gaps = 8/262 (3%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           KM+G+GN  ++ID R  +  ++ D I  +   +    DQ+++I   ++  +DA +   N 
Sbjct: 7   KMDGLGNDFVIIDQRIENIELSKDQIIKICNRNFIGCDQLIIIK--KNPKLDAELEFYNS 64

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGS--ISVDMGEPILDW 127
           DGS   +CGNG RCV  FL+    +K  T  T  G+L  K N  GS  +  ++G P  +W
Sbjct: 65  DGSPTGACGNGTRCVADFLSKENNQKEITVWTSSGVL--KSNILGSNLVETEIGTPKTNW 122

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             IPL+++ D  + +   I   N+        V++GNPH +FFV+D + ++DL   G  +
Sbjct: 123 NEIPLSKNLDTKNLN-IKILSKNNTEHIGGAAVNVGNPHIVFFVKD-IENFDLKKIGPEI 180

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             H +F E  N+++A+V +   + ++ WERG GLT ACG+AACAS +A        +   
Sbjct: 181 ENHKLFPEKCNVTLAKVINKNLIKVKVWERGSGLTKACGTAACASAIAGNINGFVEKKTD 240

Query: 248 VKMLGGGLLIEWHDNNHVFMTG 269
           ++   G L I     N V M G
Sbjct: 241 IEFKLGKLSIFIDAKNSVHMKG 262


>gi|56421492|ref|YP_148810.1| diaminopimelate epimerase [Geobacillus kaustophilus HTA426]
 gi|81557752|sp|Q5KVP4|DAPF_GEOKA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56381334|dbj|BAD77242.1| diaminopimelate epimerase [Geobacillus kaustophilus HTA426]
          Length = 290

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 153/301 (50%), Gaps = 41/301 (13%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS---TDDNTHF--DQIMLIHDFQDASVDA 62
           F KM G+GN  + +D+    + +  + + A++    D +T    D ++LI   + A V  
Sbjct: 6   FTKMHGLGNSYIYVDL--FRETLPEEELPAIARSVADVHTGIGSDGLILICPSEKAPVK- 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGSI 116
            +RI N DGSE ++CGNG+RCV ++      +  ++F  ET+ G++ A+    +    S+
Sbjct: 63  -MRIFNSDGSEGKNCGNGLRCVAKYAYEHGIVSDRTFLIETLSGLVEARVAVADGEVTSV 121

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----------VSMGNPH 166
           +VDMGEP L+   IP+             +GP     +  PF           VSMGNPH
Sbjct: 122 TVDMGEPRLERSAIPM-------------LGPEAERVVAEPFAIAGGEYEITAVSMGNPH 168

Query: 167 AIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
            IF+V DD+    + + G L+ K P F EGVN+    V +   L  R WERG G+T ACG
Sbjct: 169 VIFYV-DDIQKAPVTTLGPLVEKDPRFPEGVNVEFVEVVNERELHFRVWERGSGVTQACG 227

Query: 227 SAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
           + ACA+VVAS    KT R     V + GG L I W  +  V MTG A+    G    + G
Sbjct: 228 TGACAAVVASVLNGKTARGEETVVHLAGGDLTIVWGHDGRVRMTGPAETVCTGVYYYRGG 287

Query: 285 K 285
           +
Sbjct: 288 R 288


>gi|225677211|ref|ZP_03788204.1| diaminopimelate epimerase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590735|gb|EEH11969.1| diaminopimelate epimerase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 262

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 147/266 (55%), Gaps = 17/266 (6%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           +F KM G GN  ++ID R  ++       N     D +  DQ+++I      + D F+ I
Sbjct: 8   NFIKMHGTGNNFVIIDSRSTNN----LDWNHRQIADQSSCDQVIIIT--MSNAADCFMHI 61

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE-TIRGILVAKENRDGSISVDMGEPIL 125
            N DGS  + CGN  RCV   + S    +    E T + IL   +  D SI V+MG+P+L
Sbjct: 62  YNADGSRAEMCGNAARCVGYLIMSEKGAEYSIIELTSKRILECFKVGDKSIKVNMGKPLL 121

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+   D +     H+ P+    L++P  V++GNPH +FFV D++    L + G 
Sbjct: 122 KWHEIPLSTECDTL-----HL-PIELEMLKDPVAVNIGNPHIVFFV-DNISEIPLRNLGP 174

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL-HKTNR 244
            L  H +F   +N+SIA+V     + LR WERG G+TA+CGSAACA++VAS    +   +
Sbjct: 175 KLENHALFPRKINVSIAQVEKSGEIALRVWERGTGITASCGSAACAALVASTLRGYLVAQ 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGE 270
             SV + GG LLIEW +N  VFMTG+
Sbjct: 235 QTSVNLPGGKLLIEWANN--VFMTGD 258


>gi|312621623|ref|YP_004023236.1| diaminopimelate epimerase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202090|gb|ADQ45417.1| diaminopimelate epimerase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 278

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 149/291 (51%), Gaps = 38/291 (13%)

Query: 8   FAKMEGIGNKILVIDMRG-------------CHDNITSDAINALSTDDNTHFDQIMLIHD 54
           F+KM G+GN  +VID RG             CH +I   A            D ++L+ D
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNLLAKRMCHRHIGVGA------------DGLLLVLD 50

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE-- 110
            + A  D  +RIIN DGSE + CGNG+RC  +++  R  +K   F  ET+ GI+  +   
Sbjct: 51  SKLA--DIRMRIINSDGSEAEMCGNGIRCFAKYVFERGIVKATKFKVETLAGIIEPELFI 108

Query: 111 NRDG---SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHA 167
           N  G    + V+MG+P    K IP+ +   K D     I    + +     +  MG PH 
Sbjct: 109 NEYGLVDKVKVNMGKPSFKRKDIPM-QGDPKSDAINTSIVVDGNEYRITSLL--MGVPHT 165

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           I FV DDL   D+ + G  + KH +F    N++  +V    ++ +RTWERG G T ACG+
Sbjct: 166 ILFV-DDLEKVDIYTLGPKIEKHEIFPRKTNVNFVQVIDKNNIKVRTWERGAGATFACGT 224

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
            +CASV+A+     T R  +V +  G L IEW ++  VFMTG A++ + G+
Sbjct: 225 GSCASVIAANLNGLTERKANVHLYFGILEIEWREDGIVFMTGPAEEVFVGE 275


>gi|329957955|ref|ZP_08298387.1| diaminopimelate epimerase [Bacteroides clarus YIT 12056]
 gi|328522104|gb|EGF49220.1| diaminopimelate epimerase [Bacteroides clarus YIT 12056]
          Length = 284

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 142/283 (50%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +D  R   +N    +    +       D ++LI     A  D  +
Sbjct: 5   IKFTKMHGAGNDYIYVDTTRYPIENPEKLSKKWSAPHTGIGSDGLVLIGRSDKA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE + CGN  RC+ ++L       +   T +T+ GI + K +  G    +++V
Sbjct: 63  RIFNADGSEAKMCGNASRCIGKYLYDYKLTSKTEITLDTLSGIKILKLHATGDKVDTVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P  D  +    +    M      I  + +        VSMGNPH + FV +D+   
Sbjct: 123 DMGIP-SDEPVNYDGKGSKPMTEHPIEIDGIRY----TGTTVSMGNPHLVIFV-NDITKA 176

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL+S G  L  HP+F + +N+  A+V     + +R WERG G+T ACG+ ACA+ VA+  
Sbjct: 177 DLSSIGPKLENHPLFPDRINVEFAQVLEEGKIRMRVWERGSGVTQACGTGACATAVAAFL 236

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
             +  R   + M GG L IEW     HVFMTGEA K +EG+++
Sbjct: 237 TGRAGRKSIIVMDGGTLTIEWDIATKHVFMTGEATKVFEGEME 279


>gi|56477674|ref|YP_159263.1| diaminopimelate epimerase [Aromatoleum aromaticum EbN1]
 gi|81598729|sp|Q5P2V2|DAPF_AZOSE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56313717|emb|CAI08362.1| Diaminopimelate epimerase [Aromatoleum aromaticum EbN1]
          Length = 277

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 138/285 (48%), Gaps = 24/285 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +VID      ++T + +  L+   + HF    DQ++++ +     VD  
Sbjct: 5   FTKMHGLGNDFVVIDAIRQSVDLTPEQVRRLA---DRHFGIGCDQLLVVEEATRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC VRF+  +    ++    ET  GI+  +   DG ++VDMG
Sbjct: 62  YRIFNADGGEVEQCGNGARCFVRFVHEQGLTAKRRIRVETRSGIIAPQLEDDGLVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----VSMGNPHAIFFVEDDLYH 177
            P+L+   +P     D +         V  L +    V    VSMGNPHA+  V D    
Sbjct: 122 VPVLEPARVPFVSDSDAI---------VQPLDVGGETVAITAVSMGNPHAVQVVADVDAA 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
              A  G L+ +HP F   VN    +V     + LR +ERG G T ACG+ ACA+VV   
Sbjct: 173 PVAAQ-GALIERHPRFPARVNAGFVQVVDAHRIRLRVFERGAGETLACGTGACAAVVTVI 231

Query: 238 CLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                   V V+  GG L I W      V MTG A   + G++D+
Sbjct: 232 LRELAQSPVRVETRGGELDIAWEGPGQPVLMTGPAVTVFAGEIDV 276


>gi|146296337|ref|YP_001180108.1| diaminopimelate epimerase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145409913|gb|ABP66917.1| diaminopimelate epimerase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 278

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 147/291 (50%), Gaps = 38/291 (13%)

Query: 8   FAKMEGIGNKILVIDMRG-------------CHDNITSDAINALSTDDNTHFDQIMLIHD 54
           F+KM G+GN  +VID RG             CH +I   A            D ++L+ +
Sbjct: 3   FSKMHGLGNDFIVIDTRGKEDIDYNLLAKRMCHRHIGVGA------------DGLLLVLN 50

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL-----V 107
              A  D  +RIIN DGSE + CGNG+RC  +++  R  +K   F  ET+ GI+     V
Sbjct: 51  SDIA--DIRMRIINSDGSEAEMCGNGIRCFAKYVYERGIVKATKFKVETLAGIIEPELFV 108

Query: 108 AKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHA 167
            +      + V+MG+P    K IP+    +    +   +   N   + +   + MG PH 
Sbjct: 109 NEYGLVDKVKVNMGKPSFKRKDIPMQGDPESDAINTSIVVDGNEYRITS---LLMGVPHT 165

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           I FV DD+   D+ + G  + KH  F    N++  +V    ++ +RTWERG G T ACG+
Sbjct: 166 ILFV-DDVEKVDIYTLGPKIEKHEAFPRKTNVNFVQVIDKNNIKVRTWERGAGATFACGT 224

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
            +CASV+A+     T R  +V +  G L I+W D++ VFMTG A++ + G+
Sbjct: 225 GSCASVIAANLNGLTERKANVHLYFGTLEIQWQDDDTVFMTGPAEEVFVGE 275


>gi|304413631|ref|ZP_07395075.1| diaminopimelate epimerase [Candidatus Regiella insecticola LSR1]
 gi|304283722|gb|EFL92116.1| diaminopimelate epimerase [Candidatus Regiella insecticola LSR1]
          Length = 278

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDNVTQNVYFSPELIRRLANRHTGVGFDQMLVVEPPYDPKLDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RFL  +    +K     T  G +  +   D  + V+MGE
Sbjct: 65  RIFNADGSEVFQCGNGARCFARFLHLKGLTSKKIIHISTQTGRMSLEITGDEKVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+   + IP   +        + +    H  L    VVS+GNPH +  VED +   ++A 
Sbjct: 125 PVFTPRQIPFCAT---TTEKTYILRTAGHTTLCG--VVSIGNPHCVLQVED-VATANVAL 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F +  N+   ++   ++++LR  ERGVG T ACGS ACA+V         
Sbjct: 179 LGPMLEYHERFPQRTNVGFMQIIDRKNINLRVHERGVGETQACGSGACAAVAIGIEQQLL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           ++ V VK+ GG L I+W    H ++MTG A   ++G + +
Sbjct: 239 DKNVDVKLPGGKLSIQWKGKGHPLYMTGSAVHIYDGYIHL 278


>gi|53713934|ref|YP_099926.1| diaminopimelate epimerase [Bacteroides fragilis YCH46]
 gi|81608423|sp|Q64SY7|DAPF_BACFR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|52216799|dbj|BAD49392.1| diaminopimelate epimerase [Bacteroides fragilis YCH46]
          Length = 269

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 147/288 (51%), Gaps = 35/288 (12%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++ +R         AI   +       D ++LI     A  D  +
Sbjct: 5   IQFTKMHGTGNDYIYVNTLRFPIARPEKAAIEWSAYHTGIGSDGLVLIGHSDKA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE   CGN  RC+ ++L       +   T +T+ GI + + + +G    +++V
Sbjct: 63  RIFNADGSEAMMCGNASRCIGKYLYEYGLTSKNVITLDTLSGIKILELHLEGRTVETVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV---VSMGNPHAIFFVEDDL 175
           DMG P+            D +D D              PF+   VSMGNPH + FV DD+
Sbjct: 123 DMGVPL----------ETDTIDFDG-----------EFPFLSTQVSMGNPHLVTFV-DDI 160

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              +L+  G  L KHP+F +  N+  A++T   ++ +R WERG G+T ACG+ ACA+ VA
Sbjct: 161 RIVNLSEMGPKLEKHPLFPDRTNVEFAQITGENTIRMRVWERGSGITQACGTGACATAVA 220

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
           +    +T R V+V M GG L IEW +   H+ MTG A K ++G ++++
Sbjct: 221 AHLTGRTGRTVNVVMDGGTLTIEWDEATGHISMTGPAVKVFDGTIELR 268


>gi|107024016|ref|YP_622343.1| diaminopimelate epimerase [Burkholderia cenocepacia AU 1054]
 gi|116691103|ref|YP_836726.1| diaminopimelate epimerase [Burkholderia cenocepacia HI2424]
 gi|105894205|gb|ABF77370.1| diaminopimelate epimerase [Burkholderia cenocepacia AU 1054]
 gi|116649192|gb|ABK09833.1| diaminopimelate epimerase [Burkholderia cenocepacia HI2424]
          Length = 309

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 142/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGA 79

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 80  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDQRSVRVQVMKGLITLTLQENGEVVV 139

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P  A   D        + P++     R    VSMGNPHA+  V DD+ 
Sbjct: 140 DMGAPVFAPAQVPFDAAGLDSRKEGNDTLWPLDVGGATRWISTVSMGNPHAVQVV-DDVE 198

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 199 AYPVLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAG 258

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 259 IRRGLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPATTVFEGEIDL 307


>gi|197303586|ref|ZP_03168624.1| hypothetical protein RUMLAC_02314 [Ruminococcus lactaris ATCC
           29176]
 gi|197297320|gb|EDY31882.1| hypothetical protein RUMLAC_02314 [Ruminococcus lactaris ATCC
           29176]
          Length = 281

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 144/288 (50%), Gaps = 22/288 (7%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQ 56
           M+  M  F KM+G+GN  + ++   C      D         + HF    D ++LI+  +
Sbjct: 1   MEKKM-KFTKMQGLGNDYVYVN---CFKEKIEDPSALAVRISDRHFGVGSDGLILINPSK 56

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKE 110
            A  D  + + N DGS  + CGNG+RCV +++       +++ + ET+ GI       + 
Sbjct: 57  VA--DCEMEMYNADGSRGEMCGNGIRCVGKYMYDYGLTDKEAISVETLAGIKYLQFFIEN 114

Query: 111 NRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
            +   + VDMG PIL    IP+    ++   +   +    +        +SMGNPHAI +
Sbjct: 115 GKVAKVKVDMGSPILTPAEIPVVAEGERAVDEPIVVDGTEYRMT----CISMGNPHAIVY 170

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V DD+ +  +   G L  KH  F   VN    +V    ++++R WERG G T ACG+ AC
Sbjct: 171 V-DDVKNLPIEKIGPLFEKHERFPNRVNTEFVKVLDRNTVEMRVWERGSGETLACGTGAC 229

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEG 277
           A+ VA      T   V+VK+LGG L IEW  + N VFMTG AK  ++G
Sbjct: 230 ATAVACILNGLTEEKVTVKLLGGDLEIEWDREKNKVFMTGPAKVVFDG 277


>gi|261420393|ref|YP_003254075.1| diaminopimelate epimerase [Geobacillus sp. Y412MC61]
 gi|319768060|ref|YP_004133561.1| diaminopimelate epimerase [Geobacillus sp. Y412MC52]
 gi|261376850|gb|ACX79593.1| diaminopimelate epimerase [Geobacillus sp. Y412MC61]
 gi|317112926|gb|ADU95418.1| diaminopimelate epimerase [Geobacillus sp. Y412MC52]
          Length = 290

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 154/301 (51%), Gaps = 41/301 (13%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS---TDDNTHF--DQIMLIHDFQDASVDA 62
           F KM G+GN  + +D+    + +  + + A++    D +T    D ++LI   + A +  
Sbjct: 6   FTKMHGLGNSYIYVDL--FRETLPEEELPAIARSVADVHTGIGSDGLILICPSEKAPLK- 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGSI 116
            +RI N DGSE ++CGNG+RCV ++      ++ ++F  ET+ G++ A+    +    S+
Sbjct: 63  -MRIFNSDGSEGKNCGNGLRCVAKYAYEHGIVRDRTFLIETLSGLVEARVAVADGEVTSV 121

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----------VSMGNPH 166
           +VDMGEP L+   IP+             +GP     +  PF           VSMGNPH
Sbjct: 122 TVDMGEPRLERSAIPM-------------VGPKAERVVAEPFTIAGGEYEMTAVSMGNPH 168

Query: 167 AIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
            IF+V DD+    + + G L+ K P F EGVN+    V +   L  R WERG G+T ACG
Sbjct: 169 VIFYV-DDIQKAPVTTLGPLVEKDPRFPEGVNVEFVEVVNERELHFRVWERGSGVTQACG 227

Query: 227 SAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
           + ACA+VVAS    KT R     V + GG L I W  +  V MTG A+    G    + G
Sbjct: 228 TGACAAVVASVLNGKTVRGEETVVHLAGGDLTIVWGHDGRVRMTGPAETVCTGVYYYRGG 287

Query: 285 K 285
           +
Sbjct: 288 R 288


>gi|229124477|ref|ZP_04253662.1| Diaminopimelate epimerase [Bacillus cereus 95/8201]
 gi|228658817|gb|EEL14472.1| Diaminopimelate epimerase [Bacillus cereus 95/8201]
          Length = 280

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 147/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEQAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVAS    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWIEEGNVLMKGPAEVICHGVYEYK 277


>gi|54310575|ref|YP_131595.1| diaminopimelate epimerase [Photobacterium profundum SS9]
 gi|81614797|sp|Q6LLN5|DAPF_PHOPR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|46915018|emb|CAG21793.1| putative ribulose-phosphate 3-epimerase [Photobacterium profundum
           SS9]
          Length = 276

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 136/280 (48%), Gaps = 14/280 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   +  AI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFMVVDCVTQNVFFSPAAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF  +     +      T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVWMKGLTNKYQVAVSTKAGKMLLKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF--VVSMGNPHAIFFVEDDLYHYDL 180
           P  +   IP    F     ++ +I  V     R  F   VSMGNPH +  V DDL   D+
Sbjct: 123 PEFEPSKIP----FRAKQTEKTYIMRVGE---RTIFCGTVSMGNPHCVTVV-DDLELTDV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G L+  H  F E VN    +V S   + LR +ERG G T ACGS ACA+V       
Sbjct: 175 DTLGPLIESHERFPERVNAGFMQVVSRNEVKLRVYERGAGETQACGSGACAAVAVGYLQG 234

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
             +  V V + GG L I W  +   ++MTG     ++G++
Sbjct: 235 LLDENVKVSLPGGDLHISWAGEGKSLYMTGPVAHVFDGQI 274


>gi|115353182|ref|YP_775021.1| diaminopimelate epimerase [Burkholderia ambifaria AMMD]
 gi|122321974|sp|Q0BAY6|DAPF_BURCM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|115283170|gb|ABI88687.1| diaminopimelate epimerase [Burkholderia ambifaria AMMD]
          Length = 289

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 143/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVV 119

Query: 119 DMGEPILDWKLIPLARS-FDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P   S  D     R  + P++     R    VSMGNPHA+  V DD+ 
Sbjct: 120 DMGAPVFAPAQVPFDVSGLDGRAEGRDTLWPLDVGGATRWISAVSMGNPHAVQVV-DDVE 178

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 179 AYPVLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAG 238

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 239 IRRGLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPAATVFEGEIDL 287


