BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780710|ref|YP_003065123.1| diaminopimelate epimerase
[Candidatus Liberibacter asiaticus str. psy62]
         (296 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780710|ref|YP_003065123.1| diaminopimelate epimerase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040387|gb|ACT57183.1| diaminopimelate epimerase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 296

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV
Sbjct: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM
Sbjct: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL
Sbjct: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH
Sbjct: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY 296
           KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
Sbjct: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY 296


>gi|120600507|ref|YP_965081.1| diaminopimelate epimerase [Shewanella sp. W3-18-1]
 gi|146294665|ref|YP_001185089.1| diaminopimelate epimerase [Shewanella putrefaciens CN-32]
 gi|166225757|sp|A4YBF7|DAPF_SHEPC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166225759|sp|A1RPD2|DAPF_SHESW RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|120560600|gb|ABM26527.1| diaminopimelate epimerase [Shewanella sp. W3-18-1]
 gi|145566355|gb|ABP77290.1| diaminopimelate epimerase [Shewanella putrefaciens CN-32]
 gi|319427901|gb|ADV55975.1| diaminopimelate epimerase [Shewanella putrefaciens 200]
          Length = 275

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 140/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGSEVEQCGNGARCFARFVRNKGLTNKNKIRVSTSSGKMTLRLERDGTVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PIL+  LIP         +                   SMGNPH +  VE D+    +A
Sbjct: 121 VPILEPSLIPFKAK-----KPEKTYLLQTAQQTFLCGAASMGNPHCVLDVE-DVASAAVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K
Sbjct: 175 EIGALLTKHERFPRGVNVGFMQVINSGHIKLRVYERGAAETLACGTGACAAVVVGQIQGK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            ++ V V + GG L I W      ++MTG A+  ++G++ +
Sbjct: 235 LDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|188590966|ref|YP_001795566.1| diaminopimelate epimerase [Cupriavidus taiwanensis LMG 19424]
 gi|229807504|sp|B2AGE5|DAPF_CUPTR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|170937860|emb|CAP62844.1| diaminopimelate epimerase [Cupriavidus taiwanensis LMG 19424]
          Length = 288

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 95/285 (33%), Positives = 137/285 (48%), Gaps = 7/285 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T     AL+        DQI+++       VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGADQILIVEKPTRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI+N DGSEV+ CGNG RC VRF+T +    ++S   E + G++      DG ++VDMG 
Sbjct: 63  RIVNADGSEVEHCGNGARCFVRFVTEQGMTDKRSVRVEVMNGVITLTLQDDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P L+   +P          +      G   +        VSMGNPHA+  V+ D+ ++ +
Sbjct: 123 PELEPARVPFRAQGLPTHAEGADALYGLEVNGRTEWISAVSMGNPHAVQVVD-DVENFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++  HP F   VN    +V    ++ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LQDGPVIEHHPAFPNRVNAGFMQVVDRHAIRLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDIKTG 284
             +  V V   GG L I W      V MTG A   +EG +D+   
Sbjct: 242 LLDSPVRVHTHGGELTIAWDGGAEPVRMTGPATTVFEGSIDLAAL 286


>gi|83643200|ref|YP_431635.1| diaminopimelate epimerase [Hahella chejuensis KCTC 2396]
 gi|123535219|sp|Q2SQ64|DAPF_HAHCH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|83631243|gb|ABC27210.1| diaminopimelate epimerase [Hahella chejuensis KCTC 2396]
          Length = 276

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 139/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H +   + +  L+       FDQ++++        D  
Sbjct: 2   LIKFTKMHGLGNDFMVVDLISQHAHFRPEQVRRLADRNFGVGFDQLLIVEPPGRPDADFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+       +K+   ET +GI+    N+DG ++VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVKENRLTNKKNIRVETKKGIIELIVNKDGLVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L    IP      +        G +  +       VSMGNPH +  V+ D+    + 
Sbjct: 122 APRLAPADIPFVAETQEAIYPIEVNGVMYEI-----SAVSMGNPHGVLVVD-DVNKAPVH 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  HP F E  N+   +V       LR +ERG G T ACG+ ACA+VVA      
Sbjct: 176 KLGKALENHPRFPERANIGFLQVVHRRFAKLRVFERGAGETLACGTGACAAVVAGRLRGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +R V +K+ GG L I W    H V MTG A + ++G++ I
Sbjct: 236 LDRKVEIKLPGGNLKISWEGEGHPVMMTGPAVRVFDGQVRI 276


>gi|254448956|ref|ZP_05062411.1| diaminopimelate epimerase [gamma proteobacterium HTCC5015]
 gi|198261493|gb|EDY85783.1| diaminopimelate epimerase [gamma proteobacterium HTCC5015]
          Length = 281

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 138/282 (48%), Gaps = 12/282 (4%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +VID       ++ D +  ++        DQ++L+   +  S D   RI
Sbjct: 5   FSKMHGLGNDFVVIDAIRQQVELSPDQVRRIADRRFGVGCDQLLLVERPESKSADFRYRI 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRM----KRKSFTFETIRGILVAKENRDGSISVDMGE 122
            N DGSEV+ CGNG RC  RF+  +        S   ET+ G +  +      + VDMG 
Sbjct: 65  YNADGSEVEQCGNGARCFGRFVVDQGLADASCASLKIETLGGPIEIQLLDGHQVQVDMGV 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D   +P     +       H        L +   VSMGNPHA+ +V+ ++    +A 
Sbjct: 125 PRFDPSALPFEADAEAA-----HYALDTAGQLLDIGAVSMGNPHAVLWVD-EIQEAPVAE 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F + VN   A+  S   + LR +ERG G T ACG+ ACA+V       K 
Sbjct: 179 LGPAIESHPRFPQRVNAGFAQCLSRSEIHLRVYERGAGETLACGTGACAAVAVGIRQGKL 238

Query: 243 NRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIKT 283
           +R V+V + GG L I W  D+  + MTG+A   +EG +D+ +
Sbjct: 239 DREVTVHLPGGDLNIYWPDDDQSLMMTGDAITVFEGTIDLSS 280


>gi|127511257|ref|YP_001092454.1| diaminopimelate epimerase [Shewanella loihica PV-4]
 gi|166225756|sp|A3Q9P7|DAPF_SHELP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|126636552|gb|ABO22195.1| diaminopimelate epimerase [Shewanella loihica PV-4]
          Length = 279

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 95/279 (34%), Positives = 141/279 (50%), Gaps = 6/279 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFTKMHGLGNDFMVVDGVTQNVYFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ S+  + ++     T  G +  +  RDGS++V+MG
Sbjct: 61  YRIFNADGSEVEQCGNGARCFARFVKSKGLINKQKIKVSTSSGKMTLRLERDGSVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+L+   IP                    +       VSMGNPH +  V+ D+ + D+ 
Sbjct: 121 IPVLEPSRIPFNAKK-AEKTYLLQADMPEGMQTFLCGAVSMGNPHCVLEVD-DVANADVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G+LL KH  F +GVN+   +V     + LR +ERG   T ACGS ACA+V       K
Sbjct: 179 RIGSLLTKHERFPKGVNVGFMQVVDANHIKLRVYERGAAETLACGSGACAAVAVGQLQGK 238

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             R V V + GG L I W      ++MTG A+  ++G++
Sbjct: 239 LARRVRVDLPGGSLTINWEGEGKPLWMTGPAEHVYDGQI 277


>gi|330444896|ref|ZP_08308551.1| diaminopimelate epimerase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489206|dbj|GAA03048.1| diaminopimelate epimerase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 276

 Score =  251 bits (641), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFVVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMILKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP+         ++ +I       L      SMGNPH +  V+ ++   D+ +
Sbjct: 123 PIFEPNKIPMKAK----QAEKTYILRAGDQTLFCG-AASMGNPHCVTVVD-NVDTADVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNAGFMQVLDRNNVRLRVYERGAGETQACGSGACAAVAIGRLQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W      +FMTG A   ++G+ ++
Sbjct: 237 DENVKVSLPGGDLHIRWAGEGKPLFMTGPAAHVFDGQFNL 276


>gi|254492257|ref|ZP_05105431.1| diaminopimelate epimerase [Methylophaga thiooxidans DMS010]
 gi|224462582|gb|EEF78857.1| diaminopimelate epimerase [Methylophaga thiooxydans DMS010]
          Length = 281

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 97/279 (34%), Positives = 142/279 (50%), Gaps = 10/279 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +VID       +TS  I  LS        DQ++L+   Q A  D  
Sbjct: 1   MLKFSKMHGLGNDFVVIDAIEQTVELTSAQIQFLSDRRFGVGCDQLLLVEKPQTAEADFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMG 121
            RI N DG EV  CGNG RC  RF+  +      T   ET  G++      DGS++VDMG
Sbjct: 61  YRIFNADGGEVAQCGNGARCFARFVRDKGLTTKDTIAVETASGLIYPTLQADGSVTVDMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +PI +   IP             ++  ++    +    +SMGNPHA+  V+ D+    + 
Sbjct: 121 KPIFEPAKIPFQAE-----EATTYMLTIDEHGKKEIAALSMGNPHAVMLVD-DVTVASVL 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  H  F E VN    ++   +S+ LR +ERG G T+ACG+ ACA+VV+      
Sbjct: 175 ELGPLIESHERFPERVNAGFMQIVDSDSIRLRVFERGAGETSACGTGACAAVVSGIKRGL 234

Query: 242 TNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
            N  V+V + GG L I W   +  V+MTG A+  ++G++
Sbjct: 235 LNTMVTVSLPGGDLQISWPDQDASVWMTGPAQHVFDGEI 273


>gi|288957726|ref|YP_003448067.1| diaminopimelate epimerase [Azospirillum sp. B510]
 gi|288910034|dbj|BAI71523.1| diaminopimelate epimerase [Azospirillum sp. B510]
          Length = 283

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 103/284 (36%), Positives = 149/284 (52%), Gaps = 9/284 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
           +F KM G+GN  +VID R      ++  + A++        DQ +++        DAF+R
Sbjct: 4   EFLKMHGLGNDFVVIDARSEPYRPSAAEVRAIADRRIGVGCDQFIVLERTDAPGADAFMR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I N DG E  +CGN  RCV   L     R   +F+T  G+L A    +G I+VDMG P L
Sbjct: 64  IRNADGGEAAACGNASRCVGWLLMEESGRDRASFQTAAGLLHASRADNGRITVDMGPPRL 123

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPLA   D +  +    G         P  V+MGNPHA+FFV+ D     L   G 
Sbjct: 124 DWAAIPLAAPADTLRVETVAHGGF-----AAPVAVNMGNPHAVFFVD-DAEAVPLDEVGP 177

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +   HP F E  N+  A+V S  ++ +R WERG G+T ACGS +CA++VA+     T+R 
Sbjct: 178 VFENHPAFPERANIEFAQVLSPTAIRMRVWERGAGITQACGSGSCATLVAAVRRGLTDRK 237

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL--DIKTGKWI 287
             + + GG L IEW + + V MTG     + G+L  ++ +G+ +
Sbjct: 238 ADIILDGGTLTIEWTEEDRVLMTGPVALAFSGRLSAELVSGELV 281


>gi|311693139|gb|ADP96012.1| diaminopimelate epimerase [marine bacterium HP15]
          Length = 304

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 135/282 (47%), Gaps = 10/282 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D       +  + I  L+       FDQ++++       VD  
Sbjct: 11  MLRFTKMHGLGNDFMVVDAISQPFRLRPEMIRELANRNFGIGFDQLLVVEPPGLPDVDFR 70

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF        +K    +T +G++  +  R+G + V+MG
Sbjct: 71  YRIFNADGSEVEQCGNGARCFARFVRDQRLTNKKVIRVQTAKGVIELRVGREGMVMVNMG 130

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IP A      DR +                +SMGNPH +  VE D+    + 
Sbjct: 131 VPEFNPPAIPFAA-----DRRKDVYTVDVDGQTVELSALSMGNPHGVLLVE-DVDQAPVE 184

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  L +HP F    N+   ++     + LR +ERG G T ACGS ACA+VVA      
Sbjct: 185 TLGPKLERHPRFPARANIGFLQILDRTHVRLRVFERGSGETLACGSGACAAVVAGCLRGL 244

Query: 242 TNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIK 282
            +  V V++ GG L+IEW      V M G A   +EG+L + 
Sbjct: 245 LDARVEVELRGGPLVIEWQGEGTPVMMEGPATSVFEGQLRLP 286


>gi|113866258|ref|YP_724747.1| diaminopimelate epimerase [Ralstonia eutropha H16]
 gi|123134519|sp|Q0KF42|DAPF_RALEH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|113525034|emb|CAJ91379.1| diaminopimelate epimerase [Ralstonia eutropha H16]
          Length = 288

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 95/285 (33%), Positives = 137/285 (48%), Gaps = 7/285 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T     AL+        DQI+++       VD   
Sbjct: 3   LQFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGADQILIVEKPSRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI+N DGSEV+ CGNG RC VRF+T +    ++S   E + G++      DG ++VDMG 
Sbjct: 63  RIVNADGSEVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNGVITLTLQDDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P L+   +P          +      G   +       VVSMGNPHA+  V+ D+ ++ +
Sbjct: 123 PELEPARVPFRAEGLPTRAEGADTLYGLEVNGRTEWISVVSMGNPHAVQVVD-DVENFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++  H  F   VN    +V    ++ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LQDGPVVEHHAAFPNRVNAGFMQVQDRHAIRLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDIKTG 284
             +  V V   GG L I W      V MTG A   +EG +D+   
Sbjct: 242 LLDSPVRVHTHGGDLTIAWDGGAEPVRMTGPATTVFEGSIDLAAL 286


>gi|192360012|ref|YP_001983744.1| diaminopimelate epimerase [Cellvibrio japonicus Ueda107]
 gi|229807488|sp|B3PEI8|DAPF_CELJU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|190686177|gb|ACE83855.1| diaminopimelate epimerase [Cellvibrio japonicus Ueda107]
          Length = 276

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 98/280 (35%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID       +T + I  L+        DQ++L+   +  +VD   
Sbjct: 3   IRFSKMHGLGNDFVVIDGISQTVRLTPEKIRKLADRHFGVGCDQVLLVEIPEQPNVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDGSEV++CGNG RC   F+  R    ++    ET  GI+  +   D  +SVDMG 
Sbjct: 63  RIFNCDGSEVENCGNGARCFAVFVRERRLTGKRVIRVETAGGIIELRVQDDEQVSVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L  + IP        D+            + +   VSMGNPHA+  V+ D+    +  
Sbjct: 123 PRLLPEKIPFVA-----DQQAVTYPLDVAGQVCSISAVSMGNPHAVMLVD-DVKSAPVGQ 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  HP F   VN    +V S + ++LR +ERG G T ACG+ ACA+VV        
Sbjct: 177 LGPLVENHPRFPARVNAGFLQVVSRDEINLRVYERGAGETLACGTGACAAVVTGRLRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L I W    H V MTG A   + G++ +
Sbjct: 237 NDTVKVNLPGGSLRISWPGEGHSVIMTGPAVTVFHGQIKL 276


>gi|126176183|ref|YP_001052332.1| diaminopimelate epimerase [Shewanella baltica OS155]
 gi|153002476|ref|YP_001368157.1| diaminopimelate epimerase [Shewanella baltica OS185]
 gi|160877193|ref|YP_001556509.1| diaminopimelate epimerase [Shewanella baltica OS195]
 gi|217975043|ref|YP_002359794.1| diaminopimelate epimerase [Shewanella baltica OS223]
 gi|304412535|ref|ZP_07394141.1| diaminopimelate epimerase [Shewanella baltica OS183]
 gi|307307194|ref|ZP_07586932.1| diaminopimelate epimerase [Shewanella baltica BA175]
 gi|166225754|sp|A3D9Q0|DAPF_SHEB5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166225755|sp|A6WTF5|DAPF_SHEB8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082840|sp|A9L5F5|DAPF_SHEB9 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767120|sp|B8E690|DAPF_SHEB2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|125999388|gb|ABN63463.1| diaminopimelate epimerase [Shewanella baltica OS155]
 gi|151367094|gb|ABS10094.1| Diaminopimelate epimerase [Shewanella baltica OS185]
 gi|160862715|gb|ABX51249.1| Diaminopimelate epimerase [Shewanella baltica OS195]
 gi|217500178|gb|ACK48371.1| Diaminopimelate epimerase [Shewanella baltica OS223]
 gi|304349177|gb|EFM13589.1| diaminopimelate epimerase [Shewanella baltica OS183]
 gi|306910433|gb|EFN40864.1| diaminopimelate epimerase [Shewanella baltica BA175]
 gi|315269397|gb|ADT96250.1| diaminopimelate epimerase [Shewanella baltica OS678]
          Length = 275

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGTEVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PIL+   IP         +          +        SMGNPH +  VE D+    +A
Sbjct: 121 VPILEPSQIPFKAK-----KPEKTYLLQTPMQTFLCGAASMGNPHCVLDVE-DVASASVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L KH  F  GVN+   +V     + LR +ERG   T ACG+ ACA+VV      K
Sbjct: 175 EIGAMLTKHERFPRGVNVGFMQVVDSGHIKLRVYERGAAETLACGTGACAAVVVGQVQGK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             + V V + GG L I W      ++MTG A+  ++G++ +
Sbjct: 235 LGQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|224824101|ref|ZP_03697209.1| Diaminopimelate epimerase [Lutiella nitroferrum 2002]
 gi|224603520|gb|EEG09695.1| Diaminopimelate epimerase [Lutiella nitroferrum 2002]
          Length = 276

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 97/280 (34%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    H ++T + I  L        FDQ++L+     +  D   
Sbjct: 3   LKFSKMHGLGNDFMVIDGVRQHVDLTPEKIKELGHRQFGIGFDQLLLVEPSGSSENDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +    + +   ET +G++V +   DG+++VDMG 
Sbjct: 63  RIFNSDGSEVEQCGNGARCFARFVAEQGLSAKVAIRVETAKGVIVPQLLADGTVTVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP   +      +             +  VVSMGNPHA+  V  D+  + +A 
Sbjct: 123 PRFKPVEIPFVAA-----EEALTYPLDAAGRQCDISVVSMGNPHAVQVV-ADVDTFPVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F E VN    ++ S E + LR +ERG G T ACG+ ACA+VVA       
Sbjct: 177 LGPAIELHPRFPERVNAGFMQIVSREEIRLRVYERGAGETLACGTGACAAVVAGIRRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V   GG L I W      V MTG A   + G++ +
Sbjct: 237 DHTVKVHTRGGDLSIRWDGVGLPVLMTGPAVTVFTGEISL 276


>gi|149376982|ref|ZP_01894736.1| diaminopimelate epimerase [Marinobacter algicola DG893]
 gi|149358759|gb|EDM47229.1| diaminopimelate epimerase [Marinobacter algicola DG893]
          Length = 327

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 94/283 (33%), Positives = 135/283 (47%), Gaps = 10/283 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +V+D       +  + I  L+       FDQ++++       VD  
Sbjct: 17  MLNFTKMHGLGNDFMVVDAISQPFRLRPEMIRELADRNFGIGFDQLLVVEPPGLPDVDFR 76

