PSIBLAST alignment of GI: 254780710 and protein with PDB id: 2q9h

>gi|159795185|pdb|2Q9H|A Chain A, Crystal Structure Of The C73s Mutant Of Diaminopimelate Epimerase Length = 274
 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV   GNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQSGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274