>gi|77920664|ref|YP_358479.1| diaminopimelate epimerase [Pelobacter carbinolicus DSM 2380]
 gi|77546747|gb|ABA90309.1| diaminopimelate epimerase [Pelobacter carbinolicus DSM 2380]
          Length = 279

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 146/293 (49%), Gaps = 38/293 (12%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           FAKM G GN  + ++   C +    D         N +F    D ++LI   + A  D  
Sbjct: 3   FAKMHGAGNDYVYVN---CFEQTIDDPAEMARKVSNRNFGIGSDGLILILPSEVA--DVR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK---ENRDG--SI 116
           +R+ N DGSE + CGNG+RCV ++      +++K  T ET  GIL  +    +RD    +
Sbjct: 58  MRMFNSDGSESEMCGNGIRCVAKYAYDHGLVEKKEITAETGAGILTLQLFTNDRDKVERV 117

Query: 117 SVDMGEPILDWKLIPLARSFDK---------MDRDRFHIGPVNHLFLRNPFVVSMGNPHA 167
            V+MG+P L    IP+  S ++         +DR  FHI             VSMGNPH 
Sbjct: 118 RVNMGKPRLTRGEIPMTGSPEEQVINAELKVLDRT-FHIT-----------CVSMGNPHC 165

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           I FV D++  + +A +G ++   PMF    N+    + S   +  RTWERG G T ACG+
Sbjct: 166 IIFV-DNVDEFPVAKYGPIIENDPMFPNRTNVEFIEIVSTTEIKQRTWERGAGETLACGT 224

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            + A  VA     +T R +   +LGG L +EW ++  V+MTG A + +EG  D
Sbjct: 225 GSSAVTVACVLNERTERRLLNHLLGGDLEMEWAEDGSVYMTGPAVQVFEGVFD 277


>gi|302879882|ref|YP_003848446.1| diaminopimelate epimerase [Gallionella capsiferriformans ES-2]
 gi|302582671|gb|ADL56682.1| diaminopimelate epimerase [Gallionella capsiferriformans ES-2]
          Length = 276

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 144/283 (50%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  +V+D      ++T++ +  L+   + HF    DQI+L+    DAS D
Sbjct: 3   LKFTKMHGAGNDFVVLDGVRQQISLTTEQLRLLA---DRHFGVGCDQILLVEKAHDASAD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC VRF+  +    +     ET  G++  +   DG + V+
Sbjct: 60  FRYRIFNADGGEVEQCGNGARCFVRFVHDQKLTNKAEIVVETHNGLIRPRLEADGRVVVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P+ D   IP   S   ++  +  +     L +    +VSMGNPHA+  V DD+    
Sbjct: 120 MGAPVFDAARIPF--SGGTIEVMQPLVVADQTLMVS---IVSMGNPHAVQVV-DDVERAA 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+  H  F + VN    ++   + + LR +ERG G T +CG+ ACA+VV+    
Sbjct: 174 VEVLGPLIEHHASFPKRVNAGFMQIMDRQHIRLRVYERGSGETLSCGTGACAAVVSGIRR 233

Query: 240 HKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
              +  VSV   GG L I W  +   V MTG A   + G++++
Sbjct: 234 GLLDSPVSVATHGGNLSIAWGGEETPVLMTGPAISVFSGEINL 276


>gi|42521005|ref|NP_966920.1| diaminopimelate epimerase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410746|gb|AAS14854.1| diaminopimelate epimerase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 263

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/268 (38%), Positives = 148/268 (55%), Gaps = 21/268 (7%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           +F KM G GN  ++ID R  ++       N     D +  DQ+++I      + D F+ I
Sbjct: 9   NFIKMHGTGNNFVIIDSRSTNN----LDWNHRQIADQSSCDQVIIIT--MSNAADCFMHI 62

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE-TIRGILVAKENRDGSISVDMGEPIL 125
            N DGS  + CGN  RCV   + S    +    E T + IL   +  D SI V+MG+P+L
Sbjct: 63  YNADGSRAEMCGNAARCVGYLIMSEKGAEYSIIELTSKRILECFKVGDKSIKVNMGKPLL 122

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W  IPL+   D +     H+ P+    L++P  V++GNPH +FFV D++    L + G 
Sbjct: 123 KWHEIPLSTECDTL-----HL-PIELEMLKDPVAVNIGNPHIVFFV-DNISEIPLRNLGP 175

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS---GCLHKT 242
            L  H +F   +N+SIA+V     + LR WERG G+TA+CGSAACA++VAS   G L   
Sbjct: 176 KLENHALFPRKINVSIAQVEKSGEIALRVWERGTGITASCGSAACAALVASTLRGSL--V 233

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGE 270
            +  SV + GG LLIEW +N  VFMTG+
Sbjct: 234 AQQTSVNLPGGKLLIEWANN--VFMTGD 259


>gi|154687329|ref|YP_001422490.1| diaminopimelate epimerase [Bacillus amyloliquefaciens FZB42]
 gi|166224240|sp|A7Z8D3|DAPF_BACA2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|154353180|gb|ABS75259.1| DapF [Bacillus amyloliquefaciens FZB42]
          Length = 284

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 145/276 (52%), Gaps = 17/276 (6%)

Query: 8   FAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           F KM G+GN  + ++    +   + +   A+   S       D ++LI   + A V   +
Sbjct: 6   FTKMHGLGNSYIYVNQFEEQLPEERLAEIAVKVSSIHTGIGSDGMILICPSEKAPVK--M 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI----SV 118
           RI N DGSE ++CGNG+RCV ++       +  SF  ET+ G++ A    D  I    +V
Sbjct: 64  RIFNNDGSEGKNCGNGLRCVAKYAYEHKLTEETSFFIETLSGLVKADITEDNGIVREVAV 123

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEP L  K +P+  + D+   D   +     L   +   VSMGNPH +F V D +   
Sbjct: 124 DMGEPRLTKKELPMLGNEDERTIDETFVFGETEL---SGTAVSMGNPHIVFPVAD-INQA 179

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS-- 236
            L + G ++ K P F EGVN+      S + L  R WERG G+T ACG+ ACA+ VAS  
Sbjct: 180 PLTTLGPVIEKDPRFPEGVNVEFVETVSADELHFRVWERGSGITQACGTGACAAAVASVL 239

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
             + + NR ++V + GG L+I W DN HV MTG A+
Sbjct: 240 NGVSERNRDITVHLAGGDLVINWQDNGHVLMTGPAE 275


>gi|295675164|ref|YP_003603688.1| diaminopimelate epimerase [Burkholderia sp. CCGE1002]
 gi|295435007|gb|ADG14177.1| diaminopimelate epimerase [Burkholderia sp. CCGE1002]
          Length = 370

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 145/287 (50%), Gaps = 15/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  +V+D      ++T+  + AL+   N HF    DQ++L+       VD
Sbjct: 62  LKFTKMHGAGNDFVVLDGYTQPLDLTTAQVRALA---NRHFGVGADQLLLVEKPTVEGVD 118

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI NCDG EV+ CGNG RC V+F+  R    ++S   +  +G +      +G + VD
Sbjct: 119 FRYRIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTITLTMQDNGEVIVD 178

Query: 120 MGEPILDWKLIPLARSFDKMDRDRF-HIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P+ D +L+P A    +  R+    + P++ +   R   VVSMGNPHA+  V DD   
Sbjct: 179 MGTPVFDPELVPFATKGLQGRREGADTLWPLDVNGTTRWMSVVSMGNPHAVQVV-DDAEA 237

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G  + +H  F + VN    ++ +   + LR +ERG G T ACG+ ACA+V A  
Sbjct: 238 FPVLVEGPAIERHTRFPQRVNAGFMQIVNRNEIRLRVYERGAGETLACGTGACAAVGAGI 297

Query: 238 CLHKTNRAVSVKMLGGGLLIEW---HDNNHVFMTGEAKKEWEGKLDI 281
                +  V V   GG L I W        + M G A   +EG++++
Sbjct: 298 RRGLLDSPVLVHTHGGDLTITWDIAQPGAPLLMAGPAATVFEGEIEL 344


>gi|300721448|ref|YP_003710723.1| diaminopimelate epimerase [Xenorhabdus nematophila ATCC 19061]
 gi|297627940|emb|CBJ88486.1| diaminopimelate epimerase [Xenorhabdus nematophila ATCC 19061]
          Length = 280

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 140/284 (49%), Gaps = 14/284 (4%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVD 61
           S + F+KM G+GN  +V+D    +   + + I  L+ D NT   FDQ++++    D  +D
Sbjct: 5   SYMQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLA-DRNTGIGFDQLLVVEAPYDPDLD 63

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  I V+
Sbjct: 64  FHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIKVSTRSGQMVLSVTNDDQIRVN 123

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MGEP  + + +P  A   +K     + I  V    L    VV+MGNPH +  VED +   
Sbjct: 124 MGEPDFEPQRVPFRANKAEKT----YIIRAVERTVLCG--VVAMGNPHCVIQVED-VNTA 176

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G  L  H  F E VN+   ++ +   + LR +ERG G T ACGS ACA+V     
Sbjct: 177 DVEVLGPALENHERFPERVNVGFMQIMNRGHIRLRVFERGAGETRACGSGACAAVAVGIQ 236

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
               +  VSV + GG L I W      +FMTG A   ++G + +
Sbjct: 237 QDLLDNQVSVDLPGGSLQIRWDGPGKPLFMTGPATHVYDGMIHL 280


>gi|229032582|ref|ZP_04188547.1| Diaminopimelate epimerase [Bacillus cereus AH1271]
 gi|228728767|gb|EEL79778.1| Diaminopimelate epimerase [Bacillus cereus AH1271]
          Length = 268

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    +G ++   +DMG P L    IP L        R+ F     NH +      
Sbjct: 86  IVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FV DD+    L + G +L  H MF E VN+    + + E ++ R WERG 
Sbjct: 142 VSMGNPHAVIFV-DDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVAS    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|262404863|ref|ZP_06081417.1| diaminopimelate epimerase [Vibrio sp. RC586]
 gi|262348947|gb|EEY98086.1| diaminopimelate epimerase [Vibrio sp. RC586]
          Length = 276

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 142/281 (50%), Gaps = 20/281 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCVTQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DGSEV+ CGNG RC  RF+  RMK    + S +  T +G +V     +  I+V+MG
Sbjct: 64  IFNADGSEVEQCGNGARCFARFV--RMKGLTNKYSISVSTKKGKMVLNVEEEDLITVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F     ++ +I  V    LF      VSMGNPH +  V DD+    
Sbjct: 122 VPEFEPSKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVV-DDIRTAA 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V      
Sbjct: 174 VETLGPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 234 GLLDEQVRVHLPGGELEISWKGPGKPLYMTGPATHIYDGQI 274


>gi|220904420|ref|YP_002479732.1| Diaminopimelate epimerase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254767100|sp|B8IZX7|DAPF_DESDA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219868719|gb|ACL49054.1| Diaminopimelate epimerase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 287

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 145/289 (50%), Gaps = 23/289 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+GIGN  + I+  G  + I S    A    D  HF    D ++LI     A+ D  
Sbjct: 7   FTKMQGIGNDYVYIN--GFQERIDSPGELARKISDR-HFGIGSDGLVLI--LPSATADVR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +R+ N DGSE + CGN +RCV +++       +   T ET  G+    L+ +  +    +
Sbjct: 62  MRMFNADGSESEMCGNAVRCVGKYVYDHGIQVKDVITVETRAGVKIVRLLFEAGKVCGAT 121

Query: 118 VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVE--D 173
           VDMGEP L    IP L  +     + RF   PV+ +  L     VSMGNPHA+ F++  D
Sbjct: 122 VDMGEPELHPARIPVLTETSGDGSQQRFVARPVDVNGQLYEITAVSMGNPHAVIFMKGID 181

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           DL   DL   G     HP+F +  N   A V S   + +R WERG G T ACG+ ACA  
Sbjct: 182 DL---DLPRIGPRFEHHPLFPKRTNTEFAEVISSTKVRMRVWERGAGETLACGTGACAVA 238

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           VA        R V V++ GG L I W + +NHV+MTG A   + G+  I
Sbjct: 239 VACVLNGYAGRDVEVELKGGSLHIHWDEASNHVYMTGGAVTVFSGEYYI 287


>gi|116074845|ref|ZP_01472106.1| diaminopimelate epimerase [Synechococcus sp. RS9916]
 gi|116068067|gb|EAU73820.1| diaminopimelate epimerase [Synechococcus sp. RS9916]
          Length = 372

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 144/283 (50%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMR-GCHD-NITSDAINALSTDDNTHF----DQIMLIHDFQDA 58
           M+ F+K +G+GN  ++I+ R G  D +ITS     +    +  F    D I+L    +  
Sbjct: 1   MLQFSKYQGLGNDFVLIEGRDGRLDASITSPDPQWVRRICDRRFGVGGDGIILALPPEGP 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFETIRGILVAKENRDGS 115
             +  +RI N DGSE + CGNG+RC+ RFL         +S++ ET  G+++     DG 
Sbjct: 61  G-ELRMRIFNADGSEAEMCGNGIRCLARFLADSDGDAPGRSWSIETPAGLIIPVLQEDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P+L    +P   +  +    +  +  +N   L+    V MGNPH +  V D L
Sbjct: 120 IKVDMGAPMLAPDTVPTTLAVGEQGLPQGELT-INGDLLKV-AAVGMGNPHVVVPVPD-L 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 ++G  L   P F    N+   +V   ++LD+R WERG G T ACG+ ACA++VA
Sbjct: 177 ASIPFDAWGAALEVDPSFPAKTNVHFLQVKGSDALDIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           +  L  +     V + GG L I W D    VFMTG A+  ++G
Sbjct: 237 AHLLGLSEATAEVMLPGGPLQISWPDRGGSVFMTGPAEAVFDG 279


>gi|218261608|ref|ZP_03476354.1| hypothetical protein PRABACTJOHN_02022 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223922|gb|EEC96572.1| hypothetical protein PRABACTJOHN_02022 [Parabacteroides johnsonii
           DSM 18315]
          Length = 274

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 146/289 (50%), Gaps = 32/289 (11%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++ M     N    AI   +       D ++LI   + A  D  +
Sbjct: 5   IRFTKMHGAGNDYIYVNAMAFPIRNPEKLAIRLSAPHTGIGSDGLVLIGSSKIA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI---LVAKENRDGS---- 115
           RI N DGSE   CGN  RC+ +++  +    +K+ T ET  GI    +      GS    
Sbjct: 63  RIFNADGSEAMMCGNASRCIGKYVYDKRLTDKKNVTLETRSGIKELQLTTRKLSGSREEV 122

Query: 116 --ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
             ++VDMG P++    + +           F+ G V          VSMGNPH + FVED
Sbjct: 123 IEVTVDMGCPVVGEAALEIEAG------GYFYTGTV----------VSMGNPHLVIFVED 166

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            + + +L + G LL  HP+F    N+   +V +++ + ++ WERG G+T ACG+ ACA+ 
Sbjct: 167 -IANINLPAIGPLLECHPLFPNRTNVEFVQVLNMDEVRMKVWERGSGITQACGTGACATA 225

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           VA     KT R   V M GG L I W +++ HV+MTG A K +EG+L+I
Sbjct: 226 VAGVIRRKTGRKTKVVMDGGPLTIRWDESSGHVYMTGGAVKVFEGELEI 274


>gi|228923674|ref|ZP_04086952.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228835803|gb|EEM81166.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 280

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 146/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQISEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEEGKVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHAI FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEDETPFIRENFLYN--NHRYAFT--AVSMGNPHAIIFV-DDVEKAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVA+    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACAAVVAAILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +   V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGSVLMKGPAEVICRGVYEYK 277


>gi|255645761|gb|ACU23373.1| unknown [Glycine max]
          Length = 359

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 142/291 (48%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITS--DAINALSTDDNTHFDQIMLIHDFQDAS 59
           +S  + FAK  G+GN  ++ID R   +   S   A+     +     D ++ +    + +
Sbjct: 71  ESGFLHFAKYHGLGNDFVLIDNRDTSEPRISAEKAVQLCDRNFGVGADGVIFVLPGINGT 130

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N D SE + CGNG+RC  +F   L +   R SFT  T  G+++ +   DG++
Sbjct: 131 -DYTMRIFNSDSSEPEMCGNGVRCFAKFVSQLENLHGRHSFTIHTGAGLIIPEVLEDGNV 189

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMGEP+L    +P     +K D        V    + +   VSMGNPH + F  +   
Sbjct: 190 RVDMGEPVLKALDVPTKLPANK-DNAVVKSQLVVDGVIWHVTCVSMGNPHCVTFSREGSQ 248

Query: 175 ---LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    LA  G     H +F    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 249 NLLVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSNSHLKMRVWERGAGATLACGTGACA 308

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           +V A+    +  R  +V + GG L IEW  ++NHV+MTG A   + G L +
Sbjct: 309 TVAAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGSADVVYYGSLPL 359


>gi|255291937|dbj|BAH90425.1| diaminopimelate epimerase [uncultured bacterium]
          Length = 305

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 144/308 (46%), Gaps = 39/308 (12%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +++     L+   + HF    DQI+ +       VD
Sbjct: 3   IRFTKMQGAGNDFVVLDETTALLGLSAAQYRWLA---DRHFGVGADQILSVRAAPGPGVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG EV+ CGNG RC VR++  R    ++    +   G++   E  DG ++VD
Sbjct: 60  FEYVIHNADGGEVEQCGNGARCFVRYVRERGLTDKRRVHVQVRHGVIELVEQADGRVTVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGP-VNHLFLRNPF-------------------- 158
           MG P+ +   IP    FD         G    HL+   P                     
Sbjct: 120 MGAPVFELPRIP----FDPAGLTPVPAGADAAHLWQWWPLDLGRSAATAVAEPASDAIVN 175

Query: 159 --VVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWE 216
             V+SMGNPHA+  V D +    +A  G L+  HP F + VN    ++    ++ LR +E
Sbjct: 176 VAVLSMGNPHAVQLVAD-VEAAPVARHGALIESHPAFPKRVNAGFMQILDRAAVRLRVYE 234

Query: 217 RGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWH--DNNHVFMTGEAKKE 274
           RGVG T ACG+ ACA+VVA   L   +  V V   GG L IEW   + + VFMTG A   
Sbjct: 235 RGVGETLACGTGACAAVVAGVRLGLLDSRVDVHTRGGVLSIEWAGGERDPVFMTGPATTV 294

Query: 275 WEGKLDIK 282
           +EG+ +I 
Sbjct: 295 FEGETEIP 302


>gi|295109167|emb|CBL23120.1| diaminopimelate epimerase [Ruminococcus obeum A2-162]
          Length = 285

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 149/293 (50%), Gaps = 30/293 (10%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIH--DFQDASVD 61
           F KM GIGN  + ++   C +   S+         + HF    D ++LI   D  D  +D
Sbjct: 3   FTKMHGIGNDYVYVN---CFEEAVSNPSAVAKFVSDRHFGIGSDGLILIKPSDIADCEMD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI-----LVAKENRDG 114
            +    N DGS+   CGNG+RCV ++      + + S +  T  GI      + K+ +  
Sbjct: 60  MY----NLDGSQGAMCGNGIRCVAKYAYDYGIVNKTSISVATKSGIKYLDLTLGKDGKVA 115

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVED 173
            + V+MG PIL  + IP+  + +++  +  H+ G   H+       VSMGNPHAI ++ D
Sbjct: 116 LVKVNMGAPILTSRQIPVVSTKEQVINEPLHVDGETYHIT-----AVSMGNPHAIVYM-D 169

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
            L + D+   G     H  F + +N    +V    +L +R WERG G T ACG+ ACA  
Sbjct: 170 ALKNLDIEKLGPKFENHINFPDRINTEFVKVIDRHTLQMRVWERGSGETLACGTGACAVA 229

Query: 234 VASGC--LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIKT 283
           VAS    L   ++ V+VK+LGG L I W+   N V+MTG A   ++G++D+ +
Sbjct: 230 VASTLNGLVDEDKPVTVKLLGGDLQILWNRQENLVYMTGPATTVFDGEIDVSS 282


>gi|167764472|ref|ZP_02436593.1| hypothetical protein BACSTE_02856 [Bacteroides stercoris ATCC
           43183]
 gi|167697141|gb|EDS13720.1| hypothetical protein BACSTE_02856 [Bacteroides stercoris ATCC
           43183]
          Length = 284

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 141/283 (49%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +D  R   +N    +    +       D ++LI     A  D  +
Sbjct: 5   IKFTKMHGAGNDYIYVDTTRYPIENPEKLSKKWSAPHTGIGSDGLVLIGRSDKA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE + CGN  RC+ ++L       +   T +T+ GI + K +  G    +++V
Sbjct: 63  RIFNADGSEAKMCGNASRCIGKYLYDYKLTSKTEITLDTLSGIKILKLHATGDKVDTVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P  D  +    +    M      I  + +        VSMGNPH + FV +D+   
Sbjct: 123 DMGIP-SDEPVNYDGKGSKPMTEHPIEIDGIRY----TGTTVSMGNPHLVIFV-NDITKV 176