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF        +K    +T +G++  +  R G ++VDMG
Sbjct: 77  YRIFNSDGSEVEQCGNGARCFARFVRDQRLTNKKVIRVQTAKGVIELRVGRAGMVTVDMG 136

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L+   IP A      DR +                VSMGNPH +  V+ D+    + 
Sbjct: 137 VPELNPPAIPFAA-----DRRKDVYTVELGGDTVELSAVSMGNPHGVLLVD-DVDTAPVG 190

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
            +G  L  HP F    N+   ++     + LR +ERG G T ACGS ACA+VVA      
Sbjct: 191 EYGPRLENHPRFPARANIGFLQIVDRTHVRLRVFERGSGETMACGSGACAAVVAGCLRGL 250

Query: 242 TNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKT 283
            +  V V++ GG L+IEW      V M G     +EG+L +  
Sbjct: 251 LDNRVDVELKGGRLVIEWQGEGAPVMMEGPTASVFEGQLRLPA 293


>gi|117918848|ref|YP_868040.1| diaminopimelate epimerase [Shewanella sp. ANA-3]
 gi|166225758|sp|A0KS65|DAPF_SHESA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|117611180|gb|ABK46634.1| diaminopimelate epimerase [Shewanella sp. ANA-3]
          Length = 275

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 141/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV++CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+LD   IP         +                   SMGNPH +  VE D+ + ++A
Sbjct: 121 VPVLDPSQIPFKAK-----KAEKTYLLQTPQQTFLCGAASMGNPHCVLDVE-DVANANVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K
Sbjct: 175 EIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGQIQGK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            ++ V V + GG L I W      ++MTG A+  ++G++ +
Sbjct: 235 LDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|89074450|ref|ZP_01160927.1| diaminopimelate epimerase [Photobacterium sp. SKA34]
 gi|89049738|gb|EAR55288.1| diaminopimelate epimerase [Photobacterium sp. SKA34]
          Length = 276

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 91/278 (32%), Positives = 137/278 (49%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFVVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMLLKLENDNQVTVNMGG 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP+         ++ +I       L      SMGNPH +  V+ ++   D+ +
Sbjct: 123 PIFEPSKIPMKAK----QAEKTYILRAGEQTLFCG-AASMGNPHCVTVVD-NVDTADVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNAGFMQVIDRNNVRLRVYERGAGETLACGSGACAAVAIGRSQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           +  V V + GG L I W      +FMTG A   ++G+ 
Sbjct: 237 DENVKVSLPGGDLYIRWAGEGKPLFMTGPAAHVFDGQF 274


>gi|113968736|ref|YP_732529.1| diaminopimelate epimerase [Shewanella sp. MR-4]
 gi|114049120|ref|YP_739670.1| diaminopimelate epimerase [Shewanella sp. MR-7]
 gi|122944336|sp|Q0HQJ2|DAPF_SHESR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123130815|sp|Q0HN95|DAPF_SHESM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|113883420|gb|ABI37472.1| diaminopimelate epimerase [Shewanella sp. MR-4]
 gi|113890562|gb|ABI44613.1| diaminopimelate epimerase [Shewanella sp. MR-7]
          Length = 275

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 141/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV++CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+LD   IP         +                   SMGNPH +  VE D+ + ++A
Sbjct: 121 VPVLDPSQIPFKAK-----KAEKTYLLQTSQQTFLCGAASMGNPHCVLDVE-DVANANVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K
Sbjct: 175 EIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGQIQGK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            ++ V V + GG L I W      ++MTG A+  ++G++ +
Sbjct: 235 LDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|90019886|ref|YP_525713.1| diaminopimelate epimerase [Saccharophagus degradans 2-40]
 gi|123396771|sp|Q21P78|DAPF_SACD2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|89949486|gb|ABD79501.1| diaminopimelate epimerase [Saccharophagus degradans 2-40]
          Length = 277

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 133/280 (47%), Gaps = 9/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  ++ID       IT +    L+        DQ++++        D   
Sbjct: 3   LRFTKMHGLGNDFVMIDAISQRVTITPERARQLADRHFGVGCDQVLVVETPDSPDADFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV++CGNG RC   F+  R    +   T ET  G +V     D  ++VDMG 
Sbjct: 63  RIFNHDGSEVENCGNGARCFAVFVRQRGLTAKSVITVETAVGRMVLHVQEDDQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PIL    IPLA             G  +         VSMGNPHA++ V +D     + +
Sbjct: 123 PILSPADIPLAAPQQATSYTLPTQGAGDITIG----AVSMGNPHAVYCV-NDCKTAPVET 177

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F + VN    +V S   ++LR +ERG G T ACG+ ACA+VVA       
Sbjct: 178 LGPEIEAHPHFPKKVNAGFMQVVSPSEINLRVYERGAGETLACGTGACAAVVAGRLQGLL 237

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W   ++ V MTG A   + G++ I
Sbjct: 238 ENTVKVNLPGGSLSITWEGVDSPVMMTGPATTVFHGQVKI 277


>gi|120553432|ref|YP_957783.1| diaminopimelate epimerase [Marinobacter aquaeolei VT8]
 gi|120323281|gb|ABM17596.1| diaminopimelate epimerase [Marinobacter aquaeolei VT8]
          Length = 308

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 95/281 (33%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D       +  D I  L+       FDQ++++       VD   
Sbjct: 12  LRFTKMHGLGNDFMVVDAISQPFRLAPDTIRELADRNFGIGFDQLLVVEPPGLPDVDFRY 71

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF        ++    +T +G++  K  RDG ++V+MG 
Sbjct: 72  RIFNADGSEVEQCGNGARCFARFVRDQRLTNKRVIRVQTAKGVIELKVGRDGLVAVNMGV 131

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L+   IP A      D+ +       +        +SMGNPH +  V+ ++    + S
Sbjct: 132 PELNPPAIPFAA-----DQRKDVYTVDVNGQTVELSAISMGNPHGVLVVD-NVDTAPVES 185

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L KHP F    N+   +V       LR +ERG G T ACGS ACA+VVA       
Sbjct: 186 LGPQLEKHPRFPARANIGFLQVIDRRHARLRVFERGSGETLACGSGACAAVVAGCLRGLL 245

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
           +  V V++ GG L+IEW  ++  V M G A   +EG+L + 
Sbjct: 246 DSRVEVELRGGRLVIEWQGEDTPVMMEGPATTVFEGQLRLP 286


>gi|24375790|ref|NP_719833.1| diaminopimelate epimerase [Shewanella oneidensis MR-1]
 gi|29839322|sp|Q8E9H5|DAPF_SHEON RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|24350738|gb|AAN57277.1|AE015863_6 diaminopimelate epimerase [Shewanella oneidensis MR-1]
          Length = 275

 Score =  248 bits (632), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 141/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIQFTKMHGLGNDFMVVDGITQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV++CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+L+   IP         +                   SMGNPH +  VE D+ + ++A
Sbjct: 121 VPVLEPSQIPFKAK-----KAEKTYLLQTPQQTFLCGAASMGNPHCVLDVE-DVANANVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL KH  F  GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K
Sbjct: 175 EIGALLTKHERFPRGVNVGFMQVVNAGHIKLRVYERGAAETLACGTGACAAVVVGQIQGK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            ++ V V + GG L I W      ++MTG A+  ++G++ +
Sbjct: 235 LDQQVQVDLPGGSLTINWEGEGKPLWMTGPAQHVYDGQIQL 275


>gi|256821401|ref|YP_003145364.1| diaminopimelate epimerase [Kangiella koreensis DSM 16069]
 gi|256794940|gb|ACV25596.1| diaminopimelate epimerase [Kangiella koreensis DSM 16069]
          Length = 276

 Score =  248 bits (632), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 85/281 (30%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           ++ F+KM+G+GN  +V+D       +    I  L+       FDQ++++   Q    D  
Sbjct: 2   IMPFSKMQGLGNDFVVVDAISQPVYLNQGQIAKLAHRNFGIGFDQLLIVEAPQHPESDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSE   CGNG R V +++  +    ++     T    + A    +G +++DMG
Sbjct: 62  FRIFNADGSEAGHCGNGARAVAKYVRQKGLTWKRQLRLSTNTATMQATLEDNGLVTIDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P L+   IPL     +    +                VSMGNPH +  V+ ++    + 
Sbjct: 122 KPRLEPAQIPL-----RFAEKQTLYSIDAGGISYKVGAVSMGNPHCVLKVD-NVEKAPVQ 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L++H  F    N    ++   +++ LR +ERGVG T ACG+ ACA+VV +     
Sbjct: 176 TVGPMLSQHKYFPSQANAGFMQIVDRQNIKLRVYERGVGETLACGTGACAAVVVARLQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           T+  V V + GG L I W      VFM+G AK  +EG+++I
Sbjct: 236 TDDKVKVMLPGGSLWITWQGEGSRVFMSGPAKVVFEGQVEI 276


>gi|226940775|ref|YP_002795849.1| DapF [Laribacter hongkongensis HLHK9]
 gi|254767108|sp|C1D8Q0|DAPF_LARHH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226715702|gb|ACO74840.1| DapF [Laribacter hongkongensis HLHK9]
          Length = 278

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 102/282 (36%), Positives = 145/282 (51%), Gaps = 12/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN   V+D       +T + I  L        FDQ++L+   QDA  D   
Sbjct: 3   LKFTKMQGLGNDFAVLDGVRQTIRLTPEQIRKLGDRRFGIGFDQLLLVEPPQDAGNDFSY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC  RF+       R+    ET RG++V +   DG ++VDMG 
Sbjct: 63  RIFNCDGGEVEQCGNGARCFARFVFDHGLTDRREIRVETARGVIVPRLADDGLVTVDMGP 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP   + D +  +    G      +    VVSMGNPHA+  V+ D+    + +
Sbjct: 123 PRFRPADIPFVAAEDAVIHELEVAG-----QILGVTVVSMGNPHAVQVVD-DVDTAPVTA 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG L+  H  F   VN    ++ S  ++ LR +ERG G T ACG+ ACA+VVA       
Sbjct: 177 FGPLIENHLRFPARVNAGFMQIESRTAICLRVFERGSGETLACGTGACAAVVAGIRRGLL 236

Query: 243 --NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             +  V+V+  GG L I W  + H V+MTG A   +EG++ +
Sbjct: 237 DADTPVTVQTRGGELRIRWAGDGHPVWMTGPAVTVFEGEITL 278


>gi|24054374|gb|AAN45323.1| diaminopimelate epimerase [Shigella flexneri 2a str. 301]
 gi|30043155|gb|AAP18877.1| diaminopimelate epimerase [Shigella flexneri 2a str. 2457T]
 gi|281603202|gb|ADA76186.1| Diaminopimelate epimerase [Shigella flexneri 2002017]
          Length = 275

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 134/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LDEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|91781473|ref|YP_556679.1| diaminopimelate epimerase [Burkholderia xenovorans LB400]
 gi|123169125|sp|Q146W2|DAPF_BURXL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91685427|gb|ABE28627.1| diaminopimelate epimerase [Burkholderia xenovorans LB400]
          Length = 287

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 91/285 (31%), Positives = 138/285 (48%), Gaps = 9/285 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      N+T   + AL+        DQ++L+     A VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGADQLLLVEKPTVAGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+  R    ++S   +  +G +      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTITLTMQENGEVLVDMGT 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ D + +P A    +  R+              R   VVSMGNPHA+  V  D+  + +
Sbjct: 123 PVFDPERVPFATKGLEGRREGADTLWPLDVSGTTRWISVVSMGNPHAVQVVG-DVEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LAEGPVIERHARFPQRVNAGFMQIVGRNEIRLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWH---DNNHVFMTGEAKKEWEGKLDIK 282
             +  V V   GG L I W    +   + M G A   +EG++++ 
Sbjct: 242 LLDSPVRVHTHGGDLTISWDSTREGEPLLMAGPAVTVFEGEIELP 286


>gi|94499871|ref|ZP_01306407.1| diaminopimelate epimerase [Oceanobacter sp. RED65]
 gi|94428072|gb|EAT13046.1| diaminopimelate epimerase [Oceanobacter sp. RED65]
          Length = 278

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 85/280 (30%), Positives = 135/280 (48%), Gaps = 6/280 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H     + +  LS       FDQ++++    +  VD  
Sbjct: 2   LLKFTKMHGLGNDFMVVDLVTQHFAFRPEFVRQLSDRQFGIGFDQLLIVEPPSNPEVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT--SRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+       +     ET  GI+     +DG + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVHDVRLTAKNPIKVETSSGIIELNIEQDGDVVVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
                   +P   + ++ +R +  +   +  +      VSMGNPH +  V+ D++   + 
Sbjct: 122 AARFSPSDLPF--NAEQAERYQVQVPLNDGNYTAEFGAVSMGNPHCVMVVD-DIHSELVN 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  H  F + VN    ++ +   +DLR +ERG G T ACG+ ACA+V  +     
Sbjct: 179 QLGPQLEGHEQFPKRVNAGFMQIKNRNEMDLRVYERGAGWTLACGTGACAAVAVAHKWGL 238

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            +  V V + GG L I W     V M G   + ++G+L +
Sbjct: 239 VDDEVKVNLPGGALTIRWDGEGDVIMKGPVVRVFDGRLQV 278


>gi|317494829|ref|ZP_07953240.1| diaminopimelate epimerase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917154|gb|EFV38502.1| diaminopimelate epimerase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 274

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS   +   FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHNGVGFDQMLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V K + D  ++V+MGE
Sbjct: 61  RIFNADGSEVGQCGNGARCFARFVRLKGLTNKREIRVSTQNGRMVLKVSDDELVTVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP            + +    H  L     VSMGNPH +  V+ D+    + +
Sbjct: 121 PIFEPSKIPFKA---VKAEKTYIMRAAEHTILCG--AVSMGNPHCVLQVD-DVETALVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+   +V +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 IGPVLESHERFPERVNVGFMQVINRNQIKLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W   +N +FMTG A   ++G + +
Sbjct: 235 DENVQVDLPGGRLQIRWKGPDNPLFMTGPATHVYDGFIHL 274


>gi|331005626|ref|ZP_08328995.1| Diaminopimelate epimerase [gamma proteobacterium IMCC1989]
 gi|330420551|gb|EGG94848.1| Diaminopimelate epimerase [gamma proteobacterium IMCC1989]
          Length = 282

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 96/288 (33%), Positives = 144/288 (50%), Gaps = 13/288 (4%)

Query: 1   MQSSM---VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQ 56
           M + M   + F KM G+GN  +V D      ++T + I  ++        DQ++++   Q
Sbjct: 1   MAARMTTRLRFTKMHGLGNDFVVFDGINQDIDLTPERIRKIADRRFGIGCDQLLVVEVPQ 60

Query: 57  DASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG 114
               D   RI N DGSEV++CGNG RC  +F+  +    + +   ET+ G+L    +R G
Sbjct: 61  HPENDFRYRIYNYDGSEVENCGNGARCFAKFVRDKKLTGKNTIRVETLGGVLTLHASRQG 120

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            ++VDMG P+L    IP       ++ D             +   +SMGNPHA+  V+ +
Sbjct: 121 DVTVDMGVPVLTPAEIPFNADSQAVNYDLALAD-----QTISISAISMGNPHAVTLVD-N 174

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    +  +G L+  H  F   VN     V S ES+ LR +ERGVG T ACG+ ACA+VV
Sbjct: 175 VDTAPIEQWGPLIENHSRFPNRVNAGFMAVESRESIRLRVYERGVGETLACGTGACAAVV 234

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           A       +  V+  + GG L IEW    H V MTG A   ++G++ I
Sbjct: 235 AGHLQGLLDPVVTAHLRGGDLRIEWQGIGHPVMMTGPATTVFQGQVKI 282


>gi|90414246|ref|ZP_01222226.1| diaminopimelate epimerase [Photobacterium profundum 3TCK]
 gi|90324693|gb|EAS41234.1| diaminopimelate epimerase [Photobacterium profundum 3TCK]
          Length = 276

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 89/278 (32%), Positives = 132/278 (47%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFMVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +     +     T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVWMKGLTNKYQVAVSTKAGKMLLKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP      +  +                 VVSMGNPH +  V+ DL    + +
Sbjct: 123 PEFEPSKIPF-----RAKQTEKTYIMRVGERTIFCGVVSMGNPHCVTVVD-DLDLTGVET 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E VN    +V S   + LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLIESHERFPERVNAGFMQVVSRNEVKLRVYERGAGETQACGSGACAAVAVGYLQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
           +  V V + GG L I W  +   ++MTG     ++G++
Sbjct: 237 DENVKVSLPGGDLHISWAGEGKSLYMTGPVAHVFDGQI 274


>gi|262273211|ref|ZP_06051027.1| diaminopimelate epimerase [Grimontia hollisae CIP 101886]
 gi|262222789|gb|EEY74098.1| diaminopimelate epimerase [Grimontia hollisae CIP 101886]
          Length = 276

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + D I  L+  +    FDQ++++    D   D   
Sbjct: 3   IQFSKMHGLGNDFMVVDCVTQNAYFSPDMIRRLADRNTGVGFDQLLVVEPPYDPESDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N D SEV  CGNG RC  RF+  +    +      T  G +V K + D  ++V+MGE
Sbjct: 63  RIFNADSSEVAQCGNGARCFARFVRMKGLTNKNQIQVSTKSGKMVLKMDGDDQVTVNMGE 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI     IP      + + +                 VSMGNPH +  V+ ++  +D+  
Sbjct: 123 PIWAPAKIPF-----RANAEEKTYILRVEDTTLFVGAVSMGNPHCVTVVD-NVDTFDVEG 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E VN    ++ S   + LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLVESHERFPERVNAGFMQIVSRNEIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           + +V+V + GG L I W    H ++MTG A   ++G++ +
Sbjct: 237 DESVTVHLKGGDLKIRWRGAGHPLYMTGPASHVYDGQITV 276


>gi|73539904|ref|YP_294424.1| diaminopimelate epimerase [Ralstonia eutropha JMP134]
 gi|123626043|sp|Q476V3|DAPF_RALEJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|72117317|gb|AAZ59580.1| diaminopimelate epimerase [Ralstonia eutropha JMP134]
          Length = 288

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 137/285 (48%), Gaps = 7/285 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T++   AL+        DQ++++       VD   
Sbjct: 3   LQFTKMHGAGNDFVVLDGIHQKLDLTTEQWRALASRHFGVGADQMLIVEKPTREDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC VRF+T +    ++S   E + G++      DG ++VDMG 
Sbjct: 63  RIFNADGSEVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNGVITLTLQDDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDR--DRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P L+   +P       +    +    G   +        VSMGNPHA+  V+ D+ ++ +
Sbjct: 123 PELEPARVPFRPDGLPVRTQGEDIAYGLEINGRTAWISPVSMGNPHAVQVVD-DVENFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  H  F   VN    +V    +  LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LQDGPLIEHHATFPNRVNAGFLQVVDRHTARLRVFERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDIKTG 284
             +  V V   GG L I W      V MTG A   +EG +D+   
Sbjct: 242 LLDSPVKVHTHGGDLNIAWDGGAEPVRMTGPATTVFEGTIDLAAL 286