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL+S G  L  HP+F +  N+  A+V     + +R WERG G+T ACG+ ACA+ VA+  
Sbjct: 177 DLSSIGPKLENHPLFPDRTNVEFAQVLEEGKIRMRVWERGSGVTRACGTGACATAVAAFL 236

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
             +  R   + M GG L IEW     HVFMTGEA K +EG+++
Sbjct: 237 TGRAGRKSIIGMDGGTLTIEWDIATKHVFMTGEATKVFEGEME 279


>gi|253690336|ref|YP_003019526.1| diaminopimelate epimerase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259595059|sp|C6DHB7|DAPF_PECCP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|251756914|gb|ACT14990.1| diaminopimelate epimerase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 274

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 137/277 (49%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  + + +P    F  +  ++ +I   + H  L    VVSMGNPH +  VE D+    + 
Sbjct: 121 PNFEPQQVP----FRAVKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVE-DVDTAKVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F E  N+   +V    ++ LR +ERG G T ACGS ACA+V        
Sbjct: 174 TLGPLLESHERFPERANIGFMQVVDSHTVRLRVYERGAGETQACGSGACAAVAVGIQQGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            +  V V + GG L I+W    H +FMTG A   ++G
Sbjct: 234 LSANVRVSLPGGDLDIQWDGPGHPLFMTGPATHVYDG 270


>gi|78212901|ref|YP_381680.1| diaminopimelate epimerase [Synechococcus sp. CC9605]
 gi|78197360|gb|ABB35125.1| diaminopimelate epimerase [Synechococcus sp. CC9605]
          Length = 368

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 143/294 (48%), Gaps = 33/294 (11%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQI-----------MLIH 53
           M+ F+K +G+GN  L+++ R           +A+S  D     +I           +++ 
Sbjct: 1   MLQFSKYQGLGNDFLIVEGR------QGQLPDAISNPDPAWVRRICDRRFGVGGDGLILA 54

Query: 54  DFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFETIRGILVAKE 110
               A  +  +RI+N DGSE + CGNG+RC+ R+L         + +  ET+ G++  + 
Sbjct: 55  LPAQADGELRMRILNVDGSEAEMCGNGIRCLARYLADTDGDAPGRRWDIETLAGMIRPEL 114

Query: 111 NRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----VSMGNPH 166
             DG + VDMG P L  + IP       M  D     P   L L    +    V MGNPH
Sbjct: 115 MADGQLRVDMGPPFLSSEGIPTT----LMPEDGL---PQGVLLLEGEQLKVAAVGMGNPH 167

Query: 167 AIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
            +  V DDL      ++G  L  HP F    N+   +V + E L++R WERG G T ACG
Sbjct: 168 VVVPV-DDLASIPFDAWGAALEVHPAFPAKTNVHFLQVHNRERLEIRVWERGAGPTLACG 226

Query: 227 SAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           + ACA++VA+  L   +    V + GG L+IEW D    V MTG A+  ++G L
Sbjct: 227 TGACATLVAAVLLGLADDCAEVVLPGGPLMIEWRDRTGSVLMTGPAEAVFDGVL 280


>gi|228942106|ref|ZP_04104646.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228981675|ref|ZP_04141970.1| Diaminopimelate epimerase [Bacillus thuringiensis Bt407]
 gi|228777787|gb|EEM26059.1| Diaminopimelate epimerase [Bacillus thuringiensis Bt407]
 gi|228817440|gb|EEM63525.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
          Length = 280

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 147/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGFVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FVED +    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFVED-VEKAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVA+    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACAAVVAAILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 277


>gi|254495752|ref|ZP_05108666.1| diaminopimelate epimerase [Legionella drancourtii LLAP12]
 gi|254355030|gb|EET13651.1| diaminopimelate epimerase [Legionella drancourtii LLAP12]
          Length = 308

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 137/279 (49%), Gaps = 9/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      N+    I  L+  +    FDQ++LI       +D   
Sbjct: 32  IKFTKMHGLGNDFIVIDGINQSINLQPLQIAKLAQRNTGIGFDQLLLIERSTHTGIDFNY 91

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV  CGNG RC+  F    +   +   T  T    +  + N D S+ V+MG 
Sbjct: 92  RIFNADGQEVGQCGNGARCLAVFAKYYNLTHKNHLTVATTTTQMSLQINADNSVRVEMGI 151

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L+   IPL+      +        + H        +S+GNPHA+  V+D +    + +
Sbjct: 152 PQLNPAAIPLSAEHQAAEYQL----ELQHGQTATMHAISVGNPHAVLLVKD-VETAPVPT 206

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+ ++ HP F    N+   ++ + + + LR +ERG G T ACGS A A+V      H+ 
Sbjct: 207 LGHEISIHPRFPAQANVGFMQIINPQHIKLRVYERGCGETLACGSGAVAAVAIGRLYHRL 266

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           ++ V+V + GG L+I+W D    + +TG A   +EG+L 
Sbjct: 267 DKQVTVSLPGGELIIDWPDFTAPITLTGPAVFVYEGQLS 305


>gi|325662281|ref|ZP_08150896.1| diaminopimelate epimerase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471533|gb|EGC74754.1| diaminopimelate epimerase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 279

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 148/290 (51%), Gaps = 35/290 (12%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM+G+GN  + ++     + + S +  A    D  HF    D ++LI   + A  D  
Sbjct: 5   FTKMQGLGNDYVYVNC--LKEKVESPSEMARRVSDR-HFGVGSDGLILICPSECA--DFE 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +++ N DGS  + CGNG+RCV +++       +   + ET+ GI    L  +E +   + 
Sbjct: 60  MKMYNADGSRGEMCGNGIRCVGKYVYDYGLTDQTEISVETLGGIKHLSLTVEEGKVALVK 119

Query: 118 VDMGEPILDWKLIPLARSFD-------KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           VDMG PI   + IP+    D        +D D + +             VSMGNPHA+ +
Sbjct: 120 VDMGSPIFVPEQIPVKVEGDHAVNVPISVDGDEYRM-----------TCVSMGNPHAVVY 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           + DD+ + ++   G     HP F   VN   ARV   E++++R WERG G T ACG+ AC
Sbjct: 169 L-DDIQNMEIEKIGPKFEHHPCFPNRVNTEFARVLDRETVEMRVWERGSGETLACGTGAC 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
           A  VAS     T   V+V++LGG L IEW  + N V+MTG A   ++G+L
Sbjct: 228 AVAVASMVNGLTEDCVTVQLLGGNLKIEWDREKNVVYMTGPATVVFDGEL 277


>gi|159029708|emb|CAO87786.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 281

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 150/284 (52%), Gaps = 21/284 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F K +G+GN  ++ID R   + + +  I     D   HF    D ++     Q A+ D
Sbjct: 3   IPFTKYQGLGNDFILIDNRHSPEPLITPEIAVAMCDR--HFGIGADGVIFALPGQ-AATD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKR-----KSFTFETIRGILVAKENRDGSI 116
             +RI N DGSE + CGNG+RC+ +F+ +R++      +++   T+ G ++ +   +  +
Sbjct: 60  YTMRIFNSDGSEPEMCGNGIRCLAQFI-ARLEANNTIGRTYRIHTLAGTIIPRLEANEQV 118

Query: 117 SVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           +VDMG P L    IP  L +  +K+      +   + L       VSMGNPH + FV DD
Sbjct: 119 TVDMGPPQLLGSEIPTTLVKGSEKVLAVPLEVEGKDWLIT----CVSMGNPHCVTFV-DD 173

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           L    L + G     HP+F +  N+    V   + + +R WERG G+T ACG+ ACA VV
Sbjct: 174 LASIPLETIGPKFEHHPVFPQRTNVEFVEVIGPDYMKMRVWERGAGITLACGTGACAVVV 233

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           A+    K +R  +V++ GG L I W D +N V+MTG AK  +EG
Sbjct: 234 AAVSTAKCDRHCTVELPGGCLQIHWSDTDNRVYMTGPAKAVFEG 277


>gi|60682141|ref|YP_212285.1| diaminopimelate epimerase [Bacteroides fragilis NCTC 9343]
 gi|60493575|emb|CAH08364.1| diaminopimelate epimerase [Bacteroides fragilis NCTC 9343]
 gi|301163620|emb|CBW23173.1| diaminopimelate epimerase [Bacteroides fragilis 638R]
          Length = 272

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 146/288 (50%), Gaps = 35/288 (12%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++ +R         AI   +       D ++LI     A  D  +
Sbjct: 8   IQFTKMHGTGNDYIYVNTLRFPIARPEKAAIEWSAYHTGIGSDGLVLIGHSDKA--DFSM 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE   CGN  RC+ ++L       +   T +T+ GI + + + +G    +++V
Sbjct: 66  RIFNADGSEAMMCGNASRCIGKYLYEYGLTSKNVITLDTLSGIKILELHLEGRTVETVTV 125

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV---VSMGNPHAIFFVEDDL 175
           DMG P L+   I     F                    PF+   VSMGNPH + FV DD+
Sbjct: 126 DMGVP-LETGTIDFDGEF--------------------PFLSTQVSMGNPHLVTFV-DDI 163

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              +L+  G  L KHP+F +  N+  A++T   ++ +R WERG G+T ACG+ ACA+ VA
Sbjct: 164 RIVNLSEMGPKLEKHPLFPDRTNVEFAQITGENTIRMRVWERGSGITQACGTGACATAVA 223

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
           +    +T R V+V M GG L IEW +   H+ MTG A K ++G ++++
Sbjct: 224 AHLTGRTGRTVNVVMDGGTLTIEWDEATGHISMTGPAVKVFDGTIELR 271


>gi|86606001|ref|YP_474764.1| diaminopimelate epimerase [Synechococcus sp. JA-3-3Ab]
 gi|123506579|sp|Q2JUV6|DAPF_SYNJA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|86554543|gb|ABC99501.1| diaminopimelate epimerase [Synechococcus sp. JA-3-3Ab]
          Length = 285

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 146/288 (50%), Gaps = 21/288 (7%)

Query: 3   SSMVDFAKMEGIGNKILVIDMR-GCHDNITSDAINALSTDDNTHF----DQIMLIHDFQD 57
            S + F K +G+GN  +++D R      +T +   AL    N  F    D ++ +   Q+
Sbjct: 2   PSRLSFHKYQGLGNDFILVDNRHQPQPCLTPEEAVALC---NRRFGVGADGVIFLLPGQE 58

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTS---RMKRKSFTFETIRGILVAKENRDG 114
            + D  +R+ N DGSE + CGNG+RC+ RFL       +  ++   T+ G +V +   DG
Sbjct: 59  GA-DFSMRLFNSDGSEAEMCGNGIRCLARFLQDLGIPGQDGAYQIHTLAGRIVPQVRPDG 117

Query: 115 SISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
            ++VDMG P L    IP  LA+  +K+ R    +G            VSMGNPH + F+E
Sbjct: 118 LVTVDMGIPRLLAGQIPTTLAKPEEKVVRQPLQVGGREWAVT----AVSMGNPHCVVFLE 173

Query: 173 D--DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           +   L   DL   G L   HP F E  N   A+V     L LR WERG G+T ACG+ AC
Sbjct: 174 EGGSLEELDLERVGPLFEHHPAFPERTNTEFAQVLGPNYLRLRVWERGAGVTLACGTGAC 233

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEG 277
           A++VA+    +     +V++ GG L I W  D  HV+MTG A   + G
Sbjct: 234 AALVAAVLEERAEPQATVELPGGNLEIRWDPDTQHVWMTGPALPVFSG 281


>gi|265764282|ref|ZP_06092850.1| diaminopimelate epimerase [Bacteroides sp. 2_1_16]
 gi|263256890|gb|EEZ28236.1| diaminopimelate epimerase [Bacteroides sp. 2_1_16]
          Length = 269

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 146/288 (50%), Gaps = 35/288 (12%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++ +R         AI   +       D ++LI     A  D  +
Sbjct: 5   IQFTKMHGTGNNYIYVNTLRFPIARPEKAAIEWSAYHTGIGSDGLVLIGHSDKA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE   CGN  RC+ ++L       +   T +T+ GI + + + +G    +++V
Sbjct: 63  RIFNADGSEAMMCGNASRCIGKYLYEYGLTSKNVITLDTLSGIKILELHLEGRTVETVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV---VSMGNPHAIFFVEDDL 175
           DMG P L+   I     F                    PF+   VSMGNPH + FV DD+
Sbjct: 123 DMGIP-LETGTIDFDGEF--------------------PFLSTQVSMGNPHLVTFV-DDI 160

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              +L+  G  L KHP+F +  N+  A++T   ++ +R WERG G+T ACG+ ACA+ VA
Sbjct: 161 RIVNLSEMGPKLEKHPLFPDRTNVEFAQITGENTIRMRVWERGSGITQACGTGACATAVA 220

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
           +    +T R V+V M GG L IEW +   H+ MTG A K ++G ++++
Sbjct: 221 AHLTGRTGRTVNVVMDGGTLTIEWDEATGHISMTGPAVKVFDGTIELR 268


>gi|270308057|ref|YP_003330115.1| diaminopimelate epimerase [Dehalococcoides sp. VS]
 gi|270153949|gb|ACZ61787.1| diaminopimelate epimerase [Dehalococcoides sp. VS]
          Length = 284

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 149/290 (51%), Gaps = 17/290 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           + F K++ +GN  +++D +G   +    A++          D +ML+     A  D  +R
Sbjct: 1   MKFTKLQSVGNDFVLVDPQGEERDWPKLALHMCHRHFGAGADGLMLL--LPSAKADFRMR 58

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM---KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           I N DGSE + CGNG+RC++ ++ +      R   + ET+ GI  A+  +DG I   MG+
Sbjct: 59  IFNADGSEAEICGNGLRCLIHYIVANKLIGSRDELSIETLAGIRHAQIFKDGRIRTTMGK 118

Query: 123 PILDWKLIPLARSFDKMDRDRFHIG--PVNHLFLRNPFV--VSMGNPHAIFFVEDDLYHY 178
           P+ +   IP+A   D        I   P+N +  R   V  VSMGNPHAI F    +  +
Sbjct: 119 PMFEAHQIPVAAEPDPKHYSGQLISDFPLN-INNRRVLVSLVSMGNPHAIHFCTKPVEEF 177

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G+L+  H  F +  N  +A +   E + +R WERGVG T  CGS A A  VA+  
Sbjct: 178 LLGEVGSLVETHKAFPKRTNFEVANILDTEHIKVRVWERGVGETLGCGSGASAVAVAAQI 237

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           L    + V +K+ GG L +EW  ++ V++TG+A+        I TG+W+K
Sbjct: 238 LGYVGKFVYIKLPGGTLGVEWDGHDDVYLTGKAEI-------IYTGEWLK 280


>gi|30249581|ref|NP_841651.1| diaminopimelate epimerase [Nitrosomonas europaea ATCC 19718]
 gi|81584626|sp|Q82U84|DAPF_NITEU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|30138944|emb|CAD85523.1| Diaminopimelate epimerase [Nitrosomonas europaea ATCC 19718]
          Length = 275

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 140/281 (49%), Gaps = 17/281 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASVDAFI 64
           F KM G+GN  +VID    + +++ D        D      FDQ++++    ++  D   
Sbjct: 5   FTKMHGLGNDFIVID--AINQSVSLDPATIRRWADRHFGIGFDQLLVVEKPGESG-DFRY 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+      ++ +   ET  GI++     +G +SVDMG 
Sbjct: 62  RIFNADGGEVEQCGNGARCFARFVRDHDLTRKNTIRVETACGIIMPTVEENGEVSVDMGI 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED-DLYHYDLA 181
           P  D   IP    F   +R   +   VN   +     VSMGNPHA+  V D DL    + 
Sbjct: 122 PRFDPARIP----FITQERALTYPLNVNDREIEIS-AVSMGNPHAVQIVPDIDLA--PVT 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S G  +  HP F E VN    ++     + LR +ERG G T ACG+ ACA+VV+      
Sbjct: 175 SEGPAIESHPFFPEKVNAGYMQIVDRTHIRLRVFERGTGETLACGTGACAAVVSGISRGL 234

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            +  V V M GG L I W  ++  V+MTG A   +EG +D+
Sbjct: 235 LDSEVQVTMRGGNLRIRWEGEDQPVWMTGPAVSVFEGTIDL 275


>gi|293393892|ref|ZP_06638199.1| diaminopimelate epimerase [Serratia odorifera DSM 4582]
 gi|291423719|gb|EFE96941.1| diaminopimelate epimerase [Serratia odorifera DSM 4582]
          Length = 274

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 134/277 (48%), Gaps = 12/277 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +++D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMMVDAVTQNVYFSPELIRRLADRHLGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           P  D + +P    F     ++ +I     H  L    VVSMGNPH +  V DD+    + 
Sbjct: 121 PNFDPQTVP----FRAAKAEKTYIMRAAEHTVLAG--VVSMGNPHCVLQV-DDVKTAKVE 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L  H  F E  N+   +V S + + LR +ERG G T ACGS ACA+V        
Sbjct: 174 LLGPVLESHERFPERANIGFMQVVSRDRIKLRVYERGAGETQACGSGACAAVAVGIQQEL 233

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
            +  V V++ GG L I W      +FMTG A   ++G
Sbjct: 234 LSEEVHVELPGGSLHIRWKGPGTPLFMTGPATHVYDG 270


>gi|224013704|ref|XP_002296516.1| diaminopimelate epimerase [Thalassiosira pseudonana CCMP1335]
 gi|220968868|gb|EED87212.1| diaminopimelate epimerase [Thalassiosira pseudonana CCMP1335]
          Length = 323

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 148/293 (50%), Gaps = 24/293 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHFDQ-----IMLIHDFQDAS 59
           ++FAK EG+GN  ++ID R      +T +    L    N +F       I  +   QD  
Sbjct: 39  IEFAKYEGLGNDFILIDDRDRETPRLTPEQSERLC---NRNFGVGGDGVIFALKAPQD-- 93

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMK-RKSFTFETIRGILVAKENRDGSISV 118
            D  +RI N DGSE + CGNG+RC  +FL    +  KS+   T+ G +V + N D +I+V
Sbjct: 94  YDFTMRIYNSDGSEPEMCGNGIRCFAQFLKDLGEDAKSYKVNTLAGPIVPEMNPD-TITV 152

Query: 119 DMGEPILDWKLIPLARSFDKMDR---DRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           DMGEPILD   +P   + +       ++ H+      +  +   VSMGNPHAI FV+D  
Sbjct: 153 DMGEPILDGPSVPTTLAPNSEHNSVLEQTHVDKNGKEWKIS--AVSMGNPHAIIFVDDLE 210

Query: 176 YHYDLASFGNLLAKHP-MFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
              D A  G  L      F    N+   +V S   L ++ WERG G T ACG+  CA VV
Sbjct: 211 KDIDFAVDGPALESDTGAFPAKTNVEFVQVMSPNHLKMKVWERGAGPTLACGTGTCALVV 270

Query: 235 ASGCLHKTNRA----VSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
           A+   +K  R     V V + GG L IEW  +NN ++MTG A   ++G   +K
Sbjct: 271 AAIRANKIPRPGKEGVRVTLPGGDLFIEWREENNRIYMTGPATLSFKGTALLK 323


>gi|229099396|ref|ZP_04230326.1| Diaminopimelate epimerase [Bacillus cereus Rock3-29]
 gi|228684020|gb|EEL37968.1| Diaminopimelate epimerase [Bacillus cereus Rock3-29]
          Length = 288

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 148/291 (50%), Gaps = 19/291 (6%)

Query: 4   SMVDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S   F KM G+GN  + ++M   +   +++   A    + +     D ++LI     A V
Sbjct: 2   SQFSFTKMHGLGNSYIYVNMFEEQILEEDLALVAEKVSNINTGIGADGMILICPSDVAPV 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS 117
              +R+ N DGSE ++CGNG+RCV ++      ++   F  ET+ GI+ A+    DG ++
Sbjct: 62  K--MRMFNNDGSEGKNCGNGLRCVAKYAYEHKLVEETVFAIETLAGIVTAEVTVEDGVVT 119

Query: 118 ---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
              +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV D
Sbjct: 120 LVKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-D 174

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    L + G +L  H MF E  N+    + + + ++ R WERG G+T ACG+ ACA+V
Sbjct: 175 DVEKAPLTTLGPVLETHEMFPERANVEFIEILNDDEMNFRVWERGSGVTQACGTGACAAV 234

Query: 234 VASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           VA+    K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 235 VAAILNGKLERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 285


>gi|225569359|ref|ZP_03778384.1| hypothetical protein CLOHYLEM_05443 [Clostridium hylemonae DSM
           15053]
 gi|225162158|gb|EEG74777.1| hypothetical protein CLOHYLEM_05443 [Clostridium hylemonae DSM
           15053]
          Length = 277

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 147/286 (51%), Gaps = 23/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  + ++   C      +   A     + HF    D +++I   + A  D  
Sbjct: 3   FTKMHGLGNDYVYVN---CFKEKIGNPPEAARILSDRHFGVGSDGLIMICPSEKA--DFE 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DGS  + CGNG+RCV +++       + + + ET+ G+    L  K+ +   I 
Sbjct: 58  MEMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTNISVETLGGVKYLDLTVKDGKAVLIK 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           VDMG P L  + IP+    D +  +   + G +  +       VSMGNPHA+ FV DD+ 
Sbjct: 118 VDMGRPELKPERIPIVSGGDAVISEPIVVDGAIYRMT-----GVSMGNPHAVIFV-DDVK 171

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             +L + G     H  F + VN   ARV   E++++R WERG G T ACG+ ACA  VA 
Sbjct: 172 GLELEAVGPKFENHERFPKRVNTEFARVIDRETVEMRVWERGSGETLACGTGACAVAVAC 231

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
                T   V+V++LGG LLIEW  + + V+MTG A   ++G++ I
Sbjct: 232 ILNGLTEDKVTVRLLGGDLLIEWDKEADKVYMTGPATVVFDGEIQI 277


>gi|170693975|ref|ZP_02885131.1| Diaminopimelate epimerase [Burkholderia graminis C4D1M]
 gi|170141047|gb|EDT09219.1| Diaminopimelate epimerase [Burkholderia graminis C4D1M]
          Length = 300

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 145/287 (50%), Gaps = 15/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  +V+D      N+T + + AL+   + HF    DQ++L+       VD
Sbjct: 16  LKFTKMHGAGNDFVVLDGYTQALNLTPEQVRALA---DRHFGVGADQLLLVEKPTVDGVD 72

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVD 119
              RI NCDG EV+ CGNG RC V+F+  +    ++S   +   G +      +G + VD
Sbjct: 73  FRYRIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQNGTITLTMQENGEVLVD 132

Query: 120 MGEPILDWKLIPLARSFDKMDRDRF-HIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P+ + + +P A    +  R+    + P++ +   R   VVSMGNPHA+  V DD+  
Sbjct: 133 MGSPVFEPERVPFATKGLQGRREGADTLWPLDVNGTTRWISVVSMGNPHAVQVV-DDVEA 191

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A  
Sbjct: 192 FPVLVEGPVIERHARFPQKVNAGFMQIVGRSEIKLRVYERGAGETLACGTGACAAVAAGI 251

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNH---VFMTGEAKKEWEGKLDI 281
                +  V V   GG L I W  N     + M G A   ++G++++
Sbjct: 252 RRGLLDAPVLVHTHGGKLTISWDSNKESEPLLMAGPATTVFQGEIEL 298


>gi|229181234|ref|ZP_04308564.1| Diaminopimelate epimerase [Bacillus cereus 172560W]
 gi|228602127|gb|EEK59618.1| Diaminopimelate epimerase [Bacillus cereus 172560W]
          Length = 280

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 147/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    DG ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEDGVVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEKAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+VVA+    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNNDEMNFRVWERGSGVTQACGTGACAAVVAAILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 277


>gi|212694865|ref|ZP_03302993.1| hypothetical protein BACDOR_04399 [Bacteroides dorei DSM 17855]
 gi|212662618|gb|EEB23192.1| hypothetical protein BACDOR_04399 [Bacteroides dorei DSM 17855]
          Length = 280

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 149/288 (51%), Gaps = 18/288 (6%)

Query: 3   SSMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++ + F KM+G GN  + ++ +R    +    +I   S       D ++LI   +    D
Sbjct: 2   ATTIKFTKMQGAGNDYIYVNTLRHPIADPVRTSIKWSSCHTGIGSDGLVLIG--KSTKAD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDG----S 115
             +RI N DGSE   CGN  RC+ +++      +++  T ET+ GI + K + +      
Sbjct: 60  FSMRIFNADGSEAMMCGNASRCIGKYVYDNKLTQKEVITLETLSGIKILKLHTENGLVEE 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRF-HIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           ++VDM     D  L+  +R  +  D         V+    +  FV  MGNPH + F+ DD
Sbjct: 120 VTVDM-----DLPLLTNSRQINTPDGKMLAKTITVDGKEYKGTFVC-MGNPHLVIFI-DD 172

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           + + +L + G  L  HP+F E  N+    V    SL +R WERG G+T ACG+ ACA+ V
Sbjct: 173 IKNVNLPAIGPKLENHPLFPERTNVEFVEVLPDGSLRMRVWERGSGITMACGTGACATAV 232

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           A+   HK  R   V+M GG L + W++ + HV+MTG A K ++G+++I
Sbjct: 233 AAYLNHKAGRKSRVRMDGGDLQVHWNETDGHVYMTGPAVKVFDGEIEI 280


>gi|170724854|ref|YP_001758880.1| diaminopimelate epimerase [Shewanella woodyi ATCC 51908]
 gi|229813248|sp|B1KQD0|DAPF_SHEWM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169810201|gb|ACA84785.1| Diaminopimelate epimerase [Shewanella woodyi ATCC 51908]
          Length = 279

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 149/282 (52%), Gaps = 12/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ FAKM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIHFAKMHGLGNDFMVVD--GVTQNVFFSPEQIKRLADRNFGVGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+
Sbjct: 59  FHYRIFNADGGEVEQCGNGARCFARFVRNKGLTNKHKIKVSTSNGKITLRLERDGNVTVN 118

Query: 120 MGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG P+LD   IP  A+  +K    +         FL     +SMGNPH +  VE D+ H 
Sbjct: 119 MGVPVLDPSKIPFNAKRVEKTYLLQTSSSHAMETFLCG--AISMGNPHCVLEVE-DIEHA 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++   G LL ++  F +GVN+   +V     + LR +ERG   T ACG+ ACA+      
Sbjct: 176 EVERIGALLTQNERFPKGVNVGFMQVIDAGHIKLRVYERGAAETLACGTGACAAAAVGQL 235

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
             K N+ V V + GG L I W  + N ++MTG A+  ++G++
Sbjct: 236 QGKLNKMVRVDLPGGTLTINWEGEGNPLWMTGPAEHVYDGQI 277


>gi|228948660|ref|ZP_04110938.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228810967|gb|EEM57310.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
          Length = 268

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    +G ++   +DMG P L    IP L        R+ F     NH +      
Sbjct: 86  IVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FV DD+    L + G +L  H MF E VN+    + + E ++ R WERG 
Sbjct: 142 VSMGNPHAVIFV-DDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVAS    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|229130197|ref|ZP_04259156.1| Diaminopimelate epimerase [Bacillus cereus BDRD-Cer4]
 gi|228653130|gb|EEL09009.1| Diaminopimelate epimerase [Bacillus cereus BDRD-Cer4]
          Length = 268

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 132/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    DG ++   +DMG P L    IP L  S     R+ F     NH +      
Sbjct: 86  IVTAEVTVEDGVVTLAKIDMGAPRLTRAEIPMLGESETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FV DD+    L + G +L  H MF E VN+    + + + ++ R WERG 
Sbjct: 142 VSMGNPHAVIFV-DDVEKAPLTTLGPVLETHEMFPERVNVEFIEILNEDEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVA+    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|295401375|ref|ZP_06811346.1| diaminopimelate epimerase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109665|ref|YP_003987981.1| diaminopimelate epimerase [Geobacillus sp. Y4.1MC1]
 gi|294976590|gb|EFG52197.1| diaminopimelate epimerase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311214766|gb|ADP73370.1| diaminopimelate epimerase [Geobacillus sp. Y4.1MC1]
          Length = 284

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 152/288 (52%), Gaps = 41/288 (14%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS---TDDNTHF--DQIMLIHDFQDASVDA 62
           F KM G+GN  + ++M    + I    ++ L+   ++ NT    D ++LI   + A V  
Sbjct: 6   FTKMHGLGNSYIYVNM--FEETIPESLLSLLAVKVSNVNTGIGADGMILICPSKVAPVK- 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK-ENRDGSIS-- 117
            +RI N DGSE ++CGNG+RCV +++     +  +SF  ET+ G++ A+ E  +G+++  
Sbjct: 63  -MRIFNSDGSEGKNCGNGLRCVAKYVYEHGIVNDRSFFIETLSGLVKAEVEVENGAVTNV 121

Query: 118 -VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF----------VVSMGNPH 166
            +DMG+P L    IP+             +GP     +  PF           VSMGNPH
Sbjct: 122 TIDMGKPRLKRSEIPM-------------VGPEAERVVAEPFEVDGQLYEITAVSMGNPH 168

Query: 167 AIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
            IF+V DD+    + S G ++ K   F EGVN+    V +   L  R WERG G+T ACG
Sbjct: 169 VIFYV-DDINQAAVTSLGPIVEKDKRFPEGVNVEFVEVVNDHELHFRVWERGSGVTQACG 227

Query: 227 SAACASVVASGCLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
           + ACA+VVAS    KT  N+   V + GG L I W D  +V MTG A+
Sbjct: 228 TGACAAVVASVLNGKTARNKETIVHLAGGDLTITWTDEGNVRMTGPAE 275


>gi|161702953|ref|YP_370673.2| diaminopimelate epimerase [Burkholderia sp. 383]
          Length = 289

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 140/290 (48%), Gaps = 17/290 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+       V
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGV 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVV 119

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P  A   D        + P++     R    V+MGNPHA+  V DD  
Sbjct: 120 DMGAPVFTPAQVPFDAAGLDGRTEGHDTLWPLDVGGATRWISTVTMGNPHAVQVV-DDAE 178

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+  H  F E VN    +V S   + LR +ER  G T ACG+ ACA+V A 
Sbjct: 179 AYPVLEEGPLIEHHARFPERVNAGFMQVVSRSEVKLRVYERAAGETLACGTGACAAVAAG 238

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIK 282
                 +  V+V   GG L I W     +   + M G A   +EG++D+ 
Sbjct: 239 IRRGLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPATTVFEGEIDLP 288


>gi|254788014|ref|YP_003075443.1| diaminopimelate epimerase [Teredinibacter turnerae T7901]
 gi|259595063|sp|C5BUL6|DAPF_TERTT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|237685672|gb|ACR12936.1| diaminopimelate epimerase [Teredinibacter turnerae T7901]
          Length = 276

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 137/285 (48%), Gaps = 24/285 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  ++ID       IT +    L+   + HF    DQ++++    +   D  
Sbjct: 5   FTKMHGLGNDFVMIDAISQKVTITPERARKLA---DRHFGVGCDQVLVVESPDNPDADFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV++CGNG RC   F+  R    +     ET  G+L      D  ++V+MG
Sbjct: 62  YRIFNNDGSEVENCGNGARCFAVFVRQRQLTAKSDIVVETAAGLLRLHVLDDNQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----VSMGNPHAIFFVEDDLYH 177
            P+L    IP             H  P   L L N  +    VSMGNPHA+  V D+L  
Sbjct: 122 VPVLAPAQIPFVTP---------HEQPEYPLQLDNMEITISAVSMGNPHAVTLV-DNLAS 171

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + + + G  +  H  F   VN     + S + + LR +ERGVG T ACG+ ACA+VV+  
Sbjct: 172 FPVKTLGAQIETHAQFPNRVNAGFMELISRQEVKLRVFERGVGETLACGTGACAAVVSGI 231

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                +  V+V + GG L I W      V MTG AK  + G++ +
Sbjct: 232 VRGLLDTTVAVHLPGGSLSITWEGAEKPVMMTGPAKAVFHGQVKL 276


>gi|77968649|gb|ABB10029.1| diaminopimelate epimerase [Burkholderia sp. 383]
          Length = 309

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 140/290 (48%), Gaps = 17/290 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   N HF    DQ++L+       V
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGV 79

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + V
Sbjct: 80  DFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVV 139

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+     +P  A   D        + P++     R    V+MGNPHA+  V DD  
Sbjct: 140 DMGAPVFTPAQVPFDAAGLDGRTEGHDTLWPLDVGGATRWISTVTMGNPHAVQVV-DDAE 198

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y +   G L+  H  F E VN    +V S   + LR +ER  G T ACG+ ACA+V A 
Sbjct: 199 AYPVLEEGPLIEHHARFPERVNAGFMQVVSRSEVKLRVYERAAGETLACGTGACAAVAAG 258

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIK 282
                 +  V+V   GG L I W     +   + M G A   +EG++D+ 
Sbjct: 259 IRRGLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPATTVFEGEIDLP 308


>gi|229199084|ref|ZP_04325767.1| Diaminopimelate epimerase [Bacillus cereus m1293]
 gi|228584355|gb|EEK42490.1| Diaminopimelate epimerase [Bacillus cereus m1293]
          Length = 268

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    +G ++   +DMG P L    IP L        R+ F     NH +      
Sbjct: 86  IVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FV DD+    L + G +L  H MF E VN+    + + E ++ R WERG 
Sbjct: 142 VSMGNPHAVIFV-DDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVAS    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|229141655|ref|ZP_04270185.1| Diaminopimelate epimerase [Bacillus cereus BDRD-ST26]
 gi|229187176|ref|ZP_04314321.1| Diaminopimelate epimerase [Bacillus cereus BGSC 6E1]
 gi|228596186|gb|EEK53861.1| Diaminopimelate epimerase [Bacillus cereus BGSC 6E1]
 gi|228641723|gb|EEK98024.1| Diaminopimelate epimerase [Bacillus cereus BDRD-ST26]
          Length = 268

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    +G ++   +DMG P L    IP L        R+ F     NH +      
Sbjct: 86  IVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FV DD+    L + G +L  H MF E VN+    + + E ++ R WERG 
Sbjct: 142 VSMGNPHAVIFV-DDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVAS    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|295095178|emb|CBK84268.1| diaminopimelate epimerase [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 278

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 132/278 (47%), Gaps = 10/278 (3%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDA 62
            M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D 
Sbjct: 3   QMMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHVGVGFDQLLVVEPPYDPDLDF 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+M
Sbjct: 63  HYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTDDELVRVNM 122

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEP  D   +P     +K ++          +      VVSMGNPH +  V DD+    +
Sbjct: 123 GEPNFDPSAVPF--RANKAEKTYIMRAAEQTVLCG---VVSMGNPHCVIQV-DDVQTAAV 176

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V       
Sbjct: 177 ETLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGISQG 236

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                V V++ GG L I W    H ++MTG A   ++G
Sbjct: 237 LLAEEVRVELPGGRLDIAWKGAGHPLYMTGPATHVYDG 274


>gi|34497983|ref|NP_902198.1| diaminopimelate epimerase [Chromobacterium violaceum ATCC 12472]
 gi|81655424|sp|Q7NV18|DAPF_CHRVO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|34103838|gb|AAQ60199.1| diaminopimelate epimerase [Chromobacterium violaceum ATCC 12472]
          Length = 276

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 142/286 (49%), Gaps = 22/286 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID      ++T + I  L        FDQ++L+   ++A  D   
Sbjct: 3   LKFSKMHGLGNDFMVIDGVRQTVSLTPEQIRLLGNRQLGIGFDQLLLVEPAREAGHDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  +F+  +    +     ET RG++  +   DG   VDMG 
Sbjct: 63  RIFNNDGGEVEQCGNGARCFAKFVRDQGLTGKSRIEVETARGVIAPEYLGDGLARVDMGV 122

Query: 123 PILDWKLIPL-----ARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P      +P      A ++   +   R  IG           + SMGNPHA+  V DD+ 
Sbjct: 123 PRFRPADLPFLADAEALTYSLPLPEGRCEIG-----------IASMGNPHAVQRV-DDVD 170

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G  +  HP F + VN    ++ +   + LR +ERG G T ACG+ ACA+VV  
Sbjct: 171 AAPVAEVGPAIESHPAFPQRVNAGFMQIVNRGEIRLRVYERGAGETLACGTGACAAVVCG 230

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V   GG ++IEW  + + V MTG A   ++G++++
Sbjct: 231 IRQGLLDARVTVHARGGDIVIEWAGEGSPVIMTGPAVTVFQGEIEL 276


>gi|194476635|ref|YP_002048814.1| Diaminopimelate epimerase [Paulinella chromatophora]
 gi|171191642|gb|ACB42604.1| Diaminopimelate epimerase [Paulinella chromatophora]
          Length = 376

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 147/289 (50%), Gaps = 22/289 (7%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNIT-----SDAINALSTDDNTHF----DQIMLIHDF 55
           M+ F+K  G+GN  L+ID R    N        + +  L    + HF    D +++I   
Sbjct: 1   MLQFSKYHGLGNDFLIIDGRSWPANFMFANPDPEWVRHLC---DRHFGVGADGVIIILS- 56

Query: 56  QDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR---MKRKSFTFETIRGILVAKENR 112
                D  +RI N DG+E Q CGNG+RC+ +FL      M    +  ET+ GI+V++   
Sbjct: 57  PTLEGDWRMRIFNADGTEAQMCGNGIRCISKFLADSDKVMVGHKWKIETLAGIIVSELKE 116

Query: 113 DGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPV-NHLFLRNPFVVSMGNPHAIFFV 171
           +  I VDMG PIL    IP   S   + +D   IG +  +    +     MGNPH +  V
Sbjct: 117 NDMIYVDMGIPILSPHDIPTRLS---VGQDNIAIGLIETNGITWSVAAAGMGNPHIVIPV 173

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
           +D     D+  FG LL +H  F    N+   +V     L LRTWERGVG+T ACG+ ACA
Sbjct: 174 KD-AEDIDIEKFGPLLEEHFAFPTQTNVHFLQVIEHNHLKLRTWERGVGVTFACGTGACA 232

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +++ +  L  +++   + + GG LL+ W   +NH+ + G AK  ++G L
Sbjct: 233 ALIVAHSLGLSDKEAQIDLPGGSLLVNWETIDNHISIIGSAKAIFDGVL 281


>gi|312884203|ref|ZP_07743914.1| diaminopimelate epimerase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368131|gb|EFP95672.1| diaminopimelate epimerase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 276

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 144/284 (50%), Gaps = 26/284 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + D I  L+ D NT   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFVVVDCITQNVFFSPDLIRRLA-DRNTGIGFDQLLIVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DG EV+ CGNG RC  RF+  RMK    +   +  T +G ++     D  ++V+MG
Sbjct: 64  IFNSDGGEVEQCGNGARCFARFV--RMKGLTNKYRISVSTKKGKIILNIGDDDQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI--GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F    R++ +I       LF      VS+GNPH +  VE+ L    
Sbjct: 122 VPEFEPSKIP----FKAKQREKTYILRAQDKTLFCG---AVSLGNPHVVTVVEE-LSDAL 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV---VAS 236
           +   G +L  H  F E VN    +V S   + LR +ERG G T ACG+ ACA+V   +A 
Sbjct: 174 IDEIGPVLESHERFPERVNAGFMKVLSRSEIKLRVYERGAGETQACGTGACAAVAVGIAQ 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           G L   +  V+V + GG L I W  D   ++MTG A   ++G+L
Sbjct: 234 GLL---DENVTVHLPGGTLKIAWQGDGEPLYMTGPASHVFDGQL 274


>gi|319791648|ref|YP_004153288.1| diaminopimelate epimerase [Variovorax paradoxus EPS]
 gi|315594111|gb|ADU35177.1| diaminopimelate epimerase [Variovorax paradoxus EPS]
          Length = 300

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 141/290 (48%), Gaps = 17/290 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +++     L+   + HF    DQI+ +       +D
Sbjct: 3   IRFTKMQGAGNDFVVLDETRGTLGLSAAQYRFLA---DRHFGVGADQILTVRPSPAEGID 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG EV+ CGNG RC +RF+       +     +T+ G++  +   DG ++VD
Sbjct: 60  FQYVIHNADGGEVEQCGNGARCFMRFVKEHKLTDKTQVRVQTLAGVIEPRMGADGRVTVD 119

Query: 120 MGEPILDWKLIPL------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           MG PI +   +P       A+     ++    +G      + +  V+SMGNPHA+  V D
Sbjct: 120 MGAPIFEAARVPFDTAGLDAQPDGSWEKWHLALGTRAGSPIVSVAVLSMGNPHAVQVV-D 178

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           ++    +A  G  +  HP F + VN    +V     + LR +ERG G T ACG+ ACA+V
Sbjct: 179 NVDTAPVAEQGPQIEHHPRFPQRVNAGFMQVVDRSHIKLRVFERGAGETLACGTGACAAV 238