>gi|323964054|gb|EGB59544.1| diaminopimelate epimerase [Escherichia coli M863]
          Length = 275

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVCVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|237727925|ref|ZP_04558406.1| diaminopimelate epimerase [Citrobacter sp. 30_2]
 gi|226910374|gb|EEH96292.1| diaminopimelate epimerase [Citrobacter sp. 30_2]
          Length = 275

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDELVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSQVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVDTATVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHVYDGFIHL 275


>gi|296161402|ref|ZP_06844209.1| diaminopimelate epimerase [Burkholderia sp. Ch1-1]
 gi|295888388|gb|EFG68199.1| diaminopimelate epimerase [Burkholderia sp. Ch1-1]
          Length = 295

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 90/285 (31%), Positives = 138/285 (48%), Gaps = 9/285 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      N+T   + AL+        DQ++L+     A VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGADQLLLVEKPTVAGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+  R    ++S   +  +G +      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTVTLTMQENGEVLVDMGT 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ D + +P A    +  R+              R    VSMGNPHA+  V+ D+  + +
Sbjct: 123 PVFDPERVPFATKGLEGRREGADTLWPLDVSGTTRWISAVSMGNPHAVQVVD-DVEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LVEGPVIERHARFPQRVNAGFMQIVGRSEIRLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWH---DNNHVFMTGEAKKEWEGKLDIK 282
           + +  V V   GG L I W    +   + M G A   +EG++++ 
Sbjct: 242 RLDSPVLVHTHGGNLTISWDNTREGEPLLMAGPAVTVFEGEIELP 286


>gi|237654489|ref|YP_002890803.1| diaminopimelate epimerase [Thauera sp. MZ1T]
 gi|237625736|gb|ACR02426.1| diaminopimelate epimerase [Thauera sp. MZ1T]
          Length = 277

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 130/281 (46%), Gaps = 10/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      ++T   + A++        DQ++++       VD   
Sbjct: 3   LRFTKMHGLGNDFVVIDATRAPVDLTPARVKAIADRHFGVGCDQLLVVEPAARPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+  +          ET  GI+  +   DG ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVRFVHDKGLTDKAEIRVETRSGIIAPRLRADGLVTVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L    +P     D + +     G    +       VSMGNPHA+  V  D+    +  
Sbjct: 123 PELAPAKVPFVSDSDAVVQPLQVGGDTVAI-----TAVSMGNPHAVQVV-ADVDAAPVVE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  + +H  F   VN    +V     + LR +ERG G T ACG+ ACA+VVA       
Sbjct: 177 QGARIERHERFPARVNAGFLQVVDAHEVRLRVFERGAGETLACGTGACAAVVAGILRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIK 282
              V V   GG L I W      V MTG A   +EG++++ 
Sbjct: 237 ETPVRVHTRGGELEIAWDGPGTPVRMTGPAVTVFEGEMELA 277


>gi|119896885|ref|YP_932098.1| diaminopimelate epimerase [Azoarcus sp. BH72]
 gi|166224239|sp|A1K306|DAPF_AZOSB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|119669298|emb|CAL93211.1| DapF protein [Azoarcus sp. BH72]
          Length = 277

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 95/281 (33%), Positives = 131/281 (46%), Gaps = 10/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      ++T   + A++        DQ++++       VD   
Sbjct: 3   IRFTKMHGLGNDFVVIDATRTPVDLTPARVKAIADRHFGVGCDQLLVVEPPGSDEVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+  +    ++    ET  G++      DG +SVDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVRFVHDKGLTDKREIRVETRAGVIAPALRPDGLVSVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L    IP     D   +          +       VSMGNPHA+  V  D+    +A 
Sbjct: 123 PELSPARIPFVSDSDAWVQPLQLAEDTVAI-----TAVSMGNPHAVQVV-ADVDTAPVAR 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F   VN    +V     + LR +ERG G T ACG+ ACA+VVA       
Sbjct: 177 QGAEIECHPRFPARVNAGFMQVVDAGHIRLRVFERGAGETLACGTGACAAVVAGIGRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIK 282
              V V+  GG L I W      V MTG A   +EG+L++ 
Sbjct: 237 VSPVRVETRGGELEIAWAGPGTPVVMTGPAVTVFEGELELP 277


>gi|331660154|ref|ZP_08361090.1| diaminopimelate epimerase [Escherichia coli TA206]
 gi|315296790|gb|EFU56082.1| diaminopimelate epimerase [Escherichia coli MS 16-3]
 gi|331052722|gb|EGI24757.1| diaminopimelate epimerase [Escherichia coli TA206]
          Length = 275

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 134/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P   +        + +       L    VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPFRAN---KVEKTYIMRAAEQTILCG--VVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|91213334|ref|YP_543320.1| diaminopimelate epimerase [Escherichia coli UTI89]
 gi|117626068|ref|YP_859391.1| diaminopimelate epimerase [Escherichia coli APEC O1]
 gi|188492832|ref|ZP_03000102.1| diaminopimelate epimerase [Escherichia coli 53638]
 gi|209921287|ref|YP_002295371.1| diaminopimelate epimerase [Escherichia coli SE11]
 gi|237702818|ref|ZP_04533299.1| diaminopimelate epimerase [Escherichia sp. 3_2_53FAA]
 gi|254039021|ref|ZP_04873072.1| diaminopimelate epimerase [Escherichia sp. 1_1_43]
 gi|293417275|ref|ZP_06659900.1| diaminopimelate epimerase [Escherichia coli B185]
 gi|300818720|ref|ZP_07098927.1| diaminopimelate epimerase [Escherichia coli MS 107-1]
 gi|300823345|ref|ZP_07103476.1| diaminopimelate epimerase [Escherichia coli MS 119-7]
 gi|300900641|ref|ZP_07118799.1| diaminopimelate epimerase [Escherichia coli MS 198-1]
 gi|300904064|ref|ZP_07121944.1| diaminopimelate epimerase [Escherichia coli MS 84-1]
 gi|300921480|ref|ZP_07137828.1| diaminopimelate epimerase [Escherichia coli MS 115-1]
 gi|300923313|ref|ZP_07139361.1| diaminopimelate epimerase [Escherichia coli MS 182-1]
 gi|300930025|ref|ZP_07145457.1| diaminopimelate epimerase [Escherichia coli MS 187-1]
 gi|300939971|ref|ZP_07154599.1| diaminopimelate epimerase [Escherichia coli MS 21-1]
 gi|300950426|ref|ZP_07164348.1| diaminopimelate epimerase [Escherichia coli MS 116-1]
 gi|300955185|ref|ZP_07167582.1| diaminopimelate epimerase [Escherichia coli MS 175-1]
 gi|300979370|ref|ZP_07174528.1| diaminopimelate epimerase [Escherichia coli MS 200-1]
 gi|301025746|ref|ZP_07189261.1| diaminopimelate epimerase [Escherichia coli MS 69-1]
 gi|301029026|ref|ZP_07192180.1| diaminopimelate epimerase [Escherichia coli MS 196-1]
 gi|301303705|ref|ZP_07209826.1| diaminopimelate epimerase [Escherichia coli MS 124-1]
 gi|301328429|ref|ZP_07221510.1| diaminopimelate epimerase [Escherichia coli MS 78-1]
 gi|301646123|ref|ZP_07246023.1| diaminopimelate epimerase [Escherichia coli MS 146-1]
 gi|309796247|ref|ZP_07690657.1| diaminopimelate epimerase [Escherichia coli MS 145-7]
 gi|331644542|ref|ZP_08345662.1| diaminopimelate epimerase [Escherichia coli H736]
 gi|331649634|ref|ZP_08350716.1| diaminopimelate epimerase [Escherichia coli M605]
 gi|331655494|ref|ZP_08356487.1| diaminopimelate epimerase [Escherichia coli M718]
 gi|331665459|ref|ZP_08366358.1| diaminopimelate epimerase [Escherichia coli TA143]
 gi|331670655|ref|ZP_08371492.1| diaminopimelate epimerase [Escherichia coli TA271]
 gi|331675277|ref|ZP_08376028.1| diaminopimelate epimerase [Escherichia coli TA280]
 gi|331679919|ref|ZP_08380582.1| diaminopimelate epimerase [Escherichia coli H591]
 gi|331685529|ref|ZP_08386113.1| diaminopimelate epimerase [Escherichia coli H299]
 gi|332282683|ref|ZP_08395096.1| diaminopimelate epimerase [Shigella sp. D9]
 gi|25294017|pir||C91221 diaminopimelate epimerase [imported] - Escherichia coli  (strain
           O157:H7, substrain RIMD 0509952)
 gi|25294021|pir||F86067 diaminopimelate epimerase [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12518677|gb|AAG59002.1|AE005612_5 diaminopimelate epimerase [Escherichia coli O157:H7 str. EDL933]
 gi|13364215|dbj|BAB38162.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. Sakai]
 gi|73857798|gb|AAZ90505.1| diaminopimelate epimerase [Shigella sonnei Ss046]
 gi|81243160|gb|ABB63870.1| diaminopimelate epimerase [Shigella dysenteriae Sd197]
 gi|81247571|gb|ABB68279.1| diaminopimelate epimerase [Shigella boydii Sb227]
 gi|91074908|gb|ABE09789.1| diaminopimelate epimerase [Escherichia coli UTI89]
 gi|115515192|gb|ABJ03267.1| diaminopimelate epimerase [Escherichia coli APEC O1]
 gi|188488031|gb|EDU63134.1| diaminopimelate epimerase [Escherichia coli 53638]
 gi|209753268|gb|ACI74941.1| hypothetical protein ECs4739 [Escherichia coli]
 gi|209753270|gb|ACI74942.1| hypothetical protein ECs4739 [Escherichia coli]
 gi|209753272|gb|ACI74943.1| hypothetical protein ECs4739 [Escherichia coli]
 gi|209753274|gb|ACI74944.1| hypothetical protein ECs4739 [Escherichia coli]
 gi|209753276|gb|ACI74945.1| hypothetical protein ECs4739 [Escherichia coli]
 gi|209914546|dbj|BAG79620.1| diaminopimelate epimerase [Escherichia coli SE11]
 gi|226838712|gb|EEH70740.1| diaminopimelate epimerase [Escherichia sp. 1_1_43]
 gi|226902989|gb|EEH89248.1| diaminopimelate epimerase [Escherichia sp. 3_2_53FAA]
 gi|281180858|dbj|BAI57188.1| diaminopimelate epimerase [Escherichia coli SE15]
 gi|291431043|gb|EFF04038.1| diaminopimelate epimerase [Escherichia coli B185]
 gi|299878020|gb|EFI86231.1| diaminopimelate epimerase [Escherichia coli MS 196-1]
 gi|300308042|gb|EFJ62562.1| diaminopimelate epimerase [Escherichia coli MS 200-1]
 gi|300317902|gb|EFJ67686.1| diaminopimelate epimerase [Escherichia coli MS 175-1]
 gi|300355857|gb|EFJ71727.1| diaminopimelate epimerase [Escherichia coli MS 198-1]
 gi|300395869|gb|EFJ79407.1| diaminopimelate epimerase [Escherichia coli MS 69-1]
 gi|300403944|gb|EFJ87482.1| diaminopimelate epimerase [Escherichia coli MS 84-1]
 gi|300411597|gb|EFJ94907.1| diaminopimelate epimerase [Escherichia coli MS 115-1]
 gi|300420399|gb|EFK03710.1| diaminopimelate epimerase [Escherichia coli MS 182-1]
 gi|300450233|gb|EFK13853.1| diaminopimelate epimerase [Escherichia coli MS 116-1]
 gi|300455175|gb|EFK18668.1| diaminopimelate epimerase [Escherichia coli MS 21-1]
 gi|300462058|gb|EFK25551.1| diaminopimelate epimerase [Escherichia coli MS 187-1]
 gi|300524131|gb|EFK45200.1| diaminopimelate epimerase [Escherichia coli MS 119-7]
 gi|300528686|gb|EFK49748.1| diaminopimelate epimerase [Escherichia coli MS 107-1]
 gi|300841005|gb|EFK68765.1| diaminopimelate epimerase [Escherichia coli MS 124-1]
 gi|300845139|gb|EFK72899.1| diaminopimelate epimerase [Escherichia coli MS 78-1]
 gi|301075649|gb|EFK90455.1| diaminopimelate epimerase [Escherichia coli MS 146-1]
 gi|308120129|gb|EFO57391.1| diaminopimelate epimerase [Escherichia coli MS 145-7]
 gi|315254174|gb|EFU34142.1| diaminopimelate epimerase [Escherichia coli MS 85-1]
 gi|315284715|gb|EFU44160.1| diaminopimelate epimerase [Escherichia coli MS 110-3]
 gi|320639292|gb|EFX08914.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. G5101]
 gi|320655348|gb|EFX23290.1| diaminopimelate epimerase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|323934197|gb|EGB30628.1| diaminopimelate epimerase [Escherichia coli E1520]
 gi|323938945|gb|EGB35164.1| diaminopimelate epimerase [Escherichia coli E482]
 gi|323943789|gb|EGB39884.1| diaminopimelate epimerase [Escherichia coli H120]
 gi|323954016|gb|EGB49814.1| diaminopimelate epimerase [Escherichia coli H263]
 gi|323959064|gb|EGB54733.1| diaminopimelate epimerase [Escherichia coli H489]
 gi|323969350|gb|EGB64649.1| diaminopimelate epimerase [Escherichia coli TA007]
 gi|323974391|gb|EGB69519.1| diaminopimelate epimerase [Escherichia coli TW10509]
 gi|324007470|gb|EGB76689.1| diaminopimelate epimerase [Escherichia coli MS 57-2]
 gi|324014714|gb|EGB83933.1| diaminopimelate epimerase [Escherichia coli MS 60-1]
 gi|324016214|gb|EGB85433.1| diaminopimelate epimerase [Escherichia coli MS 117-3]
 gi|324111034|gb|EGC05021.1| diaminopimelate epimerase [Escherichia fergusonii B253]
 gi|324115728|gb|EGC09663.1| diaminopimelate epimerase [Escherichia coli E1167]
 gi|325499222|gb|EGC97081.1| diaminopimelate epimerase [Escherichia fergusonii ECD227]
 gi|331036214|gb|EGI08449.1| diaminopimelate epimerase [Escherichia coli H736]
 gi|331041504|gb|EGI13652.1| diaminopimelate epimerase [Escherichia coli M605]
 gi|331046815|gb|EGI18899.1| diaminopimelate epimerase [Escherichia coli M718]
 gi|331057357|gb|EGI29346.1| diaminopimelate epimerase [Escherichia coli TA143]
 gi|331062128|gb|EGI34050.1| diaminopimelate epimerase [Escherichia coli TA271]
 gi|331067563|gb|EGI38967.1| diaminopimelate epimerase [Escherichia coli TA280]
 gi|331072466|gb|EGI43798.1| diaminopimelate epimerase [Escherichia coli H591]
 gi|331077230|gb|EGI48444.1| diaminopimelate epimerase [Escherichia coli H299]
 gi|332105035|gb|EGJ08381.1| diaminopimelate epimerase [Shigella sp. D9]
          Length = 275

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|148208|gb|AAA67605.1| diaminopimelate epimerase [Escherichia coli str. K-12 substr.
           MG1655]
          Length = 275

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVXTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|227888606|ref|ZP_04006411.1| diaminopimelate epimerase [Escherichia coli 83972]
 gi|300985707|ref|ZP_07177562.1| diaminopimelate epimerase [Escherichia coli MS 45-1]
 gi|301047309|ref|ZP_07194395.1| diaminopimelate epimerase [Escherichia coli MS 185-1]
 gi|26110979|gb|AAN83163.1|AE016769_278 Diaminopimelate epimerase [Escherichia coli CFT073]
 gi|227834445|gb|EEJ44911.1| diaminopimelate epimerase [Escherichia coli 83972]
 gi|300300828|gb|EFJ57213.1| diaminopimelate epimerase [Escherichia coli MS 185-1]
 gi|300407981|gb|EFJ91519.1| diaminopimelate epimerase [Escherichia coli MS 45-1]
 gi|315293148|gb|EFU52500.1| diaminopimelate epimerase [Escherichia coli MS 153-1]
          Length = 275

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 134/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPDLIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P   +        + +       L    VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPFRAN---KVEKTYIMRAAEQTILCG--VVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|157960207|ref|YP_001500241.1| diaminopimelate epimerase [Shewanella pealeana ATCC 700345]
 gi|157845207|gb|ABV85706.1| Diaminopimelate epimerase [Shewanella pealeana ATCC 700345]
          Length = 278

 Score =  245 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 140/281 (49%), Gaps = 10/281 (3%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVD 61
           S ++ F KM G+GN  +V+D    +   + D I  L+       FDQ++L+    D  +D
Sbjct: 2   SILIQFTKMHGLGNDFMVVDGVTQNVFFSPDQIKRLADRNFGVGFDQLLLVEPPYDPDLD 61

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+ ++    +      T  G +  +  RDG ++V+
Sbjct: 62  FHYRIFNADGSEVEQCGNGARCFARFVRNKGLTHKHKIRVSTSSGKITLRLERDGKVTVN 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L+   IP         +       +          VSMGNPH +  VE D+   D
Sbjct: 122 MGIPALEPGKIPFTAK-----KVEKTYLLMASSGTYLCGAVSMGNPHCVIEVE-DVAATD 175

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  L  H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 176 VDTIGGELTNHERFPKGVNVGFMQVLNSGHIKLRVYERGAAETLACGTGACAAVVVGILQ 235

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
            K +R V V + GG L+I W      ++MTG A+  ++G++
Sbjct: 236 GKLDRNVQVDLPGGSLMINWDGEGKPLWMTGPAEHVYDGQI 276


>gi|260912680|ref|ZP_05919166.1| diaminopimelate epimerase [Pasteurella dagmatis ATCC 43325]
 gi|260633058|gb|EEX51223.1| diaminopimelate epimerase [Pasteurella dagmatis ATCC 43325]
          Length = 279

 Score =  245 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 138/285 (48%), Gaps = 10/285 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M+   + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  
Sbjct: 1   MKGQEMQFSKMHGLGNDFVVVDAITQNLYFSPETIKRLADRHRGIGFDQMLVVEPPYDPD 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
            D   RI N DGSEV  CGNG RC  RF+T +    +K  T  T  G ++     +  + 
Sbjct: 61  QDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTDKKEITVSTQIGKMILNVLENEKVQ 120

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MGEPI +   IP        ++   +      +      VVSMGNPH +  V+ D+  
Sbjct: 121 VNMGEPIWEPAKIPFVA-----NKFEKNYILRTDIQTVLCGVVSMGNPHCVVQVD-DIKT 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            ++   G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+V    
Sbjct: 175 ANVEQLGPLLESHERFPERVNAGFMQVINRRHIKLRVYERGAGETQACGSGACAAVAVGI 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                +  V V + GG L IEW      +FMTGEA   ++G + +
Sbjct: 235 MQGLLDSKVQVDLPGGSLTIEWEGVGKPLFMTGEATHVYDGVIRL 279