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
           VA   L      V V+  GG L IEW  +   V MTG A   +EG +D+ 
Sbjct: 239 VAGIRLGLLESRVDVQTHGGILTIEWQGEGQPVLMTGPATTVFEGDIDVP 288


>gi|238756292|ref|ZP_04617607.1| Diaminopimelate epimerase [Yersinia ruckeri ATCC 29473]
 gi|238705498|gb|EEP97900.1| Diaminopimelate epimerase [Yersinia ruckeri ATCC 29473]
          Length = 278

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 140/278 (50%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAF 63
           + F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D  +D  
Sbjct: 5   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLA-DRHTGVGFDQMLVVEPPYDPELDFH 63

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  +SV+MG
Sbjct: 64  YRIFNADGSEVSQCGNGARCFARFVRIKGLTNKRDIRVSTQTGRMVLSVTDDEMVSVNMG 123

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           EP  + + IP    F  +  ++ +I     H  L    VVSMGNPH +  V DD+   ++
Sbjct: 124 EPNFEPQAIP----FKAIKAEKTYILRAAEHTVLCG--VVSMGNPHCVLQV-DDVSAANV 176

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  L  H  F E  N+   +V S + + LR +ERG G T ACGS ACA+V       
Sbjct: 177 ELLGPELENHERFPERANIGFMQVVSRQHIRLRVYERGAGETQACGSGACAAVAVGIQQA 236

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
             +  V V++ GG L I W      ++MTG A   ++G
Sbjct: 237 LLDEDVHVELPGGSLDISWKGLGQPLYMTGPATHVYDG 274


>gi|307104456|gb|EFN52710.1| hypothetical protein CHLNCDRAFT_36797 [Chlorella variabilis]
          Length = 303

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/293 (31%), Positives = 144/293 (49%), Gaps = 19/293 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF--DQIMLIHDFQDASV 60
           ++ V FAK +G+GN  +++D R   + + +        D N     D ++     ++ + 
Sbjct: 16  AAAVKFAKYQGLGNDFILVDNRHQLEPVVTPEQAVKLCDRNFGIGGDGVIFALPSENGT- 74

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE---TIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC+ RF+    + +    +   T+ G++      DG + 
Sbjct: 75  DYSMRIFNSDGSEPEMCGNGIRCLARFVAGDPRARGAGAQLVHTLAGLIQPALLPDGQVC 134

Query: 118 VDMGEPILDWKLIPLARSFDKMD---RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
           VDMGEPIL    +P      + +   + +  +     L       VSMGNPHAI F   D
Sbjct: 135 VDMGEPILRGPDVPTTLQPTQGEAVVQQKLAVDGKEWLMT----CVSMGNPHAITFGLAD 190

Query: 175 -----LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
                +   DL   G     +P+F    N     V S   + +  WERG G T ACG+ A
Sbjct: 191 GSSIKVDSIDLPGIGPKFEHNPVFPARTNTEFVEVLSRSHVRMVVWERGAGATLACGTGA 250

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           CA+VVA      T+R+  V + GG L IEW + +NH++MTG A+  + G +D+
Sbjct: 251 CATVVAGVLEGHTDRSCQVDLPGGPLHIEWRESDNHIYMTGPAELVFAGSVDV 303


>gi|258622842|ref|ZP_05717859.1| diaminopimelate epimerase [Vibrio mimicus VM573]
 gi|258584903|gb|EEW09635.1| diaminopimelate epimerase [Vibrio mimicus VM573]
          Length = 276

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 141/281 (50%), Gaps = 20/281 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCVTQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DGSEV+ CGNG RC  RF+  RMK    + +    T +G +V     +  I+V+MG
Sbjct: 64  IFNADGSEVEQCGNGARCFARFV--RMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F     ++ +I  V    LF      VSMGNPH +  V DD+    
Sbjct: 122 VPEFEPSKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVV-DDIRTAA 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V      
Sbjct: 174 VETLGPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 234 GLLDEQVRVHLPGGELEISWKGPGKPLYMTGPATHVYDGQI 274


>gi|167747179|ref|ZP_02419306.1| hypothetical protein ANACAC_01893 [Anaerostipes caccae DSM 14662]
 gi|167654139|gb|EDR98268.1| hypothetical protein ANACAC_01893 [Anaerostipes caccae DSM 14662]
          Length = 285

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 146/293 (49%), Gaps = 24/293 (8%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQD 57
           +S  + F KM G GN  + ++   C +    +         + HF    D ++ IH    
Sbjct: 4   RSDSMKFTKMHGCGNDYVYVN---CFEETIENPNETAKFVSDRHFGIGSDGMICIHPSDK 60

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKEN 111
           A  D  + + N DG+E   CGNG+RC+ +++       + + T ET  GI    L  ++ 
Sbjct: 61  A--DFRMAMYNSDGTEGAMCGNGVRCIAKYVYDYGLTDKTTITIETKGGIKELDLTVEDG 118

Query: 112 RDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           +   ++VDM  P+L+   IP+    +K   D+  I       +     VSMGNPH + FV
Sbjct: 119 KVTWVNVDMEAPVLEADKIPVIYDEEKKVIDKPVIVDGREYRIT---CVSMGNPHGVVFV 175

Query: 172 E--DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           +  DDL   D+   G +   HPMF + VN    +V    ++ +R WERG G T ACG+ A
Sbjct: 176 DSVDDL---DIEKLGPMFEHHPMFPDRVNTEFIQVVDDHTIRMRVWERGAGETLACGTGA 232

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           CAS  AS    KT   V V +LGG L IE+ +  H +FM G A K ++G++D+
Sbjct: 233 CASAYASYLNQKTGNKVLVHLLGGDLQIEYDEEKHTIFMKGPATKVFDGEIDL 285


>gi|261210167|ref|ZP_05924464.1| diaminopimelate epimerase [Vibrio sp. RC341]
 gi|260840707|gb|EEX67256.1| diaminopimelate epimerase [Vibrio sp. RC341]
          Length = 276

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 141/281 (50%), Gaps = 20/281 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCVTQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DGSEV+ CGNG RC  RF+  RMK    + +    T +G +V     +  I+V+MG
Sbjct: 64  IFNADGSEVEQCGNGARCFARFV--RMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F     ++ +I  V    LF      VSMGNPH +  VED +    
Sbjct: 122 VPEFEPSKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVVED-IRTAA 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V      
Sbjct: 174 VETLGPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 234 GLLDEQVRVHLPGGELEISWQGPGKPLYMTGPATHIYDGQI 274


>gi|289578518|ref|YP_003477145.1| diaminopimelate epimerase [Thermoanaerobacter italicus Ab9]
 gi|289528231|gb|ADD02583.1| diaminopimelate epimerase [Thermoanaerobacter italicus Ab9]
          Length = 274

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 155/287 (54%), Gaps = 28/287 (9%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +VI+     +N+    +     D   HF    D ++++        D  
Sbjct: 3   FTKMHGLGNDFIVIE---ALENVDYSELAVKLCD--RHFGIGADGLLVVE--PSGIADIR 55

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILV----AKENRDGSIS 117
           +RI N DGSE + CGNG RC  +++  R  +K++  T ET+ G+++     K  +  S+ 
Sbjct: 56  MRIFNADGSEAEMCGNGSRCFAKYVYERGIVKKEKMTVETLAGVIMPEVFVKNGKVESVK 115

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVEDD 174
           V MG PI +   IP+     K D+ +F   PV     ++      + +G PH I FVE  
Sbjct: 116 VYMGNPIFETSKIPI-----KTDKQKFINEPVKIDGKVYKLTS--IRVGVPHTIVFVES- 167

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           L    +   G+ + K  +FS+G N+   +V   E++ +RTWERGVGLT ACGS ACAS V
Sbjct: 168 LDENMIKELGSKIEKSSLFSQGTNVDFVKVEDKENIFVRTWERGVGLTLACGSGACASAV 227

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           AS  L KT R V+V    G L +EW ++N ++++G+ ++ + G++++
Sbjct: 228 ASAVLGKTERNVNVHFKAGKLFVEWLEDNSIYLSGKVEEVFRGEIEL 274


>gi|256752262|ref|ZP_05493125.1| diaminopimelate epimerase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914485|ref|ZP_07131801.1| diaminopimelate epimerase [Thermoanaerobacter sp. X561]
 gi|307724279|ref|YP_003904030.1| diaminopimelate epimerase [Thermoanaerobacter sp. X513]
 gi|320116154|ref|YP_004186313.1| diaminopimelate epimerase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|256748830|gb|EEU61871.1| diaminopimelate epimerase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889420|gb|EFK84566.1| diaminopimelate epimerase [Thermoanaerobacter sp. X561]
 gi|307581340|gb|ADN54739.1| diaminopimelate epimerase [Thermoanaerobacter sp. X513]
 gi|319929245|gb|ADV79930.1| diaminopimelate epimerase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 274

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 152/281 (54%), Gaps = 16/281 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM G+GN  +VI+ R   D  +  AI           D ++++        D  +RI 
Sbjct: 3   FTKMHGLGNDFIVIEARENVD-YSELAIKLCDRHFGIGADGLLVVE--PSGIADIRMRIF 59

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK---EN-RDGSISVDMG 121
           N DGSE + CGNG RC  +++  R  +K++    ET+ G+++ +   EN +  S+ V MG
Sbjct: 60  NADGSEAEMCGNGSRCFAKYVYERGIVKKEKMAVETLAGVIMPEVFVENGKVESVKVYMG 119

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            PI +   IP+     K D+ +F   PV     +     + +G PH I FV+  L    +
Sbjct: 120 SPIFEANKIPV-----KTDKQKFINEPVKIDGKVYKLTSIRVGVPHTIVFVKS-LDENMI 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  + K  +F +G N+   +V   E++ +RTWERGVGLT ACGS ACAS VAS  L 
Sbjct: 174 KELGPKIEKSSIFPQGTNVDFVKVEDKENISVRTWERGVGLTLACGSGACASAVASAVLG 233

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           KT R V+V   GG LL+EW D+N ++++G  ++ + G++++
Sbjct: 234 KTERNVNVHFKGGKLLVEWLDDNSIYLSGSVEEVFRGEIEL 274


>gi|85060324|ref|YP_456026.1| diaminopimelate epimerase [Sodalis glossinidius str. 'morsitans']
 gi|123518670|sp|Q2NQF4|DAPF_SODGM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|84780844|dbj|BAE75621.1| diaminopimelate epimerase [Sodalis glossinidius str. 'morsitans']
          Length = 274

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 140/278 (50%), Gaps = 14/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPEMIRRLSDRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDM 120
           RI N DGSEV  CGNG RC  RF+  RMK    ++     T  G +V     D S+ V+M
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFV--RMKNLTNKRDIHVSTQTGRMVLTVTEDDSVRVNM 118

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEP  D + + L R+  ++++          +      VVSMGNPH +  V D + +  +
Sbjct: 119 GEPNFDPQQV-LFRA-ARVEKTYIMRAAEQTVLCG---VVSMGNPHCVIAV-DSVDNAPV 172

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A+ G +L  H  F E  N+   +V +   + LR +ERG G T ACGS ACA+V       
Sbjct: 173 ATLGPVLESHERFPERANIGFMQVLNRGHIRLRVYERGAGETQACGSGACAAVAVGISQG 232

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
           +    V V++ GG L I W    H ++MTG A   ++G
Sbjct: 233 QLAEQVQVELTGGRLAISWRGPGHPLYMTGPATHIYDG 270


>gi|91791758|ref|YP_561409.1| diaminopimelate epimerase [Shewanella denitrificans OS217]
 gi|123061318|sp|Q12S90|DAPF_SHEDO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91713760|gb|ABE53686.1| diaminopimelate epimerase [Shewanella denitrificans OS217]
          Length = 275

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 149/283 (52%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           M+ F KM G+GN  +V+D  G   N+  + + I  L+  +    FDQ++L+    D  +D
Sbjct: 1   MIHFTKMHGLGNDFMVVD--GVTQNVFFSPEQIRRLANRNFGVGFDQLLLVEPPYDPDLD 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDGS+ V+
Sbjct: 59  FHYRIFNADGSEVEQCGNGARCFARFVRNKGLTQKNKIRVSTSSGKMTLRLERDGSVVVN 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P+ D   IP      K+++      PV          +SMGNPH +  V DD+    
Sbjct: 119 MGVPVTDPSNIPFKAK--KVEKTYLLQTPVQTFLCG---AISMGNPHCVIEV-DDIDTVA 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G LL +H  FS+GVN+   ++ +   + LR +ERG G T ACG+ ACA+       
Sbjct: 173 VDEIGALLTRHERFSKGVNVGFMQIINPGHIKLRVYERGAGETLACGTGACAAAAIGQLQ 232

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K +R V V + GG L I+W  +   ++MTG A+  ++G++ +
Sbjct: 233 DKLSRQVRVDLPGGTLHIDWDGEGKPLWMTGPAEHVYDGQIQL 275


>gi|292493803|ref|YP_003529242.1| diaminopimelate epimerase [Nitrosococcus halophilus Nc4]
 gi|291582398|gb|ADE16855.1| diaminopimelate epimerase [Nitrosococcus halophilus Nc4]
          Length = 276

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 139/286 (48%), Gaps = 22/286 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F KM+G+GN  +VID      ++T+  +  ++        DQ++L+       VD   
Sbjct: 3   VAFTKMQGLGNDFVVIDTISQSLSLTASQVRRIADRRLGIGCDQVLLVAPPPSPEVDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  +    ++    +T  G++      D  ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFARFVREQGLTGKERLQVQTAGGVIRLHLETDKQVTVDMGV 122

Query: 123 PILDWKLIPLARSFD------KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P      IP     +      + D+ R  IG            VSMGNPH +  V   + 
Sbjct: 123 PRFAPDEIPFKADHEADSYLLEFDKQRVEIG-----------AVSMGNPHCVLRVAA-ID 170

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A +G +L +HP F + VN+    V S   + LR +ERG G T ACG+ ACA++V  
Sbjct: 171 AAPIACWGPILERHPRFPQRVNVGFVEVISPGHIRLRVYERGAGETPACGTGACAAMVIG 230

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 +  V+V + GG L I W  +   V+MTG A+  +EG +++
Sbjct: 231 RRRGWLSEQVNVDLPGGRLGIHWAGEGRSVWMTGPAETVFEGAIEL 276


>gi|319778945|ref|YP_004129858.1| Diaminopimelate epimerase [Taylorella equigenitalis MCE9]
 gi|317108969|gb|ADU91715.1| Diaminopimelate epimerase [Taylorella equigenitalis MCE9]
          Length = 290

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 139/277 (50%), Gaps = 8/277 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRIINC 69
           M GIGN  +V+D      N+ S+ I A++        DQ++L+ +      D   RI N 
Sbjct: 1   MHGIGNDFVVLDGVSNFINVDSEIIRAIAHRQFGIGADQVLLVENPTHPEADFKYRIFNS 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPIL-- 125
           DGSEV++CGNG RC V+F+  +    R     E   G +    N D +++VDMG P    
Sbjct: 61  DGSEVENCGNGARCFVQFIHDKHLSGRNPIKAEIATGTIELYRNEDKTVTVDMGCPTFKA 120

Query: 126 -DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
            D        SF   ++ +    P+++  +    +VSM NPHA+  V D +Y   ++S G
Sbjct: 121 SDVGFDSEGISFKNENQAQVWALPLSNGSVIEISLVSMANPHAVQIVPD-VYTAPVSSQG 179

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+  HP F+  +N    ++ S   ++LR +ERG G T ACG+ ACA+VV+         
Sbjct: 180 PLIESHPYFANRINAGFMQIISENEINLRVYERGAGETFACGTGACAAVVSGIRRGLLKS 239

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            V V M GG + I + D   V M G A   +EG +DI
Sbjct: 240 PVKVNMRGGSIEISY-DGEAVIMRGPATTVFEGVIDI 275


>gi|229062608|ref|ZP_04199918.1| Diaminopimelate epimerase [Bacillus cereus AH603]
 gi|228716711|gb|EEL68407.1| Diaminopimelate epimerase [Bacillus cereus AH603]
          Length = 280

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 150/286 (52%), Gaps = 23/286 (8%)

Query: 11  MEGIGNKILVIDM-----RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           M G+GN  + ++M     R     I ++ ++ ++T      D ++LI     A V   +R
Sbjct: 1   MHGLGNSYIYVNMFEEQIREEDLAIVAEKVSNINTGIGA--DGMILICPSDVAPVK--MR 56

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGSISVD 119
           + N DGSE +SCGNG+RCV ++      ++ K FT ET+ GI+ A+    +++     +D
Sbjct: 57  MFNNDGSEGKSCGNGLRCVAKYAYEHKLVEGKVFTIETLAGIVTAEVTVEDDKVTLAKID 116

Query: 120 MGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           MG P L  + IP L        R+ F     NH +      VSMGNPHA+ FV DD+   
Sbjct: 117 MGAPRLTREEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEKA 171

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVA+  
Sbjct: 172 PLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGSGVTQACGTGACAAVVAAIL 231

Query: 239 LHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
             K    + ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 232 NGKMEHGKEITVHLAGGDLMIAWTEEGNVLMKGPAEIICRGVYEYK 277


>gi|312126876|ref|YP_003991750.1| diaminopimelate epimerase [Caldicellulosiruptor hydrothermalis 108]
 gi|311776895|gb|ADQ06381.1| diaminopimelate epimerase [Caldicellulosiruptor hydrothermalis 108]
          Length = 278

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 146/291 (50%), Gaps = 38/291 (13%)

Query: 8   FAKMEGIGNKILVIDMRG-------------CHDNITSDAINALSTDDNTHFDQIMLIHD 54
           F+KM G+GN  +VID RG             CH +I   A            D ++L+ +
Sbjct: 3   FSKMHGLGNDFIVIDARGKEDIDYNLLAKRMCHRHIGVGA------------DGLLLVLN 50

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL-----V 107
              A  D  +RIIN DGSE + CGNG+RC  +++  R  +K   F  ET+ GI+     V
Sbjct: 51  SDIA--DIRMRIINSDGSEAEMCGNGIRCFAKYVYERGIVKATKFKVETLAGIIEPELFV 108

Query: 108 AKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHA 167
            +      + V+MG+P    K IP+    +    +   +   N   + +   + MG PH 
Sbjct: 109 NEYGLVDKVKVNMGKPSFKRKDIPMQGDPESDAINTSIVVDGNEYRITS---LLMGVPHT 165

Query: 168 IFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           I FV DD+   D+ + G  + KH  F    N++  +V    ++ +RTWERG G T ACG+
Sbjct: 166 ILFV-DDVEKVDIYTLGPKIEKHEAFPRKTNVNFVQVIDKNNIKVRTWERGAGATFACGT 224

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
            +CASV+AS     T R  +V +  G L IEW ++  VFMTG A++ + G+
Sbjct: 225 GSCASVIASNLNGFTERKANVHLYFGILEIEWQEDGIVFMTGPAEEVFVGE 275


>gi|328554918|gb|AEB25410.1| diaminopimelate epimerase [Bacillus amyloliquefaciens TA208]
          Length = 284

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 144/277 (51%), Gaps = 19/277 (6%)

Query: 8   FAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           F KM G+GN  + ++    +   + +   A+   S       D ++LI   + A V   +
Sbjct: 6   FTKMHGLGNSYIYVNQFEEQLPEERLAEIAVKVSSVHTGIGSDGMILICPSEKAPVK--M 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI----SV 118
           RI N DGSE ++CGNG+RCV ++       +  SF  ET+ G++ A    D  I    +V
Sbjct: 64  RIFNNDGSEGKNCGNGLRCVAKYAYEHKLTEETSFFIETLSGLVKADITVDNGIVREVAV 123

Query: 119 DMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           DMGEP L  K +P L    ++   + F  G        +   VSMGNPH +F V D +  
Sbjct: 124 DMGEPRLTKKELPMLGNEEERTINETFVFGETE----LSGTAVSMGNPHIVFPVAD-ISQ 178

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS- 236
             L + G ++ K P F EG+N+      S + L  R WERG G+T ACG+ ACA+ VAS 
Sbjct: 179 APLTTLGPVIEKDPRFPEGINVEFVETVSADELHFRVWERGSGITQACGTGACAAAVASV 238

Query: 237 -GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
              + + NR ++V + GG L+I W DN HV MTG A+
Sbjct: 239 LNGVSERNREITVHLAGGDLVINWQDNGHVLMTGPAE 275


>gi|237809855|ref|YP_002894295.1| diaminopimelate epimerase [Tolumonas auensis DSM 9187]
 gi|259595064|sp|C4LDU8|DAPF_TOLAT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|237502116|gb|ACQ94709.1| diaminopimelate epimerase [Tolumonas auensis DSM 9187]
          Length = 276