>gi|307546849|ref|YP_003899328.1| diaminopimelate epimerase [Halomonas elongata DSM 2581]
 gi|307218873|emb|CBV44143.1| diaminopimelate epimerase [Halomonas elongata DSM 2581]
          Length = 277

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 142/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+      +  + I  L+       FDQ++++   +D  +D  
Sbjct: 2   LLQFTKMHGLGNDFMVVDLVTQRARLRDEQIRDLADRRFGIGFDQLLVVEPPRDPDMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV++CGNG RC  RF        ++    ET  G L      DG +SVDMG
Sbjct: 62  YRIYNADGSEVENCGNGARCFARFVLDQRLTHKREIHVETAGGPLTLVVGDDGRVSVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P    + +P     D+      H   V+   +      S+GNPHA+  V+ D+    +A
Sbjct: 122 KPRFAPQDLPFEADGDR----PLHDLEVDGQQISIGVA-SLGNPHAVLRVD-DVTTAPVA 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  +  HP F   VN    +V S   + LR +ERGVG T ACG+ ACA+V        
Sbjct: 176 TLGPAIEGHPRFPRRVNAGFMQVVSAHEIRLRVYERGVGETLACGTGACAAVACGIRQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V+V + GG L I+W D   ++ MTG A++ +EG++ I
Sbjct: 236 LESPVTVHLPGGELRIDWPDIEANLIMTGPAERVFEGRVAI 276


>gi|94309098|ref|YP_582308.1| diaminopimelate epimerase [Cupriavidus metallidurans CH34]
 gi|166225747|sp|Q1LS37|DAPF_RALME RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|93352950|gb|ABF07039.1| diaminopimelate epimerase [Cupriavidus metallidurans CH34]
          Length = 288

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 95/285 (33%), Positives = 134/285 (47%), Gaps = 7/285 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T     AL+        DQI+++       VD   
Sbjct: 3   LQFTKMHGAGNDFIVLDGIHQKLDLTDAQWRALANRHFGIGADQILIVEKSSRDDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSF--TFETIRGILVAKENRDGSISVDMGE 122
           RI+N DG EV+ CGNG RC VRF+T R          E + G++  K   DG ++VDMGE
Sbjct: 63  RIVNADGGEVEHCGNGARCFVRFVTDRGMTDKQSVRVEVMNGVITLKLQDDGQVTVDMGE 122

Query: 123 PILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P L    +P        + +      G   +        VSMGNPHA+  V+ D+  + +
Sbjct: 123 PELTPARVPFIADGLPTRAEAQDTLYGLEVNGRTEWISPVSMGNPHAVQIVD-DVEQFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++  H  F   VN    ++    ++ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LQDGPVIEHHKSFPNRVNAGFMQIVDRNTVRLRVFERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
             +  V V   GG L I W      V MTG A   +EG +D+ T 
Sbjct: 242 LLDSPVKVHTHGGDLTIAWQGAGQPVQMTGPATTVFEGTIDLSTL 286


>gi|54310575|ref|YP_131595.1| diaminopimelate epimerase [Photobacterium profundum SS9]
 gi|81614797|sp|Q6LLN5|DAPF_PHOPR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|46915018|emb|CAG21793.1| putative ribulose-phosphate 3-epimerase [Photobacterium profundum
           SS9]
          Length = 276

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/278 (32%), Positives = 134/278 (48%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   +  AI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFMVVDCVTQNVFFSPAAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +     +     T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVWMKGLTNKYQVAVSTKAGKMLLKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP          ++ +I  V    +     VSMGNPH +  V+ DL   D+ +
Sbjct: 123 PEFEPSKIPF----RAKQTEKTYIMRVGERTIFCGT-VSMGNPHCVTVVD-DLELTDVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E VN    +V S   + LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLIESHERFPERVNAGFMQVVSRNEVKLRVYERGAGETQACGSGACAAVAVGYLQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
           +  V V + GG L I W      ++MTG     ++G++
Sbjct: 237 DENVKVSLPGGDLHISWAGEGKSLYMTGPVAHVFDGQI 274


>gi|88797198|ref|ZP_01112788.1| diaminopimelate epimerase [Reinekea sp. MED297]
 gi|88780067|gb|EAR11252.1| diaminopimelate epimerase [Reinekea sp. MED297]
          Length = 274

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 88/277 (31%), Positives = 130/277 (46%), Gaps = 9/277 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAI-NALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID       ++++ I           FDQ++L+        D   
Sbjct: 3   LKFTKMHGLGNDFMVIDGVTQAVELSAELIEQWADRHFGVGFDQLLLVEPPTRPDRDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV++CGNG RC  RF      ++  +   ET  G L  +   +G ++VDMG 
Sbjct: 63  RIFNADGSEVENCGNGARCFARFVLDNQLIQNTTIRVETAGGDLELRVEDNGEVTVDMGR 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP        D               +   +++GNPH +  V+ D+   D+  
Sbjct: 123 PRTRPDKIPFLA-----DDKAALYDINVLDETLSISAINVGNPHCVTRVD-DVLTADVER 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F + VN    ++    ++ LR +ERGVG T ACG+ ACA+VVA       
Sbjct: 177 LGPALEDHERFPQRVNAGFMQIVDRSNIRLRVFERGVGETLACGTGACAAVVAGVLNGWL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +  VSV + GG L I W    ++ MTG A + +EG +
Sbjct: 237 DHTVSVTLPGGKLTIHWAGEGNILMTGPATRVYEGVI 273


>gi|322834931|ref|YP_004214958.1| diaminopimelate epimerase [Rahnella sp. Y9602]
 gi|321170132|gb|ADW75831.1| diaminopimelate epimerase [Rahnella sp. Y9602]
          Length = 274

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHRGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNKRDIRVSTQTGRMVLTVTEDEEVQVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ + + +P          ++ +I       +    VVSMGNPH +  V+ D+   ++  
Sbjct: 121 PVFEPQQVPF----RAAKPEKTYILRAEERTVFCG-VVSMGNPHCVLQVD-DVLTAEVEV 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+   ++ S ES+ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPMLESHDRFPERVNVGFMQILSPESVKLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVQVELPGGSLDIRWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|300113123|ref|YP_003759698.1| diaminopimelate epimerase [Nitrosococcus watsonii C-113]
 gi|299539060|gb|ADJ27377.1| diaminopimelate epimerase [Nitrosococcus watsonii C-113]
          Length = 276

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +VID       +T+  +  ++        DQ++L+      ++D   
Sbjct: 3   IAFTKMQGLGNDFVVIDAFSQPLFLTASQVRWIANRRLGIGCDQVLLVTPASSPAIDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFT--FETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  R      T   +T  GI+  +   DG I+VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFARFVRERKLTDKNTLRVQTAGGIIQLQLEPDGQITVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P    + IP     +         G    +      VVS+GNPH +  V   +    +A 
Sbjct: 123 PRFAPQQIPFKVDHEADYYSLELDGQQLEIG-----VVSLGNPHCVLRVPA-VDAAPVAH 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           +G LL  HP F + VN+  A++ S   L LR +ERG G T ACG+ ACA+VV        
Sbjct: 177 WGPLLENHPCFPQRVNVGFAQIVSPSHLRLRVYERGAGETPACGTGACAAVVIGKRRGWL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W  +   V+M+G A+  +EG  D+
Sbjct: 237 SGQVKVDLPGGRLGIRWEGDGQSVWMSGPAETVFEGSFDL 276


>gi|288941803|ref|YP_003444043.1| diaminopimelate epimerase [Allochromatium vinosum DSM 180]
 gi|288897175|gb|ADC63011.1| diaminopimelate epimerase [Allochromatium vinosum DSM 180]
          Length = 278

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 91/279 (32%), Positives = 134/279 (48%), Gaps = 8/279 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +V D      ++ +     L+        DQI+L+   +    D   
Sbjct: 3   LRFTKMQGLGNDFVVFDGVRQRVDLDAGFARLLADRRFGIGCDQILLVEPPRLPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +    +      T  G +      DG + VDMG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVRDQGLTDKDEIPVGTAAGAIRLYLEPDGQVRVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP +   +  D           L +     +SMGNPHA+  V+ D+    +A+
Sbjct: 123 PAFTPARIPFSVETETADATYPLEIEDRTLTIG---ALSMGNPHAVLIVD-DVESAPVAT 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  HP F   VN    ++    ++ LR  ERG G T ACG+ ACA+VV+     + 
Sbjct: 179 LGPLIEHHPDFPRRVNAGFMQILGPNAIRLRVHERGAGETLACGTGACAAVVSGRRRGRL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLD 280
           +  V V + GG L+IEW    H V+MTG A   +EG+++
Sbjct: 239 DERVRVALPGGELVIEWRGPGHPVWMTGPAVNVFEGEIE 277


>gi|209965482|ref|YP_002298397.1| diaminopimelate epimerase [Rhodospirillum centenum SW]
 gi|254767118|sp|B6IP82|DAPF_RHOCS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|209958948|gb|ACI99584.1| diaminopimelate epimerase [Rhodospirillum centenum SW]
          Length = 291

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 109/277 (39%), Positives = 156/277 (56%), Gaps = 9/277 (3%)

Query: 5   MVD-FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
           MV  F KM G+GN  +V+D R     +T+ A  A++        DQI+L+   +  + D 
Sbjct: 1   MVRRFLKMHGLGNDFVVLDARRDPLPLTTAAARAIADRHTGVGCDQIVLLEPPRHPAADL 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           F+RI+N DGSE  +CGN  RCV   +     R   T ET  G+L  +   DGS++VDMG 
Sbjct: 61  FMRILNPDGSESGACGNATRCVASLVADGSGRAEVTVETATGLLRCRLRADGSVTVDMGP 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
             LDW  IPLA + D +        P     L++   V MGNPHA+FFV+ D    DLA+
Sbjct: 121 ARLDWTQIPLAAAHDTLRV------PAGAGPLQDACCVGMGNPHAVFFVD-DAEAVDLAT 173

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H +F +  N+ +A+V + + + +R WERG G+T ACGS +CA++VA+     T
Sbjct: 174 LGPVLEHHSLFPQRCNIEVAQVLAPDHIRMRVWERGAGITRACGSGSCATLVAAARRGLT 233

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            RA  +++ GG L IEWH + HV MTG     + G+L
Sbjct: 234 GRAAWIELDGGRLWIEWHGDGHVLMTGPVATAFTGEL 270


>gi|315125205|ref|YP_004067208.1| diaminopimelate epimerase [Pseudoalteromonas sp. SM9913]
 gi|315013718|gb|ADT67056.1| diaminopimelate epimerase [Pseudoalteromonas sp. SM9913]
          Length = 276

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIKKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC  RF+  +    +   +  T  G L     +DG ++V+MG
Sbjct: 62  YRIFNADGHEVEQCGNGARCFARFVRMKGLTNKHKISVSTKSGNLTLYIEKDGQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IPL  +                        VSMGNPH +  V+ D+    ++
Sbjct: 122 HPNFEPSKIPLKATKR-----ELTYIIRAEEHTVFSGAVSMGNPHCVMEVD-DIETAQVS 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     +K
Sbjct: 176 TLGPLLENHERFPQRANIGFMQVISQEHIKLRVWERGVSETLACGTGACAAMVIGFIQNK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V + GG L + W    H V MTG A+  ++G++ +
Sbjct: 236 LTSTVQVDLPGGSLQVRWSGEGHPVRMTGPAEHVFDGQVAL 276


>gi|206580980|ref|YP_002241128.1| diaminopimelate epimerase [Klebsiella pneumoniae 342]
 gi|238892409|ref|YP_002917143.1| diaminopimelate epimerase [Klebsiella pneumoniae NTUH-K2044]
 gi|262040879|ref|ZP_06014105.1| diaminopimelate epimerase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|290513163|ref|ZP_06552525.1| diaminopimelate epimerase [Klebsiella sp. 1_1_55]
 gi|329997492|ref|ZP_08302794.1| diaminopimelate epimerase [Klebsiella sp. MS 92-3]
 gi|206570038|gb|ACI11814.1| diaminopimelate epimerase [Klebsiella pneumoniae 342]
 gi|238544725|dbj|BAH61076.1| diaminopimelate epimerase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259041768|gb|EEW42813.1| diaminopimelate epimerase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|289774374|gb|EFD82380.1| diaminopimelate epimerase [Klebsiella sp. 1_1_55]
 gi|328539060|gb|EGF65099.1| diaminopimelate epimerase [Klebsiella sp. MS 92-3]
          Length = 275

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/281 (30%), Positives = 131/281 (46%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSQVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G ++  H  F E  N+   +V     + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVMESHERFPERANIGFMQVVGRSHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 LAETVRVELPGGRLDIAWKGPGQPLFMTGPAAHVYDGFIHL 275


>gi|92115228|ref|YP_575156.1| diaminopimelate epimerase [Chromohalobacter salexigens DSM 3043]
 gi|122419111|sp|Q1QSV1|DAPF_CHRSD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91798318|gb|ABE60457.1| diaminopimelate epimerase [Chromohalobacter salexigens DSM 3043]
          Length = 277

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 136/282 (48%), Gaps = 10/282 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +VID+      + ++ I  L+       FDQ++L+   +D  +D  
Sbjct: 2   LLHFTKMHGLGNDFVVIDLITQRARLDTERIRQLADRHVGIGFDQLLLVEPPRDPEMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV++CGNG RC  RF+       ++    ET  G L  +   D  I VDMG
Sbjct: 62  YRIFNADGNEVENCGNGARCFARFVRDNRLTHKREIRVETQAGPLTLRVEDDERIRVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    +++P     D                  +   VSMGNPHA+  V+ D+    +A
Sbjct: 122 VPRFAPEVVPFDAPADAPA-----HCLEVDGETWDIGAVSMGNPHAVLRVD-DVAQAPVA 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+ +HP F  GVN+   +V S     LR +ERG G T ACG+ ACA+V        
Sbjct: 176 RLGPLIERHPRFPRGVNVGFLQVVSRHEARLRVFERGSGETLACGTGACAAVAHGIRRGW 235

Query: 242 TNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
               V V + GG L + W   +  + MTG A   +EG++ + 
Sbjct: 236 LESPVDVHLPGGTLTLAWPAPDASLMMTGPATSVFEGRIALP 277


>gi|187922356|ref|YP_001893998.1| diaminopimelate epimerase [Burkholderia phytofirmans PsJN]
 gi|229807509|sp|B2T1P5|DAPF_BURPP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|187713550|gb|ACD14774.1| Diaminopimelate epimerase [Burkholderia phytofirmans PsJN]
          Length = 299

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 89/285 (31%), Positives = 137/285 (48%), Gaps = 9/285 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      N+T   + AL+        DQ++L+     A VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGADQLLLVEKPTVAGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+       ++S   +  +G +      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKGTITLTMQENGEVLVDMGT 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ D + +P A    +   +          +   R   VVSMGNPHA+  V+ D+  + +
Sbjct: 123 PVFDPERVPFATKGLQGRGEGADTLWPLDVNGTTRWISVVSMGNPHAVQVVD-DVEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LVEGPVIERHARFPQRVNAGFMQIVGRSEIKLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWH---DNNHVFMTGEAKKEWEGKLDIK 282
             +  V V   GG L I W     +  + M G A   +EG++++ 
Sbjct: 242 LLDAPVLVHTHGGKLTITWDAAQADQPLLMAGPAATVFEGEIELP 286


>gi|307823077|ref|ZP_07653307.1| diaminopimelate epimerase [Methylobacter tundripaludum SV96]
 gi|307735852|gb|EFO06699.1| diaminopimelate epimerase [Methylobacter tundripaludum SV96]
          Length = 275

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 137/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +VID    H ++T + I  +S       FDQ++LI    +A+ D  
Sbjct: 1   MINFTKMHGLGNDFVVIDAINQHIDLTPEQIRLMSDRHFGIGFDQLLLIEKAVNANADFK 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV  CGNG RC  RF+  +    +     +T  G L+ + + D  I+V+MG
Sbjct: 61  YRIFNADGGEVAQCGNGARCFARFVRDKKLSDKNEICVDTNSGQLLLRFDADNLITVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IPL    +             +   +    VSMGNPHA+  V  D+    +A
Sbjct: 121 IPRHAPAEIPLLAEEESRFYTVLV-----NETEKAFGAVSMGNPHAVIQV-TDVKTAPVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  H  F E VN+   +V   + + LR +ERG   T ACGS ACA+VV     + 
Sbjct: 175 ELGKALESHTFFPERVNVGFMQVVDRQHIKLRVYERGAAETLACGSGACAAVVIGIEHNL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +  VSV + GG L I W      V MTG A   +EG++ +
Sbjct: 235 LDHTVSVDLPGGTLSINWLGRGEPVLMTGPAISVFEGQITL 275


>gi|110807500|ref|YP_691020.1| diaminopimelate epimerase [Shigella flexneri 5 str. 8401]
 gi|161485855|ref|NP_709616.2| diaminopimelate epimerase [Shigella flexneri 2a str. 301]
 gi|161486405|ref|NP_839066.2| diaminopimelate epimerase [Shigella flexneri 2a str. 2457T]
 gi|194434026|ref|ZP_03066296.1| diaminopimelate epimerase [Shigella dysenteriae 1012]
 gi|122366275|sp|Q0SZ00|DAPF_SHIF8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|110617048|gb|ABF05715.1| diaminopimelate epimerase [Shigella flexneri 5 str. 8401]
 gi|194417684|gb|EDX33783.1| diaminopimelate epimerase [Shigella dysenteriae 1012]
 gi|313647149|gb|EFS11604.1| diaminopimelate epimerase [Shigella flexneri 2a str. 2457T]
 gi|332085006|gb|EGI90188.1| diaminopimelate epimerase [Shigella dysenteriae 155-74]
 gi|332750961|gb|EGJ81366.1| diaminopimelate epimerase [Shigella flexneri 4343-70]
 gi|332751051|gb|EGJ81455.1| diaminopimelate epimerase [Shigella flexneri K-671]
 gi|332751943|gb|EGJ82338.1| diaminopimelate epimerase [Shigella flexneri 2747-71]
 gi|332764347|gb|EGJ94582.1| diaminopimelate epimerase [Shigella flexneri 2930-71]
 gi|332996987|gb|EGK16605.1| diaminopimelate epimerase [Shigella flexneri VA-6]
 gi|332997943|gb|EGK17550.1| diaminopimelate epimerase [Shigella flexneri K-218]
 gi|333013787|gb|EGK33150.1| diaminopimelate epimerase [Shigella flexneri K-227]
 gi|333019510|gb|EGK38791.1| diaminopimelate epimerase [Shigella flexneri K-304]
          Length = 274

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 133/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 DEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|307728184|ref|YP_003905408.1| diaminopimelate epimerase [Burkholderia sp. CCGE1003]
 gi|307582719|gb|ADN56117.1| diaminopimelate epimerase [Burkholderia sp. CCGE1003]
          Length = 287

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/285 (30%), Positives = 138/285 (48%), Gaps = 9/285 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      N++   + AL+        DQ++L+       VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLSPAQVRALADRHFGVGADQLLLVEKPTVEGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+       ++S   +  +G +      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKGTITLTMQENGEVLVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ + + +P A    +  R+          +   R   VVSMGNPHA+  V+ D+  + +
Sbjct: 123 PVFEPERVPFATKGIQGRREGADTLWPLDVNGTTRWISVVSMGNPHAVQVVD-DVEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LVEGPVIERHARFPQRVNAGFMQIVGRSEIKLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWH---DNNHVFMTGEAKKEWEGKLDIK 282
             +  V V   GG L I W    ++  + M G A   ++G++++ 
Sbjct: 242 LLDSPVLVHTHGGKLTISWDSSQESEPLLMAGPATTVFQGEIELA 286


>gi|320178100|gb|EFW53080.1| Diaminopimelate epimerase [Shigella boydii ATCC 9905]
          Length = 274

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERVNIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 DEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|220933237|ref|YP_002512136.1| Diaminopimelate epimerase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254767121|sp|B8GT89|DAPF_THISH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219994547|gb|ACL71149.1| Diaminopimelate epimerase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 278

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 96/282 (34%), Positives = 139/282 (49%), Gaps = 12/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIH-DFQDASVDAF 63
           + F+KM G+GN  +VID      +++ D +  L+        DQ++L+      A+ D  
Sbjct: 3   IQFSKMHGLGNDFVVIDAIHQPVDLSPDQVRLLAHRRFGVGCDQVLLVERPSDPAAADFR 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC   F+  R    +     ET  GI+  +   DG ++VDMG
Sbjct: 63  YRIFNADGNEVEQCGNGARCFAVFVRERGLTAKDHIPVETAAGIIHLQVQPDGQVTVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L    IP               G    +       VSMGNPHA+  V+ ++    +A
Sbjct: 123 PPRLKPWQIPFEAESAMTSYPLEVEGETYEIG-----AVSMGNPHAVLRVD-NVQTAPVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  HP F   VN+   +V S   + LR +ERGVG T ACG+ ACA+VV+      
Sbjct: 177 RLGPLIEAHPRFPRHVNVGFMQVVSPGEIRLRVYERGVGETLACGTGACAAVVSGRIQGL 236

Query: 242 TNRAVSVKMLGGGLLIEW--HDNNHVFMTGEAKKEWEGKLDI 281
            +  V+V + GG L+I W   +   V MTG A + + G +DI
Sbjct: 237 LDETVAVDLPGGRLVINWAGQEEAPVMMTGPATQVFTGSIDI 278


>gi|332534420|ref|ZP_08410260.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036154|gb|EGI72629.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 276

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIKKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+  +    +   +  T  G L     +DG ++V+MG
Sbjct: 62  YRIFNADGTEVEQCGNGARCFARFVRMKGLTNKHKISVSTKSGNLTLYIEKDGQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IPL  S                        VSMGNPH +  V+ D+    + 
Sbjct: 122 HPNFEPSKIPLKASKR-----ELTYIIRTQEHTVFSGAVSMGNPHCVLEVD-DVTTAQVD 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     +K
Sbjct: 176 ILGPLLENHERFPQKANIGFMQVVSQEHIKLRVWERGVNETLACGTGACAAMVIGHMQNK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +  V V + GG L + W    H V MTG A+  ++G++ +
Sbjct: 236 LSTTVQVDLPGGTLQVRWSGEGHPVRMTGPAEHVFDGQVAL 276


>gi|332084674|gb|EGI89862.1| diaminopimelate epimerase [Shigella boydii 5216-82]
          Length = 274

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC   F+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFACFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 DEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|157144437|ref|YP_001451756.1| diaminopimelate epimerase [Citrobacter koseri ATCC BAA-895]
 gi|157081642|gb|ABV11320.1| hypothetical protein CKO_00151 [Citrobacter koseri ATCC BAA-895]
          Length = 275

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTDDELVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ ++    + 
Sbjct: 121 EPNFEPAQVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-NIDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHVYDGFIHL 275


>gi|257453687|ref|ZP_05618974.1| diaminopimelate epimerase [Enhydrobacter aerosaccus SK60]
 gi|257448921|gb|EEV23877.1| diaminopimelate epimerase [Enhydrobacter aerosaccus SK60]
          Length = 310

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 93/299 (31%), Positives = 145/299 (48%), Gaps = 11/299 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+     ++T + +  L        FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLHLTKELVALLGDRHLGIGFDQLLIVEPPSRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEVQ CGNG RC  RF+ +R    ++    ET  GI+    +  G + VDMG
Sbjct: 62  YRIFNKDGSEVQQCGNGARCFARFVQARKLSFKQRIRVETASGIITLSTDDYGWVKVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP         ++ + +           +V +MGNPHA+  V+ D+   ++ 
Sbjct: 122 KPKFEPDEIPFTPKTITKVQNSYRLNVDGTPVTL--YVANMGNPHAVIKVD-DVLTAEVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V        
Sbjct: 179 KLGKAIESHPAFPERVNVGFMQVMNNRHIRLRVYERGVGETQACGTGACAAVATGVREGW 238

Query: 242 TNRAVSVK--MLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD---IKTGKWIKKNEDDEA 295
            +  V ++  + GG L I W +   V+MTG A   +EG      +  G  +K      +
Sbjct: 239 LDEGVDIRAQLYGGSLAIRWQEGYPVYMTGPATFVYEGVFSPEGLMAGAGLKFAPAQSS 297


>gi|170693975|ref|ZP_02885131.1| Diaminopimelate epimerase [Burkholderia graminis C4D1M]
 gi|170141047|gb|EDT09219.1| Diaminopimelate epimerase [Burkholderia graminis C4D1M]
          Length = 300

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 89/289 (30%), Positives = 140/289 (48%), Gaps = 10/289 (3%)

Query: 3   SSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASV 60
           S M + F KM G GN  +V+D      N+T + + AL+        DQ++L+       V
Sbjct: 12  SVMKLKFTKMHGAGNDFVVLDGYTQALNLTPEQVRALADRHFGVGADQLLLVEKPTVDGV 71

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISV 118
           D   RI NCDG EV+ CGNG RC V+F+       ++S   +   G +      +G + V
Sbjct: 72  DFRYRIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQNGTITLTMQENGEVLV 131

Query: 119 DMGEPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P+ + + +P A    +  R+          +   R   VVSMGNPHA+  V+ D+ 
Sbjct: 132 DMGSPVFEPERVPFATKGLQGRREGADTLWPLDVNGTTRWISVVSMGNPHAVQVVD-DVE 190

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            + +   G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A 
Sbjct: 191 AFPVLVEGPVIERHARFPQKVNAGFMQIVGRSEIKLRVYERGAGETLACGTGACAAVAAG 250

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH---DNNHVFMTGEAKKEWEGKLDIK 282
                 +  V V   GG L I W    ++  + M G A   ++G++++ 
Sbjct: 251 IRRGLLDAPVLVHTHGGKLTISWDSNKESEPLLMAGPATTVFQGEIELA 299


>gi|114319225|ref|YP_740908.1| diaminopimelate epimerase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312761|sp|Q0ACL9|DAPF_ALHEH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|114225619|gb|ABI55418.1| diaminopimelate epimerase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 279

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 95/283 (33%), Positives = 141/283 (49%), Gaps = 12/283 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F KM+G+GN  +VID        + + I  ++        DQ++L    + +  D   
Sbjct: 3   VRFTKMQGLGNDFVVIDAVRQPVEPSPEQIRHIADRRYGVGCDQVLLATPARRSQADFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM----KRKSFTFETIRGILVAKENRDGSISVDM 120
            I N DGS+ + CGNG+RC+ RFL  R      R     ETI G+   +   DG ++VDM
Sbjct: 63  LIFNPDGSQAEHCGNGVRCLARFLDDRGLVPAGRHELVIETINGLSRVRLCDDGPVTVDM 122

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P+L+   IP        + +    G V  L       VSMGNPHA+  V+ D+    +
Sbjct: 123 GAPVLEPPHIPFRAPSRAREYELEVEGQVVRLG-----AVSMGNPHAVLRVD-DVDSAPV 176

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G  +  H  F   VN+   +V +   + LR +ERG G T ACG+ ACA+VV+     
Sbjct: 177 ETLGPAIESHSRFPRRVNVGFMQVLTPTHIRLRVYERGAGETLACGTGACAAVVSGRLRG 236

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIK 282
               AV V + GG L+I W  +  HV+MTG A+  +EG++ + 
Sbjct: 237 WLEEAVDVDLPGGRLVIHWAGDGEHVWMTGPAETVFEGEIRLD 279


>gi|119469652|ref|ZP_01612521.1| diaminopimelate epimerase [Alteromonadales bacterium TW-7]
 gi|119446899|gb|EAW28170.1| diaminopimelate epimerase [Alteromonadales bacterium TW-7]
          Length = 276

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIKKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+  +    +   +  T  G L     +DG ++V+MG
Sbjct: 62  YRIFNADGTEVEQCGNGARCFARFVRMKGLTNKHKISVSTKSGNLTLYIEKDGQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IPL  S                        VSMGNPH +  V+ D+    + 
Sbjct: 122 HPNFEPSKIPLKASKR-----ELTYIIRAEEHTVFSGAVSMGNPHCVIEVD-DITTAQVD 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V      K
Sbjct: 176 VLGPLLENHERFPQRANIGFMQVISQEHIKLRVWERGVNETLACGTGACAAMVIGHMQSK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            + AV V + GG L I W    H V MTG A+  ++G++ +
Sbjct: 236 LSSAVQVDLPGGTLQIRWSGEGHPVRMTGPAEHVFDGQVAL 276


>gi|327250659|gb|EGE62365.1| diaminopimelate epimerase [Escherichia coli STEC_7v]
          Length = 274

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|306815152|ref|ZP_07449305.1| diaminopimelate epimerase [Escherichia coli NC101]
 gi|305851521|gb|EFM51975.1| diaminopimelate epimerase [Escherichia coli NC101]
          Length = 274

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|163859105|ref|YP_001633403.1| diaminopimelate epimerase [Bordetella petrii DSM 12804]
 gi|163262833|emb|CAP45136.1| dapF [Bordetella petrii]
          Length = 304

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 98/294 (33%), Positives = 140/294 (47%), Gaps = 14/294 (4%)

Query: 5   MV-DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
           M+ +F KM G GN  +V+D      +IT +   AL+        DQI+L+        D 
Sbjct: 7   MIWNFTKMHGAGNDFVVLDGVRQAIDITPERARALADRHFGIGADQILLVEPPTHPEADF 66

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC VRF+  +    R     E   GILV  E  D  ++VDM
Sbjct: 67  RYRIFNADGSEVEHCGNGARCFVRFVHEQRLSSRNPLRAEIATGILVLDEGDDEQVTVDM 126

Query: 121 GEPILDWKLIPL--------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
           G    D   +P         A+  D + +      P           V++ NPHA+  V+
Sbjct: 127 GVTRFDPAALPFDTAGLASAAQGSDTLWQLDLPDAPPGLPRSVQVSAVAISNPHAVQQVD 186

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
            D+    +A+ G L+ +HP F+  VN    +V    S+ LR +ERG G T ACG+ ACA+
Sbjct: 187 -DVDAAPVAAIGPLIERHPRFARRVNAGFMQVLDRHSIRLRVYERGAGETLACGTGACAA 245

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
           V A       +  V V   GG L ++W+   H+ MTG A   + G++DI    +
Sbjct: 246 VAAGIRRGLLDSPVRVHTRGGTLTVDWN-GEHLRMTGPATSVFTGQVDIDKLVF 298


>gi|315633489|ref|ZP_07888779.1| diaminopimelate epimerase [Aggregatibacter segnis ATCC 33393]
 gi|315477531|gb|EFU68273.1| diaminopimelate epimerase [Aggregatibacter segnis ATCC 33393]
          Length = 274

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    +D I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFPADTIKRLADRHRGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T  G +V     D ++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQNGKMVLTVKEDDNVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  V+ D++  ++A 
Sbjct: 121 PIWEPNKIPFTA-----NKFEKNYILRTEIQTVLCGAVSMGNPHCVVQVD-DIHTANVAQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V + + + LR  ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQVVNRKHIKLRVHERGAGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG LLIEW    H ++MTG A   ++G + +
Sbjct: 235 DNEVQVDLPGGSLLIEWQGEGHPLYMTGSATHVYDGVIYL 274


>gi|291612620|ref|YP_003522777.1| diaminopimelate epimerase [Sideroxydans lithotrophicus ES-1]
 gi|291582732|gb|ADE10390.1| diaminopimelate epimerase [Sideroxydans lithotrophicus ES-1]
          Length = 276

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D       ++ + I  ++        DQ++L+   Q    D   
Sbjct: 3   LKFTKMHGAGNDFVVLDGVRQSVALSPEQIRYIADRHFGIGCDQVLLVEKTQRDEADFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+  +    ++    ET  G++  +   DG I+V+MG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVRFVHDQNLTSKREIVVETKSGLISPRLEEDGRITVNMGL 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI D   IP        D                  VVSMGNPHA+  V+ D+    +A+
Sbjct: 123 PIFDPAQIPFV-----SDSTEVIQPLQVGNESVQITVVSMGNPHAVQVVD-DVETAPVAT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F + VN+   +V   E + LR +ERG G T +CG+ ACA+VVA       
Sbjct: 177 QGPFIEIHPRFPKRVNVGYMQVVDREHIRLRVYERGAGETLSCGTGACAAVVAGIRRKLL 236

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +  V V   GG L I W  + + V MTG A   +EG++++
Sbjct: 237 DNTVHVATRGGTLSITWAGERSPVMMTGPAITVFEGEINL 276


>gi|187734112|ref|YP_001882503.1| diaminopimelate epimerase [Shigella boydii CDC 3083-94]
 gi|229813249|sp|B2TUW5|DAPF_SHIB3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|187431104|gb|ACD10378.1| diaminopimelate epimerase [Shigella boydii CDC 3083-94]
          Length = 274

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ+++I    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVIEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVS+GNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSIGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|295095178|emb|CBK84268.1| diaminopimelate epimerase [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 278

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 90/285 (31%), Positives = 135/285 (47%), Gaps = 11/285 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDAS 59
           M+  M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  
Sbjct: 1   MEQ-MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHVGVGFDQLLVVEPPYDPD 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + 
Sbjct: 60  LDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTDDELVR 119

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MGEP  D   +P      + ++                 VVSMGNPH +  V+ D+  
Sbjct: 120 VNMGEPNFDPSAVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVQT 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             + + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V    
Sbjct: 174 AAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGI 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                   V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 234 SQGLLAEEVRVELPGGRLDIAWKGAGHPLYMTGPATHVYDGFIHL 278


>gi|187927149|ref|YP_001897636.1| diaminopimelate epimerase [Ralstonia pickettii 12J]
 gi|309780149|ref|ZP_07674900.1| diaminopimelate epimerase [Ralstonia sp. 5_7_47FAA]
 gi|229813252|sp|B2UD25|DAPF_RALPJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|187724039|gb|ACD25204.1| Diaminopimelate epimerase [Ralstonia pickettii 12J]
 gi|308920852|gb|EFP66498.1| diaminopimelate epimerase [Ralstonia sp. 5_7_47FAA]
          Length = 292

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 94/286 (32%), Positives = 134/286 (46%), Gaps = 7/286 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      + T +   A++        DQ++L+       VD   
Sbjct: 3   LHFTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIADRHFGVGADQLLLVERSTRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG 
Sbjct: 63  RIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNGIATLTMQDDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P        +   D        +        VSMGNPHA+  V+ D   + +
Sbjct: 123 PVFEAARLPFLPEGLPTRTQGDDTQHALQINGRTEWLSTVSMGNPHAVQIVD-DTEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  H +F   VN    ++    S+ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKTGK 285
             +  V V   GG L I W  +   V MTG A   +EG LD+   K
Sbjct: 242 LLDSPVKVATHGGDLTIAWAGDGQPVMMTGPATTVFEGTLDLDALK 287


>gi|323524463|ref|YP_004226616.1| diaminopimelate epimerase [Burkholderia sp. CCGE1001]
 gi|323381465|gb|ADX53556.1| diaminopimelate epimerase [Burkholderia sp. CCGE1001]
          Length = 287

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 88/285 (30%), Positives = 137/285 (48%), Gaps = 9/285 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      N+T   + AL+        DQ++L+       VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGADQLLLVEKPTVDGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+       ++S   +  +G +      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKGTITLTMQENGEVLVDMGL 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ + + +P A    +  R+          +   R   VVSMGNPHA+  V+ D+  + +
Sbjct: 123 PVFEPERVPFATKGLEGRREGADTLWPLDVNGTTRWISVVSMGNPHAVQVVD-DVEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LVEGPVIERHARFPQRVNAGFMQIVGRSEIRLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDN---NHVFMTGEAKKEWEGKLDIK 282
             +  V V   GG L I W  N     + M G A   ++G++++ 
Sbjct: 242 LLDAPVLVHTHGGTLTISWDSNKASEPLLMAGPATTVFQGEIELA 286


>gi|227357158|ref|ZP_03841527.1| diaminopimelate epimerase [Proteus mirabilis ATCC 29906]
 gi|227162690|gb|EEI47657.1| diaminopimelate epimerase [Proteus mirabilis ATCC 29906]
          Length = 274

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLANRHTGVGFDQLLVVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +      +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKREIKVSTQSGRMTLHVMDNEDVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +     + I  +    L    VVSMGNPH +  VE D+   ++ S
Sbjct: 121 PEFEPQKVPFRA---QKVEKTYIIRAMERTVLCG--VVSMGNPHCVIQVE-DIKTAEVES 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G++L +H  F E  N+   +V    +L LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGSVLEQHERFPERANIGFMQVVDRNTLHLRVFERGAGETQACGSGACAAVAVGISQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +R V V + GG L IEW    + ++MTG A   ++G + +
Sbjct: 235 DRKVKVNLPGGSLSIEWKGTGNPLYMTGPAVHIYDGTIQL 274


>gi|269103728|ref|ZP_06156425.1| diaminopimelate epimerase [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163626|gb|EEZ42122.1| diaminopimelate epimerase [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 276

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 91/278 (32%), Positives = 141/278 (50%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + D +  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFMVVDAVTQNVFFSPDMVRRLADRHRGIGFDQLLIVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMLLKLENDDQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI D   IP   +      ++ +I       +      SMGNPH +  V+ D+   D+ +
Sbjct: 123 PIFDPAKIPFRAN----QAEKTYILRAGDQTVFCG-AASMGNPHCVTVVD-DVLTADVET 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN+   +V S   + LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNVGFMQVISRSEVKLRVYERGAGETQACGSGACAAVAIGRQQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
           +  V+V + GG L I W+ N  ++FMTG     ++G++
Sbjct: 237 DEEVTVSLPGGDLRIRWNGNGSNLFMTGPVAHVFDGQV 274


>gi|161505545|ref|YP_001572657.1| diaminopimelate epimerase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160866892|gb|ABX23515.1| hypothetical protein SARI_03710 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 275

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTTNGRIVLSVTEDELVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ ++    + 
Sbjct: 121 EPNFEPAQVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-NVDTAAVD 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHVYDGFIHL 275