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 140/283 (49%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD---NTHFDQIMLIHDFQDASVD 61
           ++ F+KM G+GN  +V+D  G    +  +A       D      FDQ++L+    D  +D
Sbjct: 2   LIQFSKMHGLGNDFVVVD--GVTQKVFFNAETLKRLGDRHFGIGFDQLLLVEPPYDPDLD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEVQ CGNG RC  RF  L     +      T+ G +V +   +  ++V+
Sbjct: 60  FHYRIFNADGSEVQQCGNGARCFARFVRLKGLTNKDRIAVSTVSGRIVLQLEDNDQVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P  +   IP    F  +  ++ ++  V    +    VVSMGNPH +  V   +    
Sbjct: 120 MGVPEFEPAKIP----FRALKAEKLYLLRVAEQTVMCG-VVSMGNPHCVIEVPS-VKDAP 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  L     F E +N+    V S   ++LR +ERG G T ACG+ ACA+VV     
Sbjct: 174 VETLGPKLESFDRFPERINVGFMEVVSASEINLRVYERGAGETLACGTGACAAVVVGIQQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            K    V V + GG L I W+   + V+MTG A+  ++G++++
Sbjct: 234 EKLKGRVKVNLPGGSLYISWNGPGSPVYMTGPAEHVFDGQIEL 276


>gi|228929965|ref|ZP_04092976.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228829645|gb|EEM75271.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 268

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    +G ++   +DMG P L    IP L        R+ F     NH +      
Sbjct: 86  IVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FV DD+    L + G +L  H MF E VN+    + + E ++ R WERG 
Sbjct: 142 VSMGNPHAVIFV-DDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVAS    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVASILNGKMERGKEITVHLAGGDLMIAWIEEGNVLMKGPAEVICHG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|258625071|ref|ZP_05719990.1| diaminopimelate epimerase [Vibrio mimicus VM603]
 gi|258582622|gb|EEW07452.1| diaminopimelate epimerase [Vibrio mimicus VM603]
          Length = 276

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 140/281 (49%), Gaps = 20/281 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCVTQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DGSEV+ CGNG RC  RF+  RMK    + +    T +G +V     +  I+V+MG
Sbjct: 64  IFNADGSEVEQCGNGARCFARFV--RMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI--GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F     ++ +I       LF      VSMGNPH +  V DD+    
Sbjct: 122 VPEFEPSKIP----FRAKQSEKTYILRAGEQTLFCG---AVSMGNPHVVTVV-DDIRTAA 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V      
Sbjct: 174 VETLGPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 234 GLLDEQVRVHLPGGELEISWKGPGKPLYMTGPATHAYDGQI 274


>gi|229193215|ref|ZP_04320166.1| Diaminopimelate epimerase [Bacillus cereus ATCC 10876]
 gi|228590192|gb|EEK48060.1| Diaminopimelate epimerase [Bacillus cereus ATCC 10876]
          Length = 280

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 145/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI----SVDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+   +  +     +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEAGVVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEKAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + + + ++ R WERG G+T ACG+ ACA+VVA+    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNDDEMNFRVWERGSGVTQACGTGACAAVVAAILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 277


>gi|212640228|ref|YP_002316748.1| diaminopimelate epimerase [Anoxybacillus flavithermus WK1]
 gi|212561708|gb|ACJ34763.1| Diaminopimelate epimerase [Anoxybacillus flavithermus WK1]
          Length = 289

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 147/282 (52%), Gaps = 29/282 (10%)

Query: 8   FAKMEGIGNKILVIDM-RGCHDNITSDAINALSTD-DNTHF----DQIMLIHDFQDASVD 61
           F KM G+GN  + ++M + C   +T + ++ ++    N H     D ++LI     A V 
Sbjct: 11  FTKMHGLGNSYIYVNMFKEC---LTEEELSYIAKRVSNVHTGIGSDGLILICPSDVAPVK 67

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK----ENRDGS 115
             +RI N DGSE ++CGNG+RCV ++      ++ + F  ET+ G++ A+    + +  S
Sbjct: 68  --MRIFNSDGSEGKNCGNGLRCVAKYAYEHGIVQEEQFLIETLSGLVEARVFVEDGKVNS 125

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVE 172
           + ++MG+P L    IP+    D +        P+    H +      VSMGNPHA+F+V 
Sbjct: 126 VEINMGKPRLSRVEIPMIGKEDDIVVSE----PIEFEGHTYYMTG--VSMGNPHAVFYV- 178

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
           D +    + S G ++ K   F EG+N+    V +   L  R WERG G+T ACG+ ACA+
Sbjct: 179 DQIEDAPVTSLGPIVEKDERFPEGINVEFVEVVNDHELHFRVWERGSGVTQACGTGACAA 238

Query: 233 VVASGCLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
           VVAS    KT  N    V + GG L I W +N  V M G A+
Sbjct: 239 VVASVLNGKTKRNEETVVHLAGGDLYITWKENGDVLMRGAAE 280


>gi|119896885|ref|YP_932098.1| diaminopimelate epimerase [Azoarcus sp. BH72]
 gi|166224239|sp|A1K306|DAPF_AZOSB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|119669298|emb|CAL93211.1| DapF protein [Azoarcus sp. BH72]
          Length = 277

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 136/288 (47%), Gaps = 24/288 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G+GN  +VID      ++T   + A++   + HF    DQ++++       VD
Sbjct: 3   IRFTKMHGLGNDFVVIDATRTPVDLTPARVKAIA---DRHFGVGCDQLLVVEPPGSDEVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC VRF+  +    ++    ET  G++      DG +SVD
Sbjct: 60  FRYRIFNADGGEVEQCGNGARCFVRFVHDKGLTDKREIRVETRAGVIAPALRPDGLVSVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV----VSMGNPHAIFFVEDDL 175
           MG P L    IP     D           V  L L    V    VSMGNPHA+  V D +
Sbjct: 120 MGVPELSPARIPFVSDSDAW---------VQPLQLAEDTVAITAVSMGNPHAVQVVAD-V 169

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               +A  G  +  HP F   VN    +V     + LR +ERG G T ACG+ ACA+VVA
Sbjct: 170 DTAPVARQGAEIECHPRFPARVNAGFMQVVDAGHIRLRVFERGAGETLACGTGACAAVVA 229

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
                     V V+  GG L I W      V MTG A   +EG+L++ 
Sbjct: 230 GIGRGLLVSPVRVETRGGELEIAWAGPGTPVVMTGPAVTVFEGELELP 277


>gi|189426372|ref|YP_001953549.1| diaminopimelate epimerase [Geobacter lovleyi SZ]
 gi|189422631|gb|ACD97029.1| Diaminopimelate epimerase [Geobacter lovleyi SZ]
          Length = 278

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 144/291 (49%), Gaps = 32/291 (10%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G GN  + +D  +   DN    AI   + +     D ++LI     A  D  +R+
Sbjct: 3   FTKMHGAGNDYVYVDCFKETVDNPAETAIKVSNRNFGIGSDGLILIMPTDKA--DVRMRM 60

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAK-----ENRDGSISVD 119
            N DGSE + CGNG+RCV ++      + +   T ET  GIL  +     EN+   + V+
Sbjct: 61  FNSDGSESEMCGNGIRCVAKYAYDHGIVTKTEITAETGAGILTLQLFPNAENKVERVRVN 120

Query: 120 MGEPILDWKLIPL---------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           MG P L  + IP+         A     +D+  F I             VSMGNPH I +
Sbjct: 121 MGPPRLSREEIPMNGTPAAQVVAEELTVLDKT-FKI-----------TCVSMGNPHCIIY 168

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V DD+ ++ +A++G L+  H +F    N+   ++ S   +  RTWERG G T ACG+ A 
Sbjct: 169 V-DDVDNFPVATYGPLIENHQLFPRRTNVEFIQIISRTEVKQRTWERGAGETLACGTGAS 227

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           A  VA    + T+R +   + GG L +EW +N  VFMTG A + + G++ +
Sbjct: 228 AVCVAGVLNNLTDRKILNHLAGGDLELEWVENGPVFMTGPATEVFSGEIAL 278


>gi|238916379|ref|YP_002929896.1| diaminopimelate epimerase [Eubacterium eligens ATCC 27750]
 gi|238871739|gb|ACR71449.1| diaminopimelate epimerase [Eubacterium eligens ATCC 27750]
          Length = 305

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 148/300 (49%), Gaps = 29/300 (9%)

Query: 8   FAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G GN  + +D  +   DN +  AI+          D ++LI +   A  D F+ +
Sbjct: 9   FTKMHGAGNDYIYVDCTQSVIDNPSQVAIDLSDRHFGIGSDGLILIKNSDKA--DFFMEM 66

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG--ILVAKENRDGSIS---VD 119
            N DGS+ Q CGNG+RCV +F+       + + T +T+ G  IL  K   DG +    V+
Sbjct: 67  YNADGSQGQMCGNGIRCVGKFVYDNGLTDKTTVTIDTLAGVKILELKTGADGKVETARVN 126

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV---------------VSMGN 164
           MG PIL+   IP+     K +     I  +    ++ P V               VSMGN
Sbjct: 127 MGAPILEAAQIPVDTKGLK-EYKGCEIETIAGKVVKTPVVDETIVVEGKEYKVTAVSMGN 185

Query: 165 PHAIFFVEDDL--YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLT 222
           PHAI +++ D+    +++   G     H  F E +N    +V    +L++R WERG G T
Sbjct: 186 PHAIVYLDKDIDIKKFEIEKIGPFFENHKAFPERINTEFIQVVDKNNLNMRVWERGSGET 245

Query: 223 AACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
            ACG+ ACAS+VA+      +   ++ +LGG L I W  D N V++ G AK  + G++DI
Sbjct: 246 LACGTGACASLVATVLNGMCDTTATLHLLGGDLKITWDKDENTVYLEGPAKTVFTGEVDI 305


>gi|152980602|ref|YP_001354891.1| diaminopimelate epimerase [Janthinobacterium sp. Marseille]
 gi|151280679|gb|ABR89089.1| diaminopimelate epimerase [Janthinobacterium sp. Marseille]
          Length = 276

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 142/281 (50%), Gaps = 15/281 (5%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G GN  +VID      N T      L+        DQ++++   Q A VD   RI N 
Sbjct: 1   MHGAGNDFVVIDAINQAINFTPAQWQYLADRRFGVGADQMLVVEKPQAAGVDFRYRIYNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG R  VRF+T +    +++   ET+ GI+  +   +G I+VDMG PIL+ 
Sbjct: 61  DGGEVEQCGNGARAFVRFVTDKKLTDKRAIKVETMSGIIEPRLEANGQITVDMGAPILNP 120

Query: 128 KLIPLARSFDKMD-----RDRFHIGPVNHLFLRNPF-VVSMGNPHAIFFVEDDLYHYDLA 181
           + +P    FD  D          + P++     N   VVSMGNPHA+  V D +    + 
Sbjct: 121 EDVP----FDTRDLLCKAEGEDTLWPLDIKGETNWISVVSMGNPHAVQVVAD-VEEAPVR 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  HP F + VN    ++     + LR +ERG G T ACG+ ACA+VVA      
Sbjct: 176 EDGVLIEHHPRFPKRVNAGFMQILDQHHIKLRVFERGAGETLACGTGACAAVVAGIRRGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V V+  GG L+I W   ++ V MTG A   +EG+++I
Sbjct: 236 LVSPVKVQTRGGELVIAWGGRDSPVMMTGPAVTVFEGEIEI 276


>gi|47566972|ref|ZP_00237689.1| diaminopimelate epimerase [Bacillus cereus G9241]
 gi|47556290|gb|EAL14624.1| diaminopimelate epimerase [Bacillus cereus G9241]
          Length = 239

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 124/228 (54%), Gaps = 14/228 (6%)

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS--- 117
           +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   
Sbjct: 14  MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAK 73

Query: 118 VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+ 
Sbjct: 74  IDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVE 128

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVAS
Sbjct: 129 QAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVAS 188

Query: 237 GCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
               K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 189 ILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 236


>gi|238750681|ref|ZP_04612180.1| Diaminopimelate epimerase [Yersinia rohdei ATCC 43380]
 gi|238711071|gb|EEQ03290.1| Diaminopimelate epimerase [Yersinia rohdei ATCC 43380]
          Length = 261

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 120/236 (50%), Gaps = 11/236 (4%)

Query: 46  FDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIR 103
           FDQ++++    D  +D   RI N DGSEV  CGNG RC  RF  L     ++  +  T  
Sbjct: 29  FDQMLVVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDISVSTQT 88

Query: 104 GILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHI-GPVNHLFLRNPFVVSM 162
           G ++   N D ++ V+MGEP  D + +P    F     ++ +I     H  L    VVSM
Sbjct: 89  GRMILSVNEDETVCVNMGEPNFDPQAVP----FRATKAEKTYIFRAAEHTVLCG--VVSM 142

Query: 163 GNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLT 222
           GNPH +  V DD+   ++A  G +L  H  F E  N+   +V S E + LR +ERG G T
Sbjct: 143 GNPHCVMQV-DDVSVANVALLGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGET 201

Query: 223 AACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
            ACGS ACA+V            V V++ GG L I W    H ++MTG A   ++G
Sbjct: 202 QACGSGACAAVAVGIQQELLGEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDG 257


>gi|253567072|ref|ZP_04844523.1| diaminopimelate epimerase [Bacteroides sp. 3_2_5]
 gi|251944196|gb|EES84705.1| diaminopimelate epimerase [Bacteroides sp. 3_2_5]
          Length = 269

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 145/288 (50%), Gaps = 35/288 (12%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++ +R         AI   +       D ++LI     A  D  +
Sbjct: 5   IQFTKMHGTGNDYIYVNTLRFPIARPEKAAIEWSAYHTGIGSDGLVLIGHSDKA--DFSM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE   CGN  RC+ ++L       +   T +T+ GI + + + +G    +++V
Sbjct: 63  RIFNADGSEAMMCGNASRCIGKYLYEYGLTSKNVITLDTLSGIKILELHLEGRTVETVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFV---VSMGNPHAIFFVEDDL 175
           DMG P L+   I     F                    PF+   VSMGNPH + FV DD+
Sbjct: 123 DMGVP-LETGTIDFDGEF--------------------PFLSTQVSMGNPHLVTFV-DDI 160

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              +L+  G  L KHP+F +  N+  A++    ++ +R WERG G+T ACG+ ACA+ VA
Sbjct: 161 RTVNLSEMGPKLEKHPLFPDRTNVEFAQIMGKNTIRMRVWERGSGITQACGTGACATAVA 220

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
           +    +T R V+V M GG L IEW +   H+ MTG A K ++G ++++
Sbjct: 221 AHLTGRTGRTVNVVMDGGTLTIEWDEATGHISMTGPAVKVFDGTIELR 268


>gi|291547161|emb|CBL20269.1| diaminopimelate epimerase [Ruminococcus sp. SR1/5]
          Length = 284

 Score =  142 bits (357), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 145/294 (49%), Gaps = 37/294 (12%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM GIGN  + ++   C +    D         + HF    D ++LI   + A  D  
Sbjct: 3   FTKMHGIGNDYVYVN---CFEETVKDPAAVAKFVSDRHFGIGSDGLILIRPSEIA--DCE 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DGS+   CGNG+RCV +++     + + S +  T  GI    L  ++ +   + 
Sbjct: 58  MDMYNLDGSQGAMCGNGIRCVAKYVYDHGIVDKTSLSIATRSGIKYVDLTIRDGKASMVK 117

Query: 118 VDMGEPILDWKLIPLARSFDKM-------DRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           V+MG PIL  K IP+    +++       D   +H+             VSMGNPHAI +
Sbjct: 118 VNMGSPILTAKEIPVVAETEQVIDAPITVDGKEYHM-----------TAVSMGNPHAIIY 166

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V DD+   DL   G     H  F + VN    +V    ++ +R WERG G T ACG+ AC
Sbjct: 167 V-DDVNSLDLEKIGPSFENHVCFPDRVNTEFVQVIDRHTVKMRVWERGSGETLACGTGAC 225

Query: 231 ASVVASGCLHKTN--RAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           A  VAS    K +  + V+V++LGG L I W  D N V+MTG A   ++G++D+
Sbjct: 226 AVTVASILNDKVDGSKPVTVQLLGGDLNISWERDENLVYMTGPATTVFDGEIDL 279


>gi|222098388|ref|YP_002532446.1| diaminopimelate epimerase [Bacillus cereus Q1]
 gi|221242447|gb|ACM15157.1| diaminopimelate epimerase [Bacillus cereus Q1]
          Length = 239

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 124/228 (54%), Gaps = 14/228 (6%)

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS--- 117
           +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   
Sbjct: 14  MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAK 73

Query: 118 VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           +DMG P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+ 
Sbjct: 74  IDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVE 128

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L + G +L  H MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVAS
Sbjct: 129 QAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVAS 188

Query: 237 GCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
               K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 189 ILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICHGVYEYK 236


>gi|253997887|ref|YP_003049950.1| diaminopimelate epimerase [Methylovorus sp. SIP3-4]
 gi|313199952|ref|YP_004038610.1| diaminopimelate epimerase [Methylovorus sp. MP688]
 gi|253984566|gb|ACT49423.1| diaminopimelate epimerase [Methylovorus sp. SIP3-4]
 gi|312439268|gb|ADQ83374.1| diaminopimelate epimerase [Methylovorus sp. MP688]
          Length = 277

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 142/283 (50%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           ++F KM+GIGN  +VID      ++T D I A+S   + HF    DQ++++         
Sbjct: 4   LEFTKMQGIGNDFVVIDAYSQPVSLTPDQIRAIS---DRHFGVGCDQLLIVEHATTPEAA 60

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC V+F+  +   +++    ET RG++  +   +G ++V+
Sbjct: 61  FRYRIFNADGGEVEQCGNGARCFVKFVHDQGLTQQREICVETARGLIYPRLEDNGEVTVN 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P      +P    F+       +   + H  +    + SMGNPHA+  V D++    
Sbjct: 121 MGPP----SFLPADLPFEAETIQSLYPLQLAHETVEV-AIASMGNPHAVQLV-DNVDTAP 174

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G  +  HP F + VN    ++     + LR +ERG G T ACG+ ACA+VV+   L
Sbjct: 175 VAEQGPQIESHPRFPKRVNAGFMQIVDPHHIRLRVFERGSGETLACGTGACAAVVSGIRL 234

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
                 V V   GG L I W   ++ V+MTG A   + G + +
Sbjct: 235 GHLVSPVRVSTRGGELNIAWTGGDSPVWMTGPAATVFTGAIHL 277


>gi|229525022|ref|ZP_04414427.1| diaminopimelate epimerase [Vibrio cholerae bv. albensis VL426]
 gi|229338603|gb|EEO03620.1| diaminopimelate epimerase [Vibrio cholerae bv. albensis VL426]
          Length = 276

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 141/279 (50%), Gaps = 16/279 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCITQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
             +   IP    F     ++ +I  V    LF      VSMGNPH +  V DD+    + 
Sbjct: 124 EFEPNKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVV-DDIRTAAVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V        
Sbjct: 176 TLGPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            +  V V + GG L I W   +  ++MTG A   ++G++
Sbjct: 236 LDEQVRVHLPGGELEIHWQGPSKPLYMTGPATHIYDGQI 274


>gi|134297259|ref|YP_001120994.1| diaminopimelate epimerase [Burkholderia vietnamiensis G4]
 gi|166224252|sp|A4JIQ6|DAPF_BURVG RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|134140416|gb|ABO56159.1| diaminopimelate epimerase [Burkholderia vietnamiensis G4]
          Length = 289

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 143/289 (49%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASV 60
           + F KM G GN  +V+D        +T   + AL+   + HF    DQ++++        
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSHTLPPLTDVQVRALA---DRHFGIGADQLLVVEKPTVDGA 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F+T R    ++S   + ++G++      +G + V
Sbjct: 60  DFKYRIFNCDGGEVEHCGNGARCFVKFVTDRGLTDKRSVRVQVMKGLITLTMQDNGEVVV 119

Query: 119 DMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+ +   +P  A   D        + P++     R    VSMGNPHA+  V DD  
Sbjct: 120 DMGAPVFEPAQVPFDASGLDGRTDGNDTLWPLDVGGATRWVSTVSMGNPHAVQVV-DDAE 178

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            Y + + G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A 
Sbjct: 179 AYPVLAEGPLIERHARFPKRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAG 238

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW---HDNNHVF-MTGEAKKEWEGKLDI 281
                 +  V+V   GG L I W   HD      M G A   +EG++++
Sbjct: 239 IRRGLLDTPVTVHTHGGTLTISWDGAHDERAALTMAGPATTVFEGEIEL 287