>gi|283834574|ref|ZP_06354315.1| diaminopimelate epimerase [Citrobacter youngae ATCC 29220]
 gi|291069702|gb|EFE07811.1| diaminopimelate epimerase [Citrobacter youngae ATCC 29220]
          Length = 274

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSQVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVDTATVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHVYDGFIHL 274


>gi|237809855|ref|YP_002894295.1| diaminopimelate epimerase [Tolumonas auensis DSM 9187]
 gi|259595064|sp|C4LDU8|DAPF_TOLAT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|237502116|gb|ACQ94709.1| diaminopimelate epimerase [Tolumonas auensis DSM 9187]
          Length = 276

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 137/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F+KM G+GN  +V+D         ++ +  L        FDQ++L+    D  +D  
Sbjct: 2   LIQFSKMHGLGNDFVVVDGVTQKVFFNAETLKRLGDRHFGIGFDQLLLVEPPYDPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMG 121
            RI N DGSEVQ CGNG RC  RF+  +           T+ G +V +   +  ++V+MG
Sbjct: 62  YRIFNADGSEVQQCGNGARCFARFVRLKGLTNKDRIAVSTVSGRIVLQLEDNDQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IP       +  ++ ++  V    +    VVSMGNPH +  V   +    + 
Sbjct: 122 VPEFEPAKIPF----RALKAEKLYLLRVAEQTVMCG-VVSMGNPHCVIEV-PSVKDAPVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  L     F E +N+    V S   ++LR +ERG G T ACG+ ACA+VV      K
Sbjct: 176 TLGPKLESFDRFPERINVGFMEVVSASEINLRVYERGAGETLACGTGACAAVVVGIQQEK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V + GG L I W+     V+MTG A+  ++G++++
Sbjct: 236 LKGRVKVNLPGGSLYISWNGPGSPVYMTGPAEHVFDGQIEL 276


>gi|89110210|ref|AP_003990.1| diaminopimelate epimerase [Escherichia coli str. K-12 substr.
           W3110]
 gi|90111650|ref|NP_418254.2| diaminopimelate epimerase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|110644134|ref|YP_671864.1| diaminopimelate epimerase [Escherichia coli 536]
 gi|157158618|ref|YP_001465293.1| diaminopimelate epimerase [Escherichia coli E24377A]
 gi|157163286|ref|YP_001460604.1| diaminopimelate epimerase [Escherichia coli HS]
 gi|161367483|ref|NP_290438.2| diaminopimelate epimerase [Escherichia coli O157:H7 EDL933]
 gi|161950007|ref|YP_405361.2| diaminopimelate epimerase [Shigella dysenteriae Sd197]
 gi|161984820|ref|YP_410107.2| diaminopimelate epimerase [Shigella boydii Sb227]
 gi|161986412|ref|YP_312740.2| diaminopimelate epimerase [Shigella sonnei Ss046]
 gi|162139740|ref|NP_312766.2| diaminopimelate epimerase [Escherichia coli O157:H7 str. Sakai]
 gi|168768090|ref|ZP_02793097.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4486]
 gi|168786647|ref|ZP_02811654.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC869]
 gi|168801127|ref|ZP_02826134.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC508]
 gi|170022168|ref|YP_001727122.1| diaminopimelate epimerase [Escherichia coli ATCC 8739]
 gi|170083292|ref|YP_001732612.1| diaminopimelate epimerase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170683935|ref|YP_001746126.1| diaminopimelate epimerase [Escherichia coli SMS-3-5]
 gi|187776119|ref|ZP_02800647.2| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4196]
 gi|188025000|ref|ZP_02775401.2| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4113]
 gi|189010227|ref|ZP_02805715.2| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4076]
 gi|189401857|ref|ZP_02778713.2| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4401]
 gi|189404374|ref|ZP_02788941.2| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4501]
 gi|191166063|ref|ZP_03027898.1| diaminopimelate epimerase [Escherichia coli B7A]
 gi|191174260|ref|ZP_03035769.1| diaminopimelate epimerase [Escherichia coli F11]
 gi|193065687|ref|ZP_03046752.1| diaminopimelate epimerase [Escherichia coli E22]
 gi|193067957|ref|ZP_03048922.1| diaminopimelate epimerase [Escherichia coli E110019]
 gi|194429206|ref|ZP_03061734.1| diaminopimelate epimerase [Escherichia coli B171]
 gi|194438660|ref|ZP_03070748.1| diaminopimelate epimerase [Escherichia coli 101-1]
 gi|195938098|ref|ZP_03083480.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4024]
 gi|208809709|ref|ZP_03252046.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4206]
 gi|208812090|ref|ZP_03253419.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4045]
 gi|208820197|ref|ZP_03260517.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4042]
 gi|209399378|ref|YP_002273326.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4115]
 gi|217326039|ref|ZP_03442123.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. TW14588]
 gi|218550967|ref|YP_002384758.1| diaminopimelate epimerase [Escherichia fergusonii ATCC 35469]
 gi|218556372|ref|YP_002389286.1| diaminopimelate epimerase [Escherichia coli IAI1]
 gi|218560873|ref|YP_002393786.1| diaminopimelate epimerase [Escherichia coli S88]
 gi|218697527|ref|YP_002405194.1| diaminopimelate epimerase [Escherichia coli 55989]
 gi|218701277|ref|YP_002408906.1| diaminopimelate epimerase [Escherichia coli IAI39]
 gi|218707443|ref|YP_002414962.1| diaminopimelate epimerase [Escherichia coli UMN026]
 gi|238902886|ref|YP_002928682.1| diaminopimelate epimerase [Escherichia coli BW2952]
 gi|253775567|ref|YP_003038398.1| diaminopimelate epimerase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254163751|ref|YP_003046859.1| diaminopimelate epimerase [Escherichia coli B str. REL606]
 gi|254795805|ref|YP_003080642.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. TW14359]
 gi|256021447|ref|ZP_05435312.1| diaminopimelate epimerase [Shigella sp. D9]
 gi|256026156|ref|ZP_05440021.1| diaminopimelate epimerase [Escherichia sp. 4_1_40B]
 gi|260846415|ref|YP_003224193.1| diaminopimelate epimerase DapF [Escherichia coli O103:H2 str.
           12009]
 gi|260857785|ref|YP_003231676.1| diaminopimelate epimerase DapF [Escherichia coli O26:H11 str.
           11368]
 gi|260870534|ref|YP_003236936.1| diaminopimelate epimerase DapF [Escherichia coli O111:H- str.
           11128]
 gi|261225583|ref|ZP_05939864.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255629|ref|ZP_05948162.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. FRIK966]
 gi|291285223|ref|YP_003502041.1| Diaminopimelate epimerase [Escherichia coli O55:H7 str. CB9615]
 gi|293407436|ref|ZP_06651356.1| dapF [Escherichia coli FVEC1412]
 gi|293413251|ref|ZP_06655913.1| diaminopimelate epimerase [Escherichia coli B354]
 gi|293468127|ref|ZP_06664539.1| diaminopimelate epimerase [Escherichia coli B088]
 gi|298383176|ref|ZP_06992770.1| diaminopimelate epimerase [Escherichia coli FVEC1302]
 gi|307140508|ref|ZP_07499864.1| diaminopimelate epimerase [Escherichia coli H736]
 gi|307313617|ref|ZP_07593237.1| diaminopimelate epimerase [Escherichia coli W]
 gi|309784525|ref|ZP_07679163.1| diaminopimelate epimerase [Shigella dysenteriae 1617]
 gi|312971904|ref|ZP_07786078.1| diaminopimelate epimerase [Escherichia coli 1827-70]
 gi|62288069|sp|P0A6K1|DAPF_ECOLI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|62288070|sp|P0A6K2|DAPF_ECO57 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123147484|sp|Q0TAR6|DAPF_ECOL5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167012034|sp|A7ZU14|DAPF_ECO24 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167012035|sp|A8A6R7|DAPF_ECOHS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082833|sp|B1IW95|DAPF_ECOLC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724208|sp|B7MH73|DAPF_ECO45 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724209|sp|B7NTD3|DAPF_ECO7I RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724210|sp|B7M611|DAPF_ECO8A RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724211|sp|B7NFB1|DAPF_ECOLU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724212|sp|B1LLY0|DAPF_ECOSM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724213|sp|B7LU47|DAPF_ESCF3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807507|sp|B5YY56|DAPF_ECO5E RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807508|sp|B1XAH6|DAPF_ECODH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767104|sp|B7L969|DAPF_ECO55 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|259595053|sp|C4ZZ73|DAPF_ECOBW RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|85676241|dbj|BAE77491.1| diaminopimelate epimerase [Escherichia coli str. K12 substr. W3110]
 gi|87082334|gb|AAC76812.2| diaminopimelate epimerase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|110345726|gb|ABG71963.1| diaminopimelate epimerase [Escherichia coli 536]
 gi|157068966|gb|ABV08221.1| diaminopimelate epimerase [Escherichia coli HS]
 gi|157080648|gb|ABV20356.1| diaminopimelate epimerase [Escherichia coli E24377A]
 gi|169757096|gb|ACA79795.1| Diaminopimelate epimerase [Escherichia coli ATCC 8739]
 gi|169891127|gb|ACB04834.1| diaminopimelate epimerase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170521653|gb|ACB19831.1| diaminopimelate epimerase [Escherichia coli SMS-3-5]
 gi|187768871|gb|EDU32715.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4196]
 gi|188015408|gb|EDU53530.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4113]
 gi|189001420|gb|EDU70406.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4076]
 gi|189359167|gb|EDU77586.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4401]
 gi|189362571|gb|EDU80990.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4486]
 gi|189365964|gb|EDU84380.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4501]
 gi|189373358|gb|EDU91774.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC869]
 gi|189376683|gb|EDU95099.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC508]
 gi|190903839|gb|EDV63553.1| diaminopimelate epimerase [Escherichia coli B7A]
 gi|190905443|gb|EDV65073.1| diaminopimelate epimerase [Escherichia coli F11]
 gi|192926654|gb|EDV81283.1| diaminopimelate epimerase [Escherichia coli E22]
 gi|192958577|gb|EDV89015.1| diaminopimelate epimerase [Escherichia coli E110019]
 gi|194412718|gb|EDX29012.1| diaminopimelate epimerase [Escherichia coli B171]
 gi|194422464|gb|EDX38463.1| diaminopimelate epimerase [Escherichia coli 101-1]
 gi|208729510|gb|EDZ79111.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4206]
 gi|208733367|gb|EDZ82054.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4045]
 gi|208740320|gb|EDZ88002.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4042]
 gi|209160778|gb|ACI38211.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. EC4115]
 gi|217322260|gb|EEC30684.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. TW14588]
 gi|218354259|emb|CAV00935.1| diaminopimelate epimerase [Escherichia coli 55989]
 gi|218358508|emb|CAQ91155.1| diaminopimelate epimerase [Escherichia fergusonii ATCC 35469]
 gi|218363141|emb|CAR00782.1| diaminopimelate epimerase [Escherichia coli IAI1]
 gi|218367642|emb|CAR05427.1| diaminopimelate epimerase [Escherichia coli S88]
 gi|218371263|emb|CAR19097.1| diaminopimelate epimerase [Escherichia coli IAI39]
 gi|218434540|emb|CAR15467.1| diaminopimelate epimerase [Escherichia coli UMN026]
 gi|222035507|emb|CAP78252.1| Diaminopimelate epimerase [Escherichia coli LF82]
 gi|238860759|gb|ACR62757.1| diaminopimelate epimerase [Escherichia coli BW2952]
 gi|242379339|emb|CAQ34151.1| diaminopimelate epimerase [Escherichia coli BL21(DE3)]
 gi|253326611|gb|ACT31213.1| diaminopimelate epimerase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975652|gb|ACT41323.1| diaminopimelate epimerase [Escherichia coli B str. REL606]
 gi|253979808|gb|ACT45478.1| diaminopimelate epimerase [Escherichia coli BL21(DE3)]
 gi|254595205|gb|ACT74566.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. TW14359]
 gi|257756434|dbj|BAI27936.1| diaminopimelate epimerase DapF [Escherichia coli O26:H11 str.
           11368]
 gi|257761562|dbj|BAI33059.1| diaminopimelate epimerase DapF [Escherichia coli O103:H2 str.
           12009]
 gi|257766890|dbj|BAI38385.1| diaminopimelate epimerase DapF [Escherichia coli O111:H- str.
           11128]
 gi|260451348|gb|ACX41770.1| Diaminopimelate epimerase [Escherichia coli DH1]
 gi|284923917|emb|CBG37016.1| diaminopimelate epimerase [Escherichia coli 042]
 gi|290765096|gb|ADD59057.1| Diaminopimelate epimerase [Escherichia coli O55:H7 str. CB9615]
 gi|291321505|gb|EFE60943.1| diaminopimelate epimerase [Escherichia coli B088]
 gi|291425547|gb|EFE98585.1| dapF [Escherichia coli FVEC1412]
 gi|291468199|gb|EFF10696.1| diaminopimelate epimerase [Escherichia coli B354]
 gi|294492006|gb|ADE90762.1| diaminopimelate epimerase [Escherichia coli IHE3034]
 gi|298276412|gb|EFI17931.1| diaminopimelate epimerase [Escherichia coli FVEC1302]
 gi|306906598|gb|EFN37110.1| diaminopimelate epimerase [Escherichia coli W]
 gi|307628872|gb|ADN73176.1| diaminopimelate epimerase [Escherichia coli UM146]
 gi|308927631|gb|EFP73100.1| diaminopimelate epimerase [Shigella dysenteriae 1617]
 gi|309704244|emb|CBJ03592.1| diaminopimelate epimerase [Escherichia coli ETEC H10407]
 gi|310334281|gb|EFQ00486.1| diaminopimelate epimerase [Escherichia coli 1827-70]
 gi|312948362|gb|ADR29189.1| diaminopimelate epimerase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315063101|gb|ADT77428.1| diaminopimelate epimerase [Escherichia coli W]
 gi|315138386|dbj|BAJ45545.1| diaminopimelate epimerase [Escherichia coli DH1]
 gi|315618493|gb|EFU99079.1| diaminopimelate epimerase [Escherichia coli 3431]
 gi|320176051|gb|EFW51120.1| Diaminopimelate epimerase [Shigella dysenteriae CDC 74-1112]
 gi|320185470|gb|EFW60239.1| Diaminopimelate epimerase [Shigella flexneri CDC 796-83]
 gi|320191098|gb|EFW65748.1| Diaminopimelate epimerase [Escherichia coli O157:H7 str. EC1212]
 gi|320197618|gb|EFW72230.1| Diaminopimelate epimerase [Escherichia coli WV_060327]
 gi|320198484|gb|EFW73085.1| Diaminopimelate epimerase [Escherichia coli EC4100B]
 gi|320644677|gb|EFX13727.1| diaminopimelate epimerase [Escherichia coli O157:H- str. 493-89]
 gi|320650002|gb|EFX18505.1| diaminopimelate epimerase [Escherichia coli O157:H- str. H 2687]
 gi|320660974|gb|EFX28417.1| diaminopimelate epimerase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666098|gb|EFX33112.1| diaminopimelate epimerase [Escherichia coli O157:H7 str. LSU-61]
 gi|323155215|gb|EFZ41399.1| diaminopimelate epimerase [Escherichia coli EPECa14]
 gi|323161127|gb|EFZ47045.1| diaminopimelate epimerase [Escherichia coli E128010]
 gi|323173424|gb|EFZ59053.1| diaminopimelate epimerase [Escherichia coli LT-68]
 gi|323177822|gb|EFZ63406.1| diaminopimelate epimerase [Escherichia coli 1180]
 gi|323189765|gb|EFZ75044.1| diaminopimelate epimerase [Escherichia coli RN587/1]
 gi|323380835|gb|ADX53103.1| diaminopimelate epimerase [Escherichia coli KO11]
 gi|323949307|gb|EGB45197.1| diaminopimelate epimerase [Escherichia coli H252]
 gi|326344265|gb|EGD68025.1| Diaminopimelate epimerase [Escherichia coli O157:H7 str. 1125]
 gi|326347907|gb|EGD71621.1| Diaminopimelate epimerase [Escherichia coli O157:H7 str. 1044]
 gi|330908109|gb|EGH36628.1| diaminopimelate epimerase [Escherichia coli AA86]
 gi|332089026|gb|EGI94137.1| diaminopimelate epimerase [Shigella boydii 3594-74]
 gi|332345788|gb|AEE59122.1| diaminopimelate epimerase DapF [Escherichia coli UMNK88]
          Length = 274

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|77359069|ref|YP_338644.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis TAC125]
 gi|123587542|sp|Q3IEW3|DAPF_PSEHT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|76873980|emb|CAI85201.1| diaminopimelate epimerase [Pseudoalteromonas haloplanktis TAC125]
          Length = 276

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  ++ D I  L+       FDQ++++       +D  
Sbjct: 2   LVNFSKMHGLGNDFVVIDNITQNVFLSRDQIIKLADRHFGIGFDQLLMVEAPYSPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+  +    +   T  T  G L     +DG ++V+MG
Sbjct: 62  YRIFNADGTEVEQCGNGARCFARFVRMKGLTNKHKITVSTKSGNLTLYIEKDGQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IPL  +                        VSMGNPH +  V+ D+    + 
Sbjct: 122 HPNFEPSKIPLKATKR-----ELTYIIRTEEHTVFSGAVSMGNPHCVLEVD-DITTAQVD 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F +  N+   +V S E + LR WERGV  T ACG+ ACA++V     +K
Sbjct: 176 ILGPLLENHERFPQRANIGFMQVISKEHIKLRVWERGVNETLACGTGACAAMVIGFIQNK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V + GG L I W+   H V MTG A+  ++G++ +
Sbjct: 236 LISTVQVDLPGGSLQIRWNGEGHPVRMTGPAEHVFDGQVAL 276


>gi|295675164|ref|YP_003603688.1| diaminopimelate epimerase [Burkholderia sp. CCGE1002]
 gi|295435007|gb|ADG14177.1| diaminopimelate epimerase [Burkholderia sp. CCGE1002]
          Length = 370

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 91/299 (30%), Positives = 142/299 (47%), Gaps = 10/299 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T+  + AL+        DQ++L+       VD   
Sbjct: 62  LKFTKMHGAGNDFVVLDGYTQPLDLTTAQVRALANRHFGVGADQLLLVEKPTVEGVDFRY 121

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+  R    ++S   +  +G +      +G + VDMG 
Sbjct: 122 RIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTITLTMQDNGEVIVDMGT 181

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ D +L+P A    +  R+          +   R   VVSMGNPHA+  V+ D   + +
Sbjct: 182 PVFDPELVPFATKGLQGRREGADTLWPLDVNGTTRWMSVVSMGNPHAVQVVD-DAEAFPV 240

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  + +H  F + VN    ++ +   + LR +ERG G T ACG+ ACA+V A     
Sbjct: 241 LVEGPAIERHTRFPQRVNAGFMQIVNRNEIRLRVYERGAGETLACGTGACAAVGAGIRRG 300

Query: 241 KTNRAVSVKMLGGGLLIEWH---DNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY 296
             +  V V   GG L I W        + M G A   +EG++++   +    + D   +
Sbjct: 301 LLDSPVLVHTHGGDLTITWDIAQPGAPLLMAGPAATVFEGEIEL-AEEASGASPDSSQH 358


>gi|237747500|ref|ZP_04577980.1| diaminopimelate epimerase [Oxalobacter formigenes HOxBLS]
 gi|229378851|gb|EEO28942.1| diaminopimelate epimerase [Oxalobacter formigenes HOxBLS]
          Length = 287

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 90/286 (31%), Positives = 136/286 (47%), Gaps = 11/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V D      ++T++    ++        DQI+++   Q+ + D   
Sbjct: 3   LKFTKMHGAGNDFIVFDACTQKVDLTAEQFRFIADRRFGIGADQILIVEKPQNPATDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG R   RF+   +   R     ET  GI+  +  ++G+++V+MG+
Sbjct: 63  RIFNADGGEVEQCGNGARAFARFVTVFNMTDRNPVRVETKAGIIELRVEKNGNVTVNMGK 122

Query: 123 PILDWKLIPL------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P      IP        +           +     L      +VSMGNPHA+  VE ++ 
Sbjct: 123 PEFSPDRIPFDASGLKGKPAGDDMIWPLALELPKGLQTIEVSLVSMGNPHAVQIVE-NVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G L+  H  F    N     + +  S+ LR +ERG G T ACG+ ACA+VVA 
Sbjct: 182 KAPVGETGPLIENHARFPNRTNAGFMEIENRHSIKLRVFERGAGETLACGTGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                 +  V+VK  GG L I W+ N H V MTG A   + G++D+
Sbjct: 242 IRRKLLDSPVTVKARGGTLEITWNGNGHEVTMTGPAVIVFNGEIDL 287


>gi|161486052|ref|NP_756589.2| diaminopimelate epimerase [Escherichia coli CFT073]
 gi|29839329|sp|Q8FBN6|DAPF_ECOL6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|307555935|gb|ADN48710.1| diaminopimelate epimerase [Escherichia coli ABU 83972]
          Length = 274

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 133/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPDLIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P   +        + +       L    VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPFRAN---KVEKTYIMRAAEQTILCG--VVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|251793384|ref|YP_003008112.1| diaminopimelate epimerase [Aggregatibacter aphrophilus NJ8700]
 gi|247534779|gb|ACS98025.1| diaminopimelate epimerase [Aggregatibacter aphrophilus NJ8700]
          Length = 274

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFPTETIKRLADRHRGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQKGKMVLSVKEDGNVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ +   IP        ++   +      +       VSMGNPH +  VE D+   ++  
Sbjct: 121 PVWEPNKIPF-----IANKFEKNYILRTTVQTVLCGAVSMGNPHCVVQVE-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V + + + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQVVNRKHIKLRVYERGAGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG A   ++G + +
Sbjct: 235 DNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDGVIYL 274


>gi|83745969|ref|ZP_00943025.1| Diaminopimelate epimerase [Ralstonia solanacearum UW551]
 gi|207742011|ref|YP_002258403.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum IPO1609]
 gi|83727363|gb|EAP74485.1| Diaminopimelate epimerase [Ralstonia solanacearum UW551]
 gi|206593397|emb|CAQ60324.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum IPO1609]
          Length = 307

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 135/291 (46%), Gaps = 8/291 (2%)

Query: 2   QSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           + +M + F KM G GN  +V+D      + T +   A++        DQ++L+       
Sbjct: 13  RPAMKLHFTKMHGAGNDFVVLDGIETPIDFTPEQWRAIADRHFGVGADQLLLVERSTRPD 72

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++
Sbjct: 73  VDFRYRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVT 132

Query: 118 VDMGEPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P+ +   +P          +          +        VSMGNPHA+  V+ D 
Sbjct: 133 VDMGAPVFEAARLPFVPDGLPTRVEGRDAQHALQVNDRTAWLSTVSMGNPHAVQVVD-DT 191

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             + +   G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA
Sbjct: 192 EAFPVLEDGPLIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVA 251

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTGK 285
                  +  V V   GGGL I W      V MTG A   +EG LD+   K
Sbjct: 252 GIRRGLLDSPVKVATHGGGLTIAWAGEGEPVMMTGPATTVFEGTLDLDALK 302


>gi|71905834|ref|YP_283421.1| diaminopimelate epimerase [Dechloromonas aromatica RCB]
 gi|123628370|sp|Q47JN0|DAPF_DECAR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71845455|gb|AAZ44951.1| diaminopimelate epimerase [Dechloromonas aromatica RCB]
          Length = 276

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 135/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D      +++ + +  L+        DQI+L+       +D   
Sbjct: 3   LKFSKMHGLGNDFVVLDGVRQSVSLSPEQLCYLADRHFGVGCDQILLVEKASQPGIDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+       ++    ET+RGI+  +   DG+++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVRFVHDEGLTDKREIRVETMRGIISPRLEGDGNVTVDMGI 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP     D                     VVSMGNPHA+  V+  +    +  
Sbjct: 123 PRFLPAEIPFLAEDDV-----IIHLLDVADETLETSVVSMGNPHAVQVVD-SVDTAPVGE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ KHP F   VN    ++    ++ LR +ERG G T ACG+ ACA+VVA       
Sbjct: 177 HGPLIEKHPRFPLRVNAGFMQIVDRHAIKLRVYERGSGETMACGTGACAAVVAGIRRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V   GG L I W  +   V MTG A   + G++++
Sbjct: 237 DSPVRVTTRGGDLTIAWGGDERPVLMTGPAVTVFTGEIEL 276


>gi|261867253|ref|YP_003255175.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412585|gb|ACX81956.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 274

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 93/278 (33%), Positives = 136/278 (48%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNIYFPTETIKRLADRHRGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T  G ++     DG++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQNGKMLLTVKEDGNVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  VE D+   ++  
Sbjct: 121 PIWEPNKIPFTA-----NKFEKNYILRTEIQTVLCSAVSMGNPHCVVQVE-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQVVNRHHIKLRVYERGTGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           +  V V + GG L IEW    H ++MTG A   ++G +
Sbjct: 235 DNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDGVV 272


>gi|117620561|ref|YP_855007.1| diaminopimelate epimerase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|166224237|sp|A0KFI1|DAPF_AERHH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|117561968|gb|ABK38916.1| diaminopimelate epimerase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 276

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++DF+KM G+GN  +V+D        +++ I  L+       FDQ++L+    D  +D  
Sbjct: 2   LIDFSKMHGLGNDFMVVDGVTQKVFFSNEVIKKLADRHFGIGFDQLLLVEPPYDPELDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +           T RG +V +   +  ++V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTARGRIVLQLEGENQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IP      +  +                  VSMGNPH +  V   +    +A
Sbjct: 122 VPQFEPGKIPF-----RAQKAEKTYLLRAQEHTVMCGAVSMGNPHCVIEV-PSVADAPVA 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G ++ +H  F E VN+    + +   + LR +ERGVG T ACG+ ACA+VV      K
Sbjct: 176 TLGPIMERHERFPERVNVGFMEMVNASEIKLRVFERGVGETLACGTGACAAVVVGISQGK 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V+V + GG L I W      V+MTG A+  ++G++++
Sbjct: 236 LKERVTVTLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL 276


>gi|288550566|ref|ZP_05970924.2| diaminopimelate epimerase [Enterobacter cancerogenus ATCC 35316]
 gi|288314631|gb|EFC53569.1| diaminopimelate epimerase [Enterobacter cancerogenus ATCC 35316]
          Length = 276

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 132/281 (46%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 2   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 62  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTDDELVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 122 EPNFEPSAVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVETAAVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 176 TLGPVLESHDRFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGISQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V V++ GG L I W      ++MTG A   ++G + +
Sbjct: 236 LAEEVRVELPGGRLDIAWKGPGQPLYMTGPAAHVYDGFIHL 276


>gi|205354492|ref|YP_002228293.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207859149|ref|YP_002245800.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|289810546|ref|ZP_06541175.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|6960255|gb|AAF33445.1| 98% identity with E. coli diaminopimelate epimerase (DAPF)
           (SP:P08885) [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16422511|gb|AAL22791.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62130049|gb|AAX67752.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|205274273|emb|CAR39292.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710952|emb|CAR35320.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261249070|emb|CBG26931.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|301160462|emb|CBW19992.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|323132294|gb|ADX19724.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326629626|gb|EGE35969.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332990782|gb|AEF09765.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 275

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ ++    + 
Sbjct: 121 EPNFEPAQVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-NVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL 275


>gi|197287149|ref|YP_002153021.1| diaminopimelate epimerase [Proteus mirabilis HI4320]
 gi|229813240|sp|B4F1X7|DAPF_PROMH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|194684636|emb|CAR46550.1| diaminopimelate epimerase [Proteus mirabilis HI4320]
          Length = 274

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLANRHTGVGFDQLLVVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +      +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNKREIKVSTQSGRMTLHVMDNEDVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +     + I  +    L    VVSMGNPH +  VE D+   ++ S
Sbjct: 121 PEFEPQKVPFRA---QKVEKTYIIRAMERTVLCG--VVSMGNPHCVIQVE-DIKTAEVES 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G++L +H  F E  N+   +V    +L LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGSVLEQHERFPERANIGFMQVVDRNTLHLRVFERGAGETQACGSGACAAVAVGISQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +R V V + GG L IEW    + ++MTG A   ++G + +
Sbjct: 235 DRKVKVNLPGGSLSIEWKGTGNPLYMTGPAVHIYDGTIQL 274


>gi|310766132|gb|ADP11082.1| diaminopimelate epimerase [Erwinia sp. Ejp617]
          Length = 282

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 9   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G ++    +D  + V+MGE
Sbjct: 69  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKSEIRVSTQSGRMILSVTQDERVCVNMGE 128

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + IP      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 129 PNFEPQQIPF-----RANKAENIYLMRAVEQTVMCGVVSMGNPHCVLQVD-NVKTAAVET 182

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 183 LGPVLESHERFPERVNVGFMEVVHREHIRLRVYERGAGETQACGSGACAAVAVGIQQALL 242

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L I W    H +FMTG A   ++G + +
Sbjct: 243 AEKVRVDLPGGSLNIAWKGPGHPLFMTGPATHVYDGFIHL 282


>gi|167625817|ref|YP_001676111.1| diaminopimelate epimerase [Shewanella halifaxensis HAW-EB4]
 gi|167355839|gb|ABZ78452.1| Diaminopimelate epimerase [Shewanella halifaxensis HAW-EB4]
          Length = 286

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 142/281 (50%), Gaps = 10/281 (3%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVD 61
           S+++ F KM G+GN  +V+D    +   + D I  L+       FDQ++L+    D  +D
Sbjct: 10  STLIQFTKMHGLGNDFMVVDGVTQNVFFSPDQIKRLADRNFGVGFDQLLLVEPPYDPDLD 69

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV+ CGNG RC  RF+ ++    +      T  G +  +  RDG ++V+
Sbjct: 70  FHYRIFNADGSEVEQCGNGARCFARFVRNKGLTHKHKIRVSTSSGKITLRLERDGKVTVN 129

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P+L+   IP         +       +          VSMGNPH +  V+D +   D
Sbjct: 130 MGIPVLEPSKIPFTAK-----KVEKTYLLLASSGTYLCGAVSMGNPHCVIEVDD-VAAAD 183

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  L  H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV     
Sbjct: 184 VDTIGAELTNHERFPKGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGIQQ 243

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
            K +R V V + GG L+I W      ++MTG A+  ++G++
Sbjct: 244 GKLDRNVCVDLPGGSLMINWDGEGKPLWMTGPAEHVYDGQI 284


>gi|332994943|gb|AEF04998.1| diaminopimelate epimerase [Alteromonas sp. SN2]
          Length = 276

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + D I  L+       FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFMVIDNVTQNVFFSKDKIQQLANRNFGIGFDQLLMVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +  + R      T  G +V    +DG ++V+MG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIVVSTKAGKMVLYLEKDGQVTVNMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL       ++         +        VSMGNPH +  VE D+    +  
Sbjct: 123 PEFEPAKIPLKA-----NKQENTYILRVNDKTLFYGAVSMGNPHCVMEVE-DVDTAPVKE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ ++  F EGVN+   ++ +   + LR +ERG G T ACGS ACA+V       K 
Sbjct: 177 IGPLVERNERFPEGVNVGFMQIINESHIRLRVFERGSGETLACGSGACAAVAIGQIQGKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           ++ V V + GG L I W   ++V  MTG A   ++G +++
Sbjct: 237 SKDVRVDLPGGSLRIRWPGPDNVLKMTGPADHVYDGHINL 276


>gi|259906884|ref|YP_002647240.1| diaminopimelate epimerase [Erwinia pyrifoliae Ep1/96]
 gi|224962506|emb|CAX53961.1| Diaminopimelate epimerase [Erwinia pyrifoliae Ep1/96]
 gi|283476677|emb|CAY72506.1| dapF [Erwinia pyrifoliae DSM 12163]
          Length = 274

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G ++    +D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKSEIRVSTQSGRMILSVTQDERVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + IP      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPQQIPF-----RANKAENIYLMRAVEQTVMCGVVSMGNPHCVLQVD-NVKTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERVNVGFMEVVHREHIRLRVYERGAGETQACGSGACAAVAVGIQQALL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L I W    H +FMTG A   ++G + +
Sbjct: 235 AEKVRVDLPGGSLNIAWKGPGHPLFMTGPATHVYDGFIHL 274


>gi|218692085|ref|YP_002400297.1| diaminopimelate epimerase [Escherichia coli ED1a]
 gi|254767105|sp|B7MR29|DAPF_ECO81 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218429649|emb|CAR10613.2| diaminopimelate epimerase [Escherichia coli ED1a]
          Length = 274

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 133/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNTDGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P   +        + +       L    VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPFRAN---KVEKTYIMRAAEQTILCG--VVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|50123103|ref|YP_052270.1| diaminopimelate epimerase [Pectobacterium atrosepticum SCRI1043]
 gi|81643660|sp|Q6CZG8|DAPF_ERWCT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|49613629|emb|CAG77080.1| diaminopimelate epimerase [Pectobacterium atrosepticum SCRI1043]
          Length = 274

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P            + +    H  L    VVSMGNPH +  VE D+    + +
Sbjct: 121 PNFEPQQVPFRA---VKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVE-DVETAKVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F +  N+   +V   +++ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPDRANIGFMQVVDSQTVRLRVYERGAGETQACGSGACAAVAVGILQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L I+W    H +FMTG A   ++G + +
Sbjct: 235 SAKVRVSLPGGELDIQWDGPGHPLFMTGPATHVYDGFIHL 274


>gi|293391245|ref|ZP_06635579.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951779|gb|EFE01898.1| diaminopimelate epimerase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 274

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 93/278 (33%), Positives = 137/278 (49%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAMTQNIYFPTETIKRLADRHRGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K+    T  G ++     DG++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKNIAVSTQNGKMLLTVKEDGNVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  VE D+   ++  
Sbjct: 121 PIWEPNKIPFTA-----NKFEKNYILRTEIQTVLCSAVSMGNPHCVVQVE-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQVVNRHHIKLRVYERGTGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           +  V V + GG L IEW    H ++MTG A   ++G +
Sbjct: 235 DNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDGVV 272


>gi|292486678|ref|YP_003529548.1| diaminopimelate epimerase [Erwinia amylovora CFBP1430]
 gi|292897915|ref|YP_003537284.1| diaminopimelate epimerase [Erwinia amylovora ATCC 49946]
 gi|291197763|emb|CBJ44858.1| diaminopimelate epimerase [Erwinia amylovora ATCC 49946]
 gi|291552095|emb|CBA19132.1| Diaminopimelate epimerase [Erwinia amylovora CFBP1430]
 gi|312170744|emb|CBX79006.1| Diaminopimelate epimerase [Erwinia amylovora ATCC BAA-2158]
          Length = 274

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G ++    +D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKSEIRVSTQSGRMILSVTQDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + IP      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 121 PGFEPQQIPF-----RANKAENIYLMRAVEQTVMCGVVSMGNPHCVIQVD-NVKTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERVNVGFMEVMHREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L I W    H +FMTG A   ++G + +
Sbjct: 235 AEKVRVDLPGGSLNIAWKGPGHPLFMTGPATHVYDGFIHL 274


>gi|269137480|ref|YP_003294180.1| diaminopimelate epimerase [Edwardsiella tarda EIB202]
 gi|267983140|gb|ACY82969.1| diaminopimelate epimerase [Edwardsiella tarda EIB202]
 gi|304557553|gb|ADM40217.1| Diaminopimelate epimerase [Edwardsiella tarda FL6-60]
          Length = 274

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 128/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R+     T  G +      D  ++V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNGRMTLHVGEDDRVTVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP   +     +                  VSMGNPH +  VE D+    +  
Sbjct: 121 PQFEPGRIPFKAA-----KAEKTYILRVAQQTVLCGAVSMGNPHCVLQVE-DVSRAQVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+   +V   + + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERVNVGFMQVVERDHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W      + MTG A   ++G + +
Sbjct: 235 DEQVQVDLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL 274


>gi|152972797|ref|YP_001337943.1| diaminopimelate epimerase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|150957646|gb|ABR79676.1| diaminopimelate epimerase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 275

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 85/281 (30%), Positives = 131/281 (46%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGS+V  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSDVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSQVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G ++  H  F E  N+   +V     + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVMESHERFPERANIGFMQVVGRSHIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 LAETVRVELPGGRLDIAWKGPGQPLFMTGPAAHVYDGFIHL 275


>gi|207727618|ref|YP_002256012.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum MolK2]
 gi|206590857|emb|CAQ56469.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum MolK2]
          Length = 307

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 135/291 (46%), Gaps = 8/291 (2%)

Query: 2   QSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           + +M + F KM G GN  +V+D      + T +   A++        DQ++L+       
Sbjct: 13  RPAMKLHFTKMHGAGNDFVVLDGIETPIDFTPEQWRAIADRHFGVGADQLLLVERATRPD 72

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++
Sbjct: 73  VDFRYRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVT 132

Query: 118 VDMGEPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P+ +   +P          +          +        VSMGNPHA+  V+ D 
Sbjct: 133 VDMGAPVFEAARLPFVPDGLPTRVEGRDAQHALQVNDRTAWLSTVSMGNPHAVQVVD-DA 191

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             + +   G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA
Sbjct: 192 EAFPVLEDGPLIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVA 251

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTGK 285
                  +  V V   GGGL I W      V MTG A   +EG LD+   K
Sbjct: 252 GIRRGLLDSPVKVATHGGGLTIAWAGEGEPVMMTGPATTVFEGTLDLDALK 302


>gi|288937768|ref|YP_003441827.1| diaminopimelate epimerase [Klebsiella variicola At-22]
 gi|288892477|gb|ADC60795.1| diaminopimelate epimerase [Klebsiella variicola At-22]
          Length = 274

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 85/280 (30%), Positives = 130/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSQVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G ++  H  F E  N+   +V     + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVMESHERFPERANIGFMQVVGRSHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 AETVRVELPGGRLDIAWKGPGQPLFMTGPAAHVYDGFIHL 274