>gi|228975036|ref|ZP_04135595.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228784557|gb|EEM32577.1| Diaminopimelate epimerase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
          Length = 268

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 47  DQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG 104
           D ++LI     A V   +R+ N DGSE +SCGNG+RCV ++      ++   FT ET+ G
Sbjct: 28  DGMILICPSDVAPVK--MRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAG 85

Query: 105 ILVAKEN-RDGSIS---VDMGEPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFV 159
           I+ A+    DG ++   +DMG P L    IP L        R+ F     NH +      
Sbjct: 86  IVTAEVTVEDGFVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--A 141

Query: 160 VSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGV 219
           VSMGNPHA+ FVED +    L + G +L  H MF E VN+    + + E ++ R WERG 
Sbjct: 142 VSMGNPHAVIFVED-VEKAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWERGS 200

Query: 220 GLTAACGSAACASVVASGCLHKTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEG 277
           G+T ACG+ ACA+VVA+    K  R   ++V + GG L+I W +  +V M G A+    G
Sbjct: 201 GVTQACGTGACAAVVAAILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRG 260

Query: 278 KLDIK 282
             + K
Sbjct: 261 VYEYK 265


>gi|228903437|ref|ZP_04067564.1| Diaminopimelate epimerase [Bacillus thuringiensis IBL 4222]
 gi|228856212|gb|EEN00745.1| Diaminopimelate epimerase [Bacillus thuringiensis IBL 4222]
          Length = 280

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 146/284 (51%), Gaps = 19/284 (6%)

Query: 11  MEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           M G+GN  + ++M   +   +++   A    + +     D ++LI     A V   +R+ 
Sbjct: 1   MHGLGNSYIYVNMFEEQIPEEDLVLVAEKVSNINTGIGADGMILICPSDVAPVK--MRMF 58

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKEN-RDGSIS---VDMG 121
           N DGSE +SCGNG+RCV ++      ++   FT ET+ GI+ A+    +G ++   +DMG
Sbjct: 59  NNDGSEGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEEGKVTLAKIDMG 118

Query: 122 EPILDWKLIP-LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
            P L    IP L        R+ F     NH +      VSMGNPHA+ FV DD+    L
Sbjct: 119 APRLTRAEIPMLGEGETPFIRENFLYN--NHRYAFT--AVSMGNPHAVIFV-DDVEQAPL 173

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G +L  H MF E VN+    + +   ++ R WERG G+T ACG+ ACA+VVA+    
Sbjct: 174 TTLGPVLETHEMFPERVNVEFIEILNDAEMNFRVWERGSGVTQACGTGACAAVVAAILNG 233

Query: 241 KTNRA--VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           K  R   ++V + GG L+I W +  +V M G A+    G  + K
Sbjct: 234 KMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK 277


>gi|300714800|ref|YP_003739603.1| Diaminopimelate epimerase [Erwinia billingiae Eb661]
 gi|299060636|emb|CAX57743.1| Diaminopimelate epimerase [Erwinia billingiae Eb661]
          Length = 274

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 131/283 (46%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     +      T  G +V    +D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKNDIRVSTQTGRMVLSVTQDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF-------VVSMGNPHAIFFVEDDL 175
           P  D + +P            F      +L+L           VVSMGNPH +  V D +
Sbjct: 121 PNFDPQQVP------------FRANKAENLYLMRVAEQTIMCGVVSMGNPHCVLQV-DSV 167

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + S G +L  H  F E VN+    V S E + LR +ERG G T ACGS ACA+V  
Sbjct: 168 KTAAVESLGPVLESHDRFPERVNVGFMEVVSREHIRLRVYERGAGETQACGSGACAAVAV 227

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                     V V + GG L I W    H ++MTG A   ++G
Sbjct: 228 GIQQALLAEKVRVDLPGGSLNIAWKGPGHPLYMTGPATHVYDG 270


>gi|254483234|ref|ZP_05096466.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2148]
 gi|214036457|gb|EEB77132.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2148]
          Length = 276

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 141/290 (48%), Gaps = 28/290 (9%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G GN  +V+D+      +    I  L+        DQ++++       VD  
Sbjct: 2   LLKFTKMHGAGNDFIVVDLISQRCKLRPREIRKLADRRFGVGCDQVLIVEPPGSPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC  RF+       ++  + ET  GI+  +   +  + VDMG
Sbjct: 62  YRIFNADGGEVEQCGNGARCFARFVRDNKLTSKRIISVETACGIIQLRLRDNNQVEVDMG 121

Query: 122 EPILDWKLIPL-----ARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
            PIL+ + IP      A S+  +++ +   IG            +SMGNPH++  V DD+
Sbjct: 122 APILEPQKIPFDAPEEATSYPLQVEENVLEIG-----------ALSMGNPHSVCRV-DDV 169

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV- 234
              ++   G L+  HP F +  N    ++ S   + LR +ERGVG T ACG+ ACA+VV 
Sbjct: 170 DSINIEHLGPLIEHHPRFPQRTNAGFMQIVSETEIKLRVFERGVGETLACGTGACAAVVY 229

Query: 235 --ASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
             + G L  T   V+V + GG L I W      V MTG     +EG + I
Sbjct: 230 GLSRGWLRDT---VTVNLSGGKLSISWAGPGQPVIMTGPTASVFEGTIRI 276


>gi|221065121|ref|ZP_03541226.1| Diaminopimelate epimerase [Comamonas testosteroni KF-1]
 gi|220710144|gb|EED65512.1| Diaminopimelate epimerase [Comamonas testosteroni KF-1]
          Length = 296

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 143/293 (48%), Gaps = 22/293 (7%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM+G GN  +V+D       +++     L+   N HF    DQI+ +       VD
Sbjct: 7   IRFTKMQGAGNDFVVLDETQARLGLSAAQYRYLA---NRHFGVGADQILTVRPAPSEGVD 63

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG EV+ CGNG RC  R++  R    +     +T+ G++  + + +G ++VD
Sbjct: 64  FEYVIHNADGGEVEQCGNGARCFARYVHDRGLTDKSVIRVQTLSGVIAPEIHANGRVTVD 123

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF--------VVSMGNPHAIFFV 171
           MG P LD   +P   S + +  +         L L  P          VSMGNPHA+  V
Sbjct: 124 MGAPQLDPVKVPF--STEGLQAETLGSAQKWPLTLDTPVQPATVWIAPVSMGNPHAVQLV 181

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
            DD+    +   G L+  H  F + VN    ++ +   ++LR +ERG G T ACG+ ACA
Sbjct: 182 -DDVNAAAVEVHGPLIESHVRFPQRVNAGFMQIVNRGEVNLRVYERGAGETLACGTGACA 240

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           +VVA       ++ V V   GG L IEW     + V MTG A+  +EG++DI 
Sbjct: 241 AVVAGIGWGLLDQRVDVHTRGGLLTIEWAGAAQDRVRMTGPAEFVFEGQIDIP 293


>gi|307728184|ref|YP_003905408.1| diaminopimelate epimerase [Burkholderia sp. CCGE1003]
 gi|307582719|gb|ADN56117.1| diaminopimelate epimerase [Burkholderia sp. CCGE1003]
          Length = 287

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 146/287 (50%), Gaps = 15/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  +V+D      N++   + AL+   + HF    DQ++L+       VD
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLSPAQVRALA---DRHFGVGADQLLLVEKPTVEGVD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVD 119
              RI NCDG EV+ CGNG RC V+F+  +    ++S   +  +G +      +G + VD
Sbjct: 60  FRYRIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKGTITLTMQENGEVLVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRF-HIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P+ + + +P A    +  R+    + P++ +   R   VVSMGNPHA+  V DD+  
Sbjct: 120 MGAPVFEPERVPFATKGIQGRREGADTLWPLDVNGTTRWISVVSMGNPHAVQVV-DDVEA 178

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A  
Sbjct: 179 FPVLVEGPVIERHARFPQRVNAGFMQIVGRSEIKLRVYERGAGETLACGTGACAAVAAGI 238

Query: 238 CLHKTNRAVSVKMLGGGLLIEW---HDNNHVFMTGEAKKEWEGKLDI 281
                +  V V   GG L I W    ++  + M G A   ++G++++
Sbjct: 239 RRGLLDSPVLVHTHGGKLTISWDSSQESEPLLMAGPATTVFQGEIEL 285


>gi|153822333|ref|ZP_01975000.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|153826286|ref|ZP_01978953.1| diaminopimelate epimerase [Vibrio cholerae MZO-2]
 gi|227080362|ref|YP_002808913.1| diaminopimelate epimerase [Vibrio cholerae M66-2]
 gi|254291935|ref|ZP_04962716.1| diaminopimelate epimerase [Vibrio cholerae AM-19226]
 gi|254851510|ref|ZP_05240860.1| diaminopimelate epimerase [Vibrio cholerae MO10]
 gi|298501106|ref|ZP_07010906.1| diaminopimelate epimerase [Vibrio cholerae MAK 757]
 gi|9654526|gb|AAF93303.1| diaminopimelate epimerase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|126520159|gb|EAZ77382.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|149739954|gb|EDM54133.1| diaminopimelate epimerase [Vibrio cholerae MZO-2]
 gi|150422145|gb|EDN14111.1| diaminopimelate epimerase [Vibrio cholerae AM-19226]
 gi|227008250|gb|ACP04462.1| diaminopimelate epimerase [Vibrio cholerae M66-2]
 gi|227011872|gb|ACP08082.1| diaminopimelate epimerase [Vibrio cholerae O395]
 gi|254847215|gb|EET25629.1| diaminopimelate epimerase [Vibrio cholerae MO10]
 gi|297540140|gb|EFH76201.1| diaminopimelate epimerase [Vibrio cholerae MAK 757]
          Length = 290

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 139/285 (48%), Gaps = 14/285 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           + S    F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  
Sbjct: 12  LSSMHFHFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPE 71

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSIS 117
            D   RI N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+
Sbjct: 72  SDFHYRIFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLIT 131

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDL 175
           V+MG P  +   IP    F     ++ +I  V    LF      VSMGNPH +  V DD+
Sbjct: 132 VNMGVPEFEPNKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVV-DDI 183

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V  
Sbjct: 184 RTAAVETLGPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAV 243

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
                  +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 244 GILQGLLDEQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 288


>gi|218459115|ref|ZP_03499206.1| diaminopimelate epimerase [Rhizobium etli Kim 5]
          Length = 124

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 91/123 (73%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           S+ V+FA+M G+GNKILV+DMRG  D +T+ A  AL+ D  T FDQIM IHD +    DA
Sbjct: 2   STTVEFARMNGLGNKILVVDMRGRPDKVTAAAAVALNADPETAFDQIMAIHDPKADGTDA 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           FI I+N DGS+ Q+CGNG RCVV+ L +   RK+FTF+T+ GIL A E+ DG+ISVDMG+
Sbjct: 62  FIDILNSDGSKAQACGNGTRCVVQALAAETGRKAFTFQTVAGILNAVEHEDGTISVDMGK 121

Query: 123 PIL 125
           P+ 
Sbjct: 122 PVF 124


>gi|237747588|ref|ZP_04578068.1| diaminopimelate epimerase [Oxalobacter formigenes OXCC13]
 gi|229378950|gb|EEO29041.1| diaminopimelate epimerase [Oxalobacter formigenes OXCC13]
          Length = 287

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 139/288 (48%), Gaps = 15/288 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V++      N+T +    L+        DQI+L+    +  VD   
Sbjct: 3   LKFTKMHGAGNDFIVLNAIDQVINLTREQYRFLADRRYGIGADQILLVEKPDNPEVDFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG R   +F+T     ++     ET  GI+     +DGS++VDMG 
Sbjct: 63  RIFNSDGGEVEQCGNGARAFAKFVTESGLSRQNPIKVETRVGIIELHLEKDGSVTVDMGN 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRN-------PF-VVSMGNPHAIFFVEDD 174
           P+ +   IP       +  D      + +L L         P  VVSMGNPHA+  V DD
Sbjct: 123 PVFETSRIPFLTK--GLTSDEIGSDTIWNLILDTGGIKKSIPISVVSMGNPHAVQIV-DD 179

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    +A  G L+  H  F E VN     +    S+ LR +ERG   T ACG+ ACA+VV
Sbjct: 180 VNRAAVAEEGPLIENHERFPERVNAGFMEIQDRHSIKLRVYERGAAETLACGTGACAAVV 239

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +       +  V+VK  GG L I W    H V M+G A   + G++++
Sbjct: 240 SGIRRKLLDSPVTVKARGGELKIAWEGEGHNVIMSGPAIIVFNGEINL 287


>gi|225023710|ref|ZP_03712902.1| hypothetical protein EIKCOROL_00574 [Eikenella corrodens ATCC
           23834]
 gi|224943592|gb|EEG24801.1| hypothetical protein EIKCOROL_00574 [Eikenella corrodens ATCC
           23834]
          Length = 282

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 149/282 (52%), Gaps = 9/282 (3%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
           +++ F KM G+GN  +VID    H +  +  I   +       FDQ++L+        + 
Sbjct: 2   AVLKFTKMHGLGNDFMVIDGISQHFDPAAAPIAEWADRHRGIGFDQLLLVEVPPLPEAEF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC  RF+  +   + +     T +G++V     +G ++VDM
Sbjct: 62  GYRIFNADGSEVEQCGNGARCFARFVHEKGLSRNRRIRVATAKGLIVLNLQENGLVTVDM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEP L    IP + +  +     +H   ++    R    V+MGNPHA+  V DD++   +
Sbjct: 122 GEPRLAAADIPFSPAPGEAADALWHEIGLDGASARFS-CVNMGNPHAVLVV-DDVHCAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA---SG 237
           A +G  L +HP F E VN+   +V     + LR +ERG G T ACG+ ACA+ VA   +G
Sbjct: 180 AEWGARLERHPQFPERVNVGFLQVLDTHHIRLRVFERGTGETQACGTGACAAAVAGMRAG 239

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L +   AV V + GG L IEW  +NHV M+G A   +EG +
Sbjct: 240 LLARQG-AVCVSLPGGDLQIEWAADNHVLMSGSAATVFEGTV 280


>gi|121587735|ref|ZP_01677496.1| diaminopimelate epimerase [Vibrio cholerae 2740-80]
 gi|121728312|ref|ZP_01681343.1| diaminopimelate epimerase [Vibrio cholerae V52]
 gi|147673333|ref|YP_001218293.1| diaminopimelate epimerase [Vibrio cholerae O395]
 gi|153214851|ref|ZP_01949659.1| diaminopimelate epimerase [Vibrio cholerae 1587]
 gi|153803077|ref|ZP_01957663.1| diaminopimelate epimerase [Vibrio cholerae MZO-3]
 gi|153818937|ref|ZP_01971604.1| diaminopimelate epimerase [Vibrio cholerae NCTC 8457]
 gi|153830024|ref|ZP_01982691.1| diaminopimelate epimerase [Vibrio cholerae 623-39]
 gi|161582035|ref|NP_229784.2| diaminopimelate epimerase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|229508404|ref|ZP_04397908.1| diaminopimelate epimerase [Vibrio cholerae BX 330286]
 gi|229508915|ref|ZP_04398405.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|229515839|ref|ZP_04405297.1| diaminopimelate epimerase [Vibrio cholerae TMA 21]
 gi|229517029|ref|ZP_04406475.1| diaminopimelate epimerase [Vibrio cholerae RC9]
 gi|229520082|ref|ZP_04409510.1| diaminopimelate epimerase [Vibrio cholerae TM 11079-80]
 gi|229606677|ref|YP_002877325.1| diaminopimelate epimerase [Vibrio cholerae MJ-1236]
 gi|255743921|ref|ZP_05417876.1| diaminopimelate epimerase [Vibrio cholera CIRS 101]
 gi|262151160|ref|ZP_06028299.1| diaminopimelate epimerase [Vibrio cholerae INDRE 91/1]
 gi|262167029|ref|ZP_06034746.1| diaminopimelate epimerase [Vibrio cholerae RC27]
 gi|262190132|ref|ZP_06048418.1| diaminopimelate epimerase [Vibrio cholerae CT 5369-93]
 gi|21362496|sp|Q9KVL6|DAPF_VIBCH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|172047519|sp|A5F4I6|DAPF_VIBC3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|121548034|gb|EAX58112.1| diaminopimelate epimerase [Vibrio cholerae 2740-80]
 gi|121629442|gb|EAX61871.1| diaminopimelate epimerase [Vibrio cholerae V52]
 gi|124115094|gb|EAY33914.1| diaminopimelate epimerase [Vibrio cholerae 1587]
 gi|124121396|gb|EAY40139.1| diaminopimelate epimerase [Vibrio cholerae MZO-3]
 gi|126510499|gb|EAZ73093.1| diaminopimelate epimerase [Vibrio cholerae NCTC 8457]
 gi|146315216|gb|ABQ19755.1| diaminopimelate epimerase [Vibrio cholerae O395]
 gi|148874509|gb|EDL72644.1| diaminopimelate epimerase [Vibrio cholerae 623-39]
 gi|229342870|gb|EEO07860.1| diaminopimelate epimerase [Vibrio cholerae TM 11079-80]
 gi|229346092|gb|EEO11064.1| diaminopimelate epimerase [Vibrio cholerae RC9]
 gi|229347102|gb|EEO12063.1| diaminopimelate epimerase [Vibrio cholerae TMA 21]
 gi|229354032|gb|EEO18965.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|229354677|gb|EEO19599.1| diaminopimelate epimerase [Vibrio cholerae BX 330286]
 gi|229369332|gb|ACQ59755.1| diaminopimelate epimerase [Vibrio cholerae MJ-1236]
 gi|255738404|gb|EET93794.1| diaminopimelate epimerase [Vibrio cholera CIRS 101]
 gi|262024547|gb|EEY43231.1| diaminopimelate epimerase [Vibrio cholerae RC27]
 gi|262031054|gb|EEY49679.1| diaminopimelate epimerase [Vibrio cholerae INDRE 91/1]
 gi|262033986|gb|EEY52440.1| diaminopimelate epimerase [Vibrio cholerae CT 5369-93]
          Length = 276

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 140/279 (50%), Gaps = 16/279 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCITQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
             +   IP    F     ++ +I  V    LF      VSMGNPH +  V DD+    + 
Sbjct: 124 EFEPNKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVV-DDIRTAAVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V        
Sbjct: 176 TLGPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 236 LDEQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 274


>gi|229527132|ref|ZP_04416526.1| diaminopimelate epimerase [Vibrio cholerae 12129(1)]
 gi|229335363|gb|EEO00846.1| diaminopimelate epimerase [Vibrio cholerae 12129(1)]
 gi|327483027|gb|AEA77434.1| Diaminopimelate epimerase [Vibrio cholerae LMA3894-4]
          Length = 276

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 140/279 (50%), Gaps = 16/279 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCITQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNH--LFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
             +   IP    F     ++ +I  V    LF      VSMGNPH +  V DD+    + 
Sbjct: 124 EFEPNKIP----FRAKQSEKTYILRVGEHTLFCG---AVSMGNPHVVTVV-DDIRTAAVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V        
Sbjct: 176 TLGPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 236 LDEQVCVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 274


>gi|227888606|ref|ZP_04006411.1| diaminopimelate epimerase [Escherichia coli 83972]
 gi|300985707|ref|ZP_07177562.1| diaminopimelate epimerase [Escherichia coli MS 45-1]
 gi|301047309|ref|ZP_07194395.1| diaminopimelate epimerase [Escherichia coli MS 185-1]
 gi|26110979|gb|AAN83163.1|AE016769_278 Diaminopimelate epimerase [Escherichia coli CFT073]
 gi|227834445|gb|EEJ44911.1| diaminopimelate epimerase [Escherichia coli 83972]
 gi|300300828|gb|EFJ57213.1| diaminopimelate epimerase [Escherichia coli MS 185-1]
 gi|300407981|gb|EFJ91519.1| diaminopimelate epimerase [Escherichia coli MS 45-1]
 gi|315293148|gb|EFU52500.1| diaminopimelate epimerase [Escherichia coli MS 153-1]
          Length = 275

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPDLIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF  L     ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P     +K+++          +      VVSMGNPH +  V DD+    + 
Sbjct: 121 EPNFEPSAVPF--RANKVEKTYIMRAAEQTILCG---VVSMGNPHCVIQV-DDVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
               V V++ GG L I W    H ++MTG A   ++G
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDG 271


>gi|225575185|ref|ZP_03783795.1| hypothetical protein RUMHYD_03274 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037593|gb|EEG47839.1| hypothetical protein RUMHYD_03274 [Blautia hydrogenotrophica DSM
           10507]
          Length = 278