>gi|254362348|ref|ZP_04978459.1| diaminopimelate epimerase [Mannheimia haemolytica PHL213]
 gi|261491829|ref|ZP_05988408.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261494700|ref|ZP_05991180.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153093932|gb|EDN74855.1| diaminopimelate epimerase [Mannheimia haemolytica PHL213]
 gi|261309665|gb|EEY10888.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261312484|gb|EEY13608.1| diaminopimelate epimerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 274

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +  +T + I  LS       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGVTQNVYLTEEMIRTLSDRHRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIHVSTAKGKMVLSLQEDGKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P   +     +   +      L      VVSMGNPH +  V+ D+    +  
Sbjct: 121 PIWEPSQVPFTAN-----KFEKNYILRTELQTVLCGVVSMGNPHCVLQVD-DVKTAPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+S  +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLESHERFPERANISFMQVVNRNHVKLRVYERGAGETQACGSGACGTVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L+IEW    H ++MTG+A   ++G + +
Sbjct: 235 DNKVQVDLPGGTLIIEWQGVGHPLYMTGDATHIYDGFIKL 274


>gi|308188854|ref|YP_003932985.1| Diaminopimelate epimerase [Pantoea vagans C9-1]
 gi|308059364|gb|ADO11536.1| Diaminopimelate epimerase [Pantoea vagans C9-1]
          Length = 282

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 84/280 (30%), Positives = 128/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 9   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V     D  + V+MGE
Sbjct: 69  RIFNADGSEVAQCGNGARCFARFVQLKGLTNKSDIRVSTQNGRMVLTVTPDDHVRVNMGE 128

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      + ++                  VSMGNPH +  VE  +    +  
Sbjct: 129 PNFEPQQVPF-----RANKAENLYLLRVAEQTVMLGAVSMGNPHCVIQVE-SVKTAQVEL 182

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F + VN+    + + E + LR +ERG G T ACGS ACA+V         
Sbjct: 183 LGPILESHERFPDRVNVGFMEIINPEHIRLRVYERGAGETQACGSGACAAVACGIQQGVL 242

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W      ++MTG A   ++G + +
Sbjct: 243 APKVRVDLPGGTLHISWKGAGQPLYMTGPATHVYDGFIHL 282


>gi|254495752|ref|ZP_05108666.1| diaminopimelate epimerase [Legionella drancourtii LLAP12]
 gi|254355030|gb|EET13651.1| diaminopimelate epimerase [Legionella drancourtii LLAP12]
          Length = 308

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 139/281 (49%), Gaps = 10/281 (3%)

Query: 4   SM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVD 61
           +M + F KM G+GN  +VID      N+    I  L+  +    FDQ++LI       +D
Sbjct: 29  NMRIKFTKMHGLGNDFIVIDGINQSINLQPLQIAKLAQRNTGIGFDQLLLIERSTHTGID 88

Query: 62  AFIRIINCDGSEVQSCGNGMRC--VVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV  CGNG RC  V     +   +   T  T    +  + N D S+ V+
Sbjct: 89  FNYRIFNADGQEVGQCGNGARCLAVFAKYYNLTHKNHLTVATTTTQMSLQINADNSVRVE 148

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L+   IPL+      +    +   + H        +S+GNPHA+  V+ D+    
Sbjct: 149 MGIPQLNPAAIPLSAEHQAAE----YQLELQHGQTATMHAISVGNPHAVLLVK-DVETAP 203

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G+ ++ HP F    N+   ++ + + + LR +ERG G T ACGS A A+V      
Sbjct: 204 VPTLGHEISIHPRFPAQANVGFMQIINPQHIKLRVYERGCGETLACGSGAVAAVAIGRLY 263

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           H+ ++ V+V + GG L+I+W D    + +TG A   +EG+L
Sbjct: 264 HRLDKQVTVSLPGGELIIDWPDFTAPITLTGPAVFVYEGQL 304


>gi|253690336|ref|YP_003019526.1| diaminopimelate epimerase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259595059|sp|C6DHB7|DAPF_PECCP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|251756914|gb|ACT14990.1| diaminopimelate epimerase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 274

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 135/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P            + +    H  L    VVSMGNPH +  VE D+    + +
Sbjct: 121 PNFEPQQVPFRA---VKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVE-DVDTAKVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERANIGFMQVVDSHTVRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L I+W    H +FMTG A   ++G + +
Sbjct: 235 SANVRVSLPGGDLDIQWDGPGHPLFMTGPATHVYDGFIHL 274


>gi|215489137|ref|YP_002331568.1| diaminopimelate epimerase [Escherichia coli O127:H6 str. E2348/69]
 gi|312969463|ref|ZP_07783665.1| diaminopimelate epimerase [Escherichia coli 2362-75]
 gi|254767103|sp|B7UNC6|DAPF_ECO27 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|215267209|emb|CAS11657.1| diaminopimelate epimerase [Escherichia coli O127:H6 str. E2348/69]
 gi|312286010|gb|EFR13928.1| diaminopimelate epimerase [Escherichia coli 2362-75]
          Length = 274

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVFERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|15603568|ref|NP_246642.1| diaminopimelate epimerase [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|13431432|sp|P57962|DAPF_PASMU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|12722112|gb|AAK03787.1| DapF [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 274

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAITQNLYFSPETIKRLADRHRGIGFDQMLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T  G ++     DG I ++MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTDKKDIAVSTQTGKMILSIKDDGMIRINMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTA-----NKFEKNYILRTSIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V     + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQVIHRGHIKLRVYERGAGETQACGSGACAAVAVGVMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V + GG L+IEW      +FMTG+A   ++G + +
Sbjct: 235 DSKVQVDLPGGSLIIEWEGVGKPLFMTGDATHVYDGVIRL 274


>gi|242237690|ref|YP_002985871.1| diaminopimelate epimerase [Dickeya dadantii Ech703]
 gi|242129747|gb|ACS84049.1| diaminopimelate epimerase [Dickeya dadantii Ech703]
          Length = 274

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHCGVGFDQLLIVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDINVSTHNGRMVLSVTEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P   +     +                 VVSMGNPH +  VE ++    + +
Sbjct: 121 PNFEPQQVPFRAA-----KSEKTYILRVAERTVMCGVVSMGNPHCVIQVE-NVDTAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   ++ +  ++ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERANIGFMQIINRNAIQLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V+V++ GG L I W    N +FMTG A   ++G + +
Sbjct: 235 AADVNVRLPGGELNIHWDGPGNPLFMTGPATHVYDGFIHL 274


>gi|300714800|ref|YP_003739603.1| Diaminopimelate epimerase [Erwinia billingiae Eb661]
 gi|299060636|emb|CAX57743.1| Diaminopimelate epimerase [Erwinia billingiae Eb661]
          Length = 274

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V    +D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKNDIRVSTQTGRMVLSVTQDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P      + ++                 VVSMGNPH +  V+  +    + S
Sbjct: 121 PNFDPQQVPF-----RANKAENLYLMRVAEQTIMCGVVSMGNPHCVLQVD-SVKTAAVES 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHDRFPERVNVGFMEVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQALL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEKVRVDLPGGSLNIAWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|300705469|ref|YP_003747072.1| diaminopimelate epimerase [Ralstonia solanacearum CFBP2957]
 gi|299073133|emb|CBJ44491.1| diaminopimelate epimerase [Ralstonia solanacearum CFBP2957]
          Length = 292

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 93/286 (32%), Positives = 132/286 (46%), Gaps = 7/286 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      + T +   A++        DQ++L+       VD   
Sbjct: 3   LHFTKMHGAGNDFVVLDGIETPIDFTPEQWRAIADRHFGVGADQLLLVERSTRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG 
Sbjct: 63  RIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P          +          +        VSMGNPHA+  V+ D   + +
Sbjct: 123 PVFEAARLPFVPDGLPTRVEGRDAQHALQVNGRTAWLSTVSMGNPHAVQVVD-DTEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LEDGPLIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTGK 285
             +  V V   GGGL I W      V MTG A   +EG LD+   K
Sbjct: 242 LLDSPVKVATHGGGLTIAWAGEGEPVMMTGPATTVFEGTLDLDALK 287


>gi|251787834|ref|YP_003002555.1| diaminopimelate epimerase [Dickeya zeae Ech1591]
 gi|247536455|gb|ACT05076.1| diaminopimelate epimerase [Dickeya zeae Ech1591]
          Length = 274

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 130/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHCGVGFDQLLIVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTSKREINVSTHNGRMVLSVTEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +  +                 VVSMGNPH +  VE ++    +  
Sbjct: 121 PNFEPQQVPF-----RAVKPEKTYILRAAERTVLCGVVSMGNPHCVLQVE-NVDSASVEE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERANVGFMQVVNPHLIRLRVFERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 AADVKVQLPGGELDIHWDGPGQPLFMTGPATHVYDGFIHL 274


>gi|323143040|ref|ZP_08077745.1| diaminopimelate epimerase [Succinatimonas hippei YIT 12066]
 gi|322417181|gb|EFY07810.1| diaminopimelate epimerase [Succinatimonas hippei YIT 12066]
          Length = 277

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 102/282 (36%), Positives = 144/282 (51%), Gaps = 10/282 (3%)

Query: 5   MV-DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
           M+  F+KM G+GN  +V+D        + + I  LS       FDQ++L+    D  VD 
Sbjct: 1   MILKFSKMHGLGNDFMVVDGVTQKIFFSPELIKRLSDRHFGVGFDQLLLVEPPYDPEVDF 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEVQ CGNG RC VRF+       ++     T+ G+L  K N D S++V+M
Sbjct: 61  HYRIFNADGSEVQMCGNGARCFVRFVVDHGLTNKRDIKVSTVSGVLRLKLNNDDSVTVNM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P LD + +P          +    G            VSMGNPHA+  V+ D+    +
Sbjct: 121 GVPQLDPEKLPFKAEAQSESYELCVKGFDAVTIG----AVSMGNPHAVINVK-DVKTAPV 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+ KH  F E VN+  ++  +   ++LR +ERG G T ACG+ ACA+VVA    H
Sbjct: 176 HELGSLVEKHERFPEKVNVGFSQKVNDHEINLRVFERGCGETLACGTGACAAVVAGIVQH 235

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +    V V + GG L I W   N  V M+G A   +EG++ I
Sbjct: 236 RLVSPVKVNLPGGSLNISWDGKNSPVMMSGPAVLVYEGQIVI 277


>gi|41237|emb|CAA31413.1| unnamed protein product [Escherichia coli K-12]
          Length = 275

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVTTANGRMVLTVTDDDLVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ D+    + 
Sbjct: 121 EPNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHWLIQVD-DVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   + + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVKRDDIRLRVYERGAGETQACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 275


>gi|152997589|ref|YP_001342424.1| diaminopimelate epimerase [Marinomonas sp. MWYL1]
 gi|150838513|gb|ABR72489.1| Diaminopimelate epimerase [Marinomonas sp. MWYL1]
          Length = 276

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 139/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D            I  LS  +    FDQ++++    D  +D  
Sbjct: 2   LLKFTKMHGLGNDFVVVDAVSRKVFFNKQQIEKLSDRNWGIGFDQLLVVEPPTDPDMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  +F+  R    ++    ET RG +  +    G ++VDMG
Sbjct: 62  YRIYNSDGSEVEHCGNGARCFAKFVLDRELTNKRIINVETKRGAIQLRVLDGGLVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  + + +P                   +L       VS+GNPHA+  V+  +    +A
Sbjct: 122 APSFEPQDLPFTAE-PCDVLYSIMAEDTEYLITP----VSVGNPHAVIKVDQLIDDE-VA 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  H  F   VN+   +V + + ++LR +ERGVG T ACG+ ACA+VVA      
Sbjct: 176 KVGALIECHERFPRKVNVGFMQVVNPDEINLRVYERGVGETQACGTGACAAVVAGIKQGW 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +  V+  + GG L IEW      + MTG A+K +EG++ +
Sbjct: 236 LSPKVTAHLRGGDLHIEWQGEGSPILMTGPAEKVFEGQIYL 276


>gi|229807518|sp|A4G980|DAPF_HERAR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|193222419|emb|CAL63067.2| Diaminopimelate epimerase (DAP epimerase) [Herminiimonas
           arsenicoxydans]
          Length = 283

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 137/282 (48%), Gaps = 7/282 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +VID      + T      L+        DQ++++   Q A VD   
Sbjct: 3   IKFTKMHGAGNDFVVIDAINQSIHFTPAQWQHLADRRFGVGADQMLVVEKPQAAGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG R  V+F+T +    +++   ET+ G++  +   +G I+VDMG 
Sbjct: 63  RIYNADGGEVEQCGNGARAFVKFVTDKKLTDKQAIRVETMSGVIEPRLEANGQITVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           PIL  + +P   S      +                  V+SMGNPHA+  V  D  H  +
Sbjct: 123 PILTPEDVPFDVSGLLCKAEGADTLWPLDIKGETHWISVLSMGNPHAVQVV-ADADHAPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  HP F + VN    ++     + LR +ERG G T ACG+ ACA+VV+     
Sbjct: 182 REDGVLIEHHPRFPKRVNAGFMQIIDPHQIKLRVFERGAGETLACGTGACAAVVSGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                + V+  GG L I W  +N  V +TG A   +EG++++
Sbjct: 242 LLASPIKVQTRGGELSIAWAGDNSPVLLTGPAVTVFEGEIEL 283


>gi|221134093|ref|ZP_03560398.1| diaminopimelate epimerase [Glaciecola sp. HTCC2999]
          Length = 276

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 90/279 (32%), Positives = 138/279 (49%), Gaps = 10/279 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           +V+F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D   D  
Sbjct: 2   LVEFTKMHGLGNDFMVVDCITQNIYFSPERIQQLADRNFGVGFDQLLLVEPPYDPDQDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +   +  T  G ++    +DG ++V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVKYKNLTHKTKISVSTKAGKIMLYLEKDGQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      +P+        +                  VS+GNPH +  V+ D+  YD+ 
Sbjct: 122 RPRFAPDDVPMKA-----QKQENTYIIREADQTFFCGAVSLGNPHCVMVVD-DIDTYDVL 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F + VN+   ++    ++ LR +ERGVG T ACGS ACA+V       K
Sbjct: 176 GVGALLESHERFPQKVNVGFMQIIDENNIKLRVFERGVGETLACGSGACAAVAIGQQQGK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
               V+V + GG L I W  ++H + MTG A+  ++GK+
Sbjct: 236 LGTEVNVTLPGGPLTIRWQGDDHTIKMTGPAEHVFDGKI 274


>gi|78484750|ref|YP_390675.1| diaminopimelate epimerase [Thiomicrospira crunogena XCL-2]
 gi|78363036|gb|ABB41001.1| diaminopimelate epimerase [Thiomicrospira crunogena XCL-2]
          Length = 283

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 90/282 (31%), Positives = 142/282 (50%), Gaps = 11/282 (3%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVD 61
           ++++ F+KM+G+GN  +VID       ++++ I   +       FDQ++++ +     VD
Sbjct: 2   TNLLKFSKMQGLGNDFMVIDGTQETITLSTEEIRFWANRYFGVGFDQLLMVENSAQGDVD 61

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEVQ CGNG RC  +F+  +    +     ET  G++V      G + V+
Sbjct: 62  FRYRIFNADGSEVQQCGNGARCFAKFVYDKGLTDKTEIRVETASGMIVLYITDQGWVRVN 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P    + +P     +    +    G    +       VSMGNPHA+  V  DL    
Sbjct: 122 MGAPNFLPEALPFDMPLESEQYELDVDGERFEIG-----AVSMGNPHAVLRV-ADLGAAP 175

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G  +  H +F E VN+  A     + + LR +ERG   T ACG+ ACA++V    L
Sbjct: 176 VAEVGEKIESHRLFPERVNVGFAETLDRQHIKLRVYERGAAETLACGTGACAAMVVLRNL 235

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH--VFMTGEAKKEWEGKL 279
            + +  V+V + GG L IEW+ +    V+MTG A   +EG++
Sbjct: 236 GEVDDVVTVSLPGGDLEIEWNGDKSSPVWMTGPAVHVFEGEI 277


>gi|312884203|ref|ZP_07743914.1| diaminopimelate epimerase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368131|gb|EFP95672.1| diaminopimelate epimerase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 276

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 88/277 (31%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+  +    FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFVVVDCITQNVFFSPDLIRRLADRNTGIGFDQLLIVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DG EV+ CGNG RC  RF+  +     +     T +G ++     D  ++V+MG P
Sbjct: 64  IFNSDGGEVEQCGNGARCFARFVRMKGLTNKYRISVSTKKGKIILNIGDDDQVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         R++ +I       L     VS+GNPH +  VE +L    +   
Sbjct: 124 EFEPSKIPFKAK----QREKTYILRAQDKTLFCG-AVSLGNPHVVTVVE-ELSDALIDEI 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G +L  H  F E VN    +V S   + LR +ERG G T ACG+ ACA+V         +
Sbjct: 178 GPVLESHERFPERVNAGFMKVLSRSEIKLRVYERGAGETQACGTGACAAVAVGIAQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V+V + GG L I W  +   ++MTG A   ++G+L
Sbjct: 238 ENVTVHLPGGTLKIAWQGDGEPLYMTGPASHVFDGQL 274


>gi|271502382|ref|YP_003335408.1| diaminopimelate epimerase [Dickeya dadantii Ech586]
 gi|270345937|gb|ACZ78702.1| diaminopimelate epimerase [Dickeya dadantii Ech586]
          Length = 274

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + D I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPDLIRRLSDRHCGVGFDQLLIVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTSKREINVSTHNGRMVLSVTEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P   +        + +    H  L    VVSMGNPH +  V+ ++    +  
Sbjct: 121 PNFEPQQVPFRAA---KPEKTYILRAAEHTVLCG--VVSMGNPHCVLQVD-NVDTAPVEE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 QGPLLENHERFPERANVGFMQVVNPHLIRLRVFERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H +FMTG A   ++G + +
Sbjct: 235 AADVKVQLPGGELDIHWDGPGHPLFMTGPATHVYDGFIHL 274


>gi|299068297|emb|CBJ39518.1| diaminopimelate epimerase [Ralstonia solanacearum CMR15]
          Length = 292

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 92/286 (32%), Positives = 131/286 (45%), Gaps = 7/286 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      + T +   A++        DQ++L+       VD   
Sbjct: 3   LHFTKMHGAGNDFVVLDGIATPIDFTPEQWRAIADRHFGVGADQLLLVERSTRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG 
Sbjct: 63  RIFNHDGGEVEQCGNGARCFVKFVTDRGLTDKRTIRVEVMNGIATLTMQPDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P          +          +        VSMGNPHA+  V+ D   + +
Sbjct: 123 PVFEAARLPFVPDGLPTRVEGRDTQHALQINGRTAWLSTVSMGNPHAVQVVD-DAQAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 REDGPLIESHAVFPRRVNAGFMEIADRHAIRLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTGK 285
             +  V V   GG L I W      V MTG A   +EG LD+   K
Sbjct: 242 LLDSPVKVATHGGDLTIAWAGEGEPVMMTGPATTVFEGTLDLDALK 287


>gi|227114725|ref|