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 141/285 (49%), Gaps = 21/285 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM GIGN  + ++   C      +         + HF    D ++LI   Q A  D  
Sbjct: 3   FTKMHGIGNDYVYVN---CFQEKVDNPSEVAKFVSDRHFGVGSDGLILIKPSQIA--DCE 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DGS+   CGNG+RCV +++     + + +    T  GI    L  +  +   + 
Sbjct: 58  MDMYNLDGSQGAMCGNGIRCVAKYVYDYGIVPKTTLRIATKSGIKELNLTVENGKVSLVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG PIL+   IP+     +       +    + F      VSMGNPHA+ ++ DD+ +
Sbjct: 118 VNMGSPILEASKIPVVSDQSQAVNQPIKVNGHTYYFTG----VSMGNPHAVVYL-DDVDN 172

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+   G    KHP+F + VN    +V   ++L +R WERG G T ACG+ ACA  V+S 
Sbjct: 173 LDIEKIGPAFEKHPVFPDRVNTEFVKVIDRKTLKMRVWERGSGETLACGTGACAVAVSSI 232

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
             + T   V+VK+LGG L I W    N V+MTG A   ++G++ +
Sbjct: 233 LNNLTGEEVTVKLLGGDLKIHWDRLENLVYMTGPATTVFDGEITL 277


>gi|172062034|ref|YP_001809686.1| diaminopimelate epimerase [Burkholderia ambifaria MC40-6]
 gi|171994551|gb|ACB65470.1| Diaminopimelate epimerase [Burkholderia ambifaria MC40-6]
          Length = 282

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 140/284 (49%), Gaps = 17/284 (5%)

Query: 11  MEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAFIR 65
           M G GN  +V+D        +T   + AL+   N HF    DQ++L+        D   R
Sbjct: 1   MHGAGNDFVVLDGYSRALPPLTEAQVRALA---NRHFGIGADQLLLVEKPTVDGADFKYR 57

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG P
Sbjct: 58  IFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMGAP 117

Query: 124 ILDWKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +     +P  A   D     R  + P++     R    VSMGNPHA+  V DD+  Y + 
Sbjct: 118 VFAPAQVPFDASGLDGRAEGRDTLWPLDVGGATRWISAVSMGNPHAVQVV-DDVEAYPVL 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A      
Sbjct: 177 EEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
            +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 237 LDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPAATVFEGEIDL 280


>gi|297581833|ref|ZP_06943754.1| diaminopimelate epimerase [Vibrio cholerae RC385]
 gi|297533927|gb|EFH72767.1| diaminopimelate epimerase [Vibrio cholerae RC385]
          Length = 290

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 135/283 (47%), Gaps = 10/283 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           + S    F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  
Sbjct: 12  LSSMHFHFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPE 71

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSIS 117
            D   RI N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+
Sbjct: 72  SDFHYRIFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLIT 131

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P  +   IP      K     + +    H        VSMGNPH +  V DD+  
Sbjct: 132 VNMGVPEFEPNKIPFRA---KQSEKTYILRAGEHTLFCG--AVSMGNPHVVTVV-DDIRT 185

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             + + G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V    
Sbjct: 186 AAVETLGPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGI 245

Query: 238 CLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
                +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 246 LQGLLDEQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 288


>gi|239828210|ref|YP_002950834.1| diaminopimelate epimerase [Geobacillus sp. WCH70]
 gi|259595057|sp|C5D729|DAPF_GEOSW RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|239808503|gb|ACS25568.1| diaminopimelate epimerase [Geobacillus sp. WCH70]
          Length = 284

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 153/279 (54%), Gaps = 23/279 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS---TDDNTHF--DQIMLIHDFQDASVDA 62
           F KM G+GN  + ++M    + I    +++L+   ++ NT    D ++LI   + A V  
Sbjct: 6   FTKMHGLGNSYIYVNM--FEETIPESLLSSLAVKVSNVNTGIGADGMILICPSEVAPVK- 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SI 116
            +RI N DGSE ++CGNG+RCV ++      +K +SF  ET+ G++ A+   +     ++
Sbjct: 63  -MRIFNSDGSEGKNCGNGLRCVAKYAYEHGMVKDRSFFIETLSGLVKAEVTVENGAVTNV 121

Query: 117 SVDMGEPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           ++DMG+P L    IP+     +++  + F +    +        VSMGNPH IF+V DD+
Sbjct: 122 TIDMGKPRLKRSEIPMIGLDAERVVAEPFEVDGKQYEIT----AVSMGNPHVIFYV-DDI 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G ++ K   F EGVN+    V +   L  R WERG G+T ACG+ ACA+VVA
Sbjct: 177 TTAPVTTLGPIVEKDERFPEGVNVEFVEVVNDHELHFRVWERGSGVTQACGTGACAAVVA 236

Query: 236 SGCLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAK 272
           S    KT  N+   V + GG L+I W D  +V MTG A+
Sbjct: 237 SVLNGKTARNKETVVHLAGGDLIITWTDEGNVRMTGPAE 275


>gi|326796186|ref|YP_004314006.1| diaminopimelate epimerase [Marinomonas mediterranea MMB-1]
 gi|326546950|gb|ADZ92170.1| Diaminopimelate epimerase [Marinomonas mediterranea MMB-1]
          Length = 278

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/279 (31%), Positives = 139/279 (49%), Gaps = 8/279 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F+KM G+GN   V+D          + I  L   +    FDQ++++       +D  
Sbjct: 2   LLKFSKMHGLGNDFAVVDAVSRKVYFNKEQIEFLGDRNRGIGFDQLLIVEPPTSPDMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N +GSEV+ CGNG RC  +F+  +    +     ET +G +      DG ++VDMG
Sbjct: 62  YRIYNSNGSEVEHCGNGARCFAKFVIEKDLTNKSVINVETKQGQIQLHVQDDGEVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      +P   +  + D    ++     + L     VS+GNPHA+  V D L    ++
Sbjct: 122 APSFAPADLPFDATEKQDDLYTLNLEGYGSVELTP---VSVGNPHAVIRV-DRLTDEIVS 177

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G L+  H  F   VN+    V S + ++LR +ER VG T ACG+  CA++VA      
Sbjct: 178 TVGPLVESHSAFPANVNVGFMEVMSRDEVNLRVYERDVGETQACGTGTCAAIVAGIRQGW 237

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            N  V+  +LGG L IEW  + + + MTG A K +EG++
Sbjct: 238 LNSKVTAHLLGGDLRIEWQGEGSPIMMTGPATKVFEGQI 276


>gi|317473618|ref|ZP_07932907.1| diaminopimelate epimerase [Anaerostipes sp. 3_2_56FAA]
 gi|316898908|gb|EFV20933.1| diaminopimelate epimerase [Anaerostipes sp. 3_2_56FAA]
          Length = 278

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 143/287 (49%), Gaps = 24/287 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  + ++   C +    +         + HF    D ++ IH    A  D  
Sbjct: 3   FTKMHGCGNDYVYVN---CFEETIENPNETAKFVSDRHFGIGSDGMICIHPSDKA--DFR 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           + + N DG+E   CGNG+RC+ +++       + + T ET  GI    L  ++ +   ++
Sbjct: 58  MAMYNSDGTEGAMCGNGVRCIAKYVYDYGLTDKTTITIETKGGIKELDLTVEDGKVTWVN 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE--DDL 175
           VDM  P+L+   IP+    +K   D+  I       +     VSMGNPH + FV+  DDL
Sbjct: 118 VDMEAPVLEADKIPVIYDEEKKVIDKPVIVDGREYRIT---CVSMGNPHGVVFVDSVDDL 174

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              D+   G +   HPMF + VN    +V    ++ +R WERG G T ACG+ ACAS  A
Sbjct: 175 ---DIEKLGPMFEHHPMFPDRVNTEFIQVVDDHTIRMRVWERGAGETLACGTGACASAYA 231

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           S    KT   V V +LGG L IE+ +  H +FM G A K ++G++D+
Sbjct: 232 SYLNQKTGNKVLVHLLGGDLQIEYDEEKHTIFMKGPATKVFDGEIDL 278


>gi|262172885|ref|ZP_06040563.1| diaminopimelate epimerase [Vibrio mimicus MB-451]
 gi|261893961|gb|EEY39947.1| diaminopimelate epimerase [Vibrio mimicus MB-451]
          Length = 276

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 140/281 (49%), Gaps = 20/281 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDASVDAFIR 65
           F+KM G+GN  +V+D    +   + + I  L+ D +T   FDQ++++    D   D   R
Sbjct: 5   FSKMHGLGNDFMVVDCVTQNVFFSPELIRRLA-DRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMG 121
           I N DGSEV+ CGNG RC  RF+  RMK    + +    T +G +V     +  I+V+MG
Sbjct: 64  IFNADGSEVEQCGNGARCFARFV--RMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHI--GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P  +   IP    F     ++ +I       LF      VSMGNPH +  V DD+    
Sbjct: 122 VPEFEPSKIP----FRAKQSEKTYILRAGEQTLFCG---AVSMGNPHVVTVV-DDIRTAA 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V      
Sbjct: 174 VETLGPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQ 233

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 234 GLLDEQVRVHLPGGELEISWKGPGKALYMTGPATHVYDGQI 274


>gi|220931996|ref|YP_002508904.1| Diaminopimelate epimerase [Halothermothrix orenii H 168]
 gi|254767107|sp|B8CX90|DAPF_HALOH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219993306|gb|ACL69909.1| Diaminopimelate epimerase [Halothermothrix orenii H 168]
          Length = 284

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 149/289 (51%), Gaps = 17/289 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVD 61
           + F KM G GN  ++++     D   S     L      HF    D ++++   +    D
Sbjct: 3   LSFTKMHGTGNDFIMVNGSNYPDLDFSKLARQLC---RRHFSIGADGLIIVLPPESVEHD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGIL---VAKENRDGS- 115
             +RI N DGSE + CGNG+RC   +L   +   R     ET+ GI+   +   N D S 
Sbjct: 60  FRMRIFNADGSEAEMCGNGIRCFAHYLRENNLTTRDVLKIETLAGIITPEIVSYNGDKSL 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I V+MG P    + IP+    D++D  +     + +  L N   VSMGNPH I FVED +
Sbjct: 120 IKVNMGRPHFKSEEIPVNIE-DELDYVKNFPLKIGNKKL-NINCVSMGNPHTIIFVED-V 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               ++++G  +  +P+F +  N+   ++ S + + +R WERG G+T ACG+ ACASVVA
Sbjct: 177 NQIPVSTWGQEIEHNPLFPQKTNVEFIQIQSEDEIIMRVWERGSGITLACGTGACASVVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
                     V+V + GG L IEW + + VFMTG A+  + GK+ I+ G
Sbjct: 237 GIKNGLLKNMVTVHLPGGDLNIEWQEQD-VFMTGPAESVYTGKIVIQEG 284


>gi|153953828|ref|YP_001394593.1| diaminopimelate epimerase [Clostridium kluyveri DSM 555]
 gi|219854444|ref|YP_002471566.1| hypothetical protein CKR_1101 [Clostridium kluyveri NBRC 12016]
 gi|146346709|gb|EDK33245.1| DapF [Clostridium kluyveri DSM 555]
 gi|219568168|dbj|BAH06152.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 274

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 148/284 (52%), Gaps = 22/284 (7%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G GN  +VID R   +              N HF    D ++++ +   AS+   
Sbjct: 3   FTKMHGTGNDFIVIDDR--ENRFLGKEEELALRLCNRHFGIGADGVLIVRNSDIASIK-- 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGI----LVAKENRDGSIS 117
           + IIN DGS    CGNG+RC  +++   + +K K    ET  GI    +  K  +   I+
Sbjct: 59  MVIINSDGSYASMCGNGIRCFAKYIWEENLVKDKILKIETGDGIKEAVVTIKNGKAEEIT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           +DMG P    + +P+    + ++++   I   N++       + MG PH + F    L  
Sbjct: 119 IDMGMPSFAPRKVPVEFKEEVIEKE-VKIKNKNYIIT----TLFMGVPHTVIF--GKLED 171

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           YD+A  G  + K+P+F++G N++   + + + + ++TWERG G T ACG+ +CA VVA+ 
Sbjct: 172 YDVAE-GEYIEKYPVFTQGTNVNFCEIVNEKEVKVKTWERGAGPTLACGTGSCACVVAAN 230

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            +  T + V V + GG LL+E  D+N VFMTG A   ++G+ DI
Sbjct: 231 KIGLTGKEVKVSVPGGILLVEIKDDNSVFMTGPAAISFKGEYDI 274


>gi|323705514|ref|ZP_08117089.1| diaminopimelate epimerase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535416|gb|EGB25192.1| diaminopimelate epimerase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 277

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 148/286 (51%), Gaps = 24/286 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHF----DQIMLIHDFQDASVDAF 63
           F KM G+GN  +V++    +  +  D +     D   HF    D ++++        D  
Sbjct: 3   FTKMTGLGNDFIVLENLE-NKELEYDVLARKLCD--RHFGIGGDGLLIVE--PSGIADIK 57

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGI----LVAKENRDGSIS 117
           +RIIN DGSE + CGNG RC  +++     + +   + ET+ GI    L+ + +    + 
Sbjct: 58  MRIINSDGSEAEMCGNGARCFAKYVYENGIVSKGKMSVETLSGIVMPELIFENDNVDKVR 117

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSM--GNPHAIFFVEDDL 175
           V MG PI    LIP+     K D+++F I     +  R   V S+  G PH + FV D +
Sbjct: 118 VYMGNPIFRPDLIPV-----KTDKNQF-IEETIKIDGRAYTVTSLLIGVPHTVIFV-DSI 170

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G L+ K  +F  G N+   +V    ++ +RTWERG GLT ACG+ ACAS VA
Sbjct: 171 DENMIVNVGPLIEKLHIFPRGTNVDFVKVEDKNNITVRTWERGAGLTLACGTGACASAVA 230

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           S    +T R V V    G L IEW  +N++++TG+A+K + G +DI
Sbjct: 231 SALTDRTKRDVYVHFKRGDLYIEWTSDNNIYLTGKAEKVFTGDIDI 276


>gi|310766132|gb|ADP11082.1| diaminopimelate epimerase [Erwinia sp. Ejp617]
          Length = 282

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 131/283 (46%), Gaps = 24/283 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 9   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  L     +      T  G ++    +D  + V+MGE
Sbjct: 69  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKSEIRVSTQSGRMILSVTQDERVCVNMGE 128

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPF-------VVSMGNPHAIFFVEDDL 175
           P  + + IP            F      +++L           VVSMGNPH +  V D++
Sbjct: 129 PNFEPQQIP------------FRANKAENIYLMRAVEQTVMCGVVSMGNPHCVLQV-DNV 175

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               + + G +L  H  F E VN+    V   E + LR +ERG G T ACGS ACA+V  
Sbjct: 176 KTAAVETLGPVLESHERFPERVNVGFMEVVHREHIRLRVYERGAGETQACGSGACAAVAV 235

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
                     V V + GG L I W    H +FMTG A   ++G
Sbjct: 236 GIQQALLAEKVRVDLPGGSLNIAWKGPGHPLFMTGPATHVYDG 278


>gi|262163684|ref|ZP_06031425.1| diaminopimelate epimerase [Vibrio mimicus VM223]
 gi|262027900|gb|EEY46564.1| diaminopimelate epimerase [Vibrio mimicus VM223]
          Length = 290

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 137/280 (48%), Gaps = 18/280 (6%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   RI
Sbjct: 19  FSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYRI 78

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVDMGE 122
            N DGSEV+ CGNG RC  RF+  RMK    + +    T +G +V     +  I+V+MG 
Sbjct: 79  FNADGSEVEQCGNGARCFARFV--RMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMGV 136

Query: 123 PILDWKLIPLARSFDKMDRDRFHI--GPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P  +   IP    F     ++ +I       LF      VSMGNPH +  V DD+    +
Sbjct: 137 PEFEPSKIP----FRAKQSEKTYILRAGEQTLFCG---AVSMGNPHVVTVV-DDIRAAAV 188

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V       
Sbjct: 189 ETLGPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQG 248

Query: 241 KTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
             +  V V + GG L I W      ++MTG A   ++G++
Sbjct: 249 LLDEQVRVHLPGGELEISWKGPGKPLYMTGPATHVYDGQI 288


>gi|269964930|ref|ZP_06179100.1| diaminopimelate epimerase [Vibrio alginolyticus 40B]
 gi|269830406|gb|EEZ84630.1| diaminopimelate epimerase [Vibrio alginolyticus 40B]
          Length = 276

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 138/278 (49%), Gaps = 14/278 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   RI
Sbjct: 5   FSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            N DGSEV+ CGNG RC  RF  L     + S +  T +G ++     DG ++V+MG P 
Sbjct: 65  FNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILNIEDDGEVTVNMGVPE 124

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPV--NHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
            +   IP    F    +++ +I     N LF      VSMGNPH +  V DD+   ++ +
Sbjct: 125 FEPNKIP----FKAKQKEKTYIMRAGDNTLFCG---AVSMGNPHVVT-VVDDVDTAEVET 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V S + + LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNAGFMQVVSRDHIRLRVYERGAGETQACGSGACAAVAVGILQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           +  V V + GG L I W      +FMTG     ++G+L
Sbjct: 237 DENVKVSLPGGELRIAWQGPGKPLFMTGPTTHVFDGQL 274


>gi|255079222|ref|XP_002503191.1| predicted protein [Micromonas sp. RCC299]
 gi|226518457|gb|ACO64449.1| predicted protein [Micromonas sp. RCC299]
          Length = 331

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 142/294 (48%), Gaps = 26/294 (8%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV----DAF 63
           F K +G+GN  +++D R   +   S    A   D N       +I       V    D  
Sbjct: 44  FYKYQGLGNDFVLVDNRDSSEIKLSSERCAQLCDRNFGIGADGVIFAMPPGLVQKDEDYS 103

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
           +R+ N DG+E + CGNG+RC+  F+        K++   T+ G++  +   DG +SVDMG
Sbjct: 104 MRMYNSDGTEPEMCGNGIRCLANFVAKMDGADPKAYKVGTLAGLIQPEVRADGQVSVDMG 163

Query: 122 EPILDWKLIPLARSFDKMD-----RDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED--- 173
           EP LD   +P   +F+        R +  +     L       VSMGNPH + F ++   
Sbjct: 164 EPTLDPPKVPC--TFEATQDGAAVRAKMEVDGETWLVT----AVSMGNPHCVTFGKEGEC 217

Query: 174 -----DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
                 +  + L+ +G +  KHP F    N     V +   + +  WERG G T ACG+ 
Sbjct: 218 DEEGIKVDSFALSHYGPMFEKHPAFPAKTNTEFTEVVNRNYVKMHVWERGAGATLACGTG 277

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           ACA+VVA+    +T R  +V++ GG L IEW + +N V MTG A+  ++G + +
Sbjct: 278 ACATVVAAVLEGRTERKCTVELPGGPLEIEWRESDNRVIMTGPAELVFDGVVAV 331


>gi|148906926|gb|ABR16608.1| unknown [Picea sitchensis]
          Length = 375

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 143/290 (49%), Gaps = 19/290 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITS--DAINALSTDDNTHFDQIMLIHDFQDAS 59
           +  ++ F K  G+GN  +++D R   +   S   AI     +     D ++      + +
Sbjct: 87  KKDVLHFVKYHGLGNDFILVDNRDSLEPKISPEQAIKLCDRNFGVGADGVIFAMPGVNGT 146

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC+  F   L +  + +S+   T  G++V K   DG +
Sbjct: 147 -DYSMRIFNSDGSEPEMCGNGIRCMACFVAELENSPRPQSYRIHTRAGLIVPKLLEDGKV 205

Query: 117 SVDMGEPILDWKLIPL---ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
            VDMG+PIL    IP     R    + +    +     +++     VSMGNPH + F   
Sbjct: 206 MVDMGQPILTAANIPTKLPKREDGAVVKAELPVD--GKIWIVT--CVSMGNPHCVTFSRK 261

Query: 174 DLYHYDLASF-----GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
           D    D+ S      G L   H MF    N    ++ S   L +R WERG G T ACG+ 
Sbjct: 262 DCEVLDVNSLTLEHIGPLFEHHEMFPARTNTEFVQILSSSHLRMRVWERGAGATLACGAG 321

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           ACA VVA+    ++ R   V + GG L IEW++ +NHV+MTG A+K + G
Sbjct: 322 ACALVVAAVLEGRSQRKCLVDLPGGPLEIEWNEKDNHVYMTGPAEKVFSG 371


>gi|289207305|ref|YP_003459371.1| diaminopimelate epimerase [Thioalkalivibrio sp. K90mix]
 gi|288942936|gb|ADC70635.1| diaminopimelate epimerase [Thioalkalivibrio sp. K90mix]
          Length = 278

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 141/285 (49%), Gaps = 18/285 (6%)

Query: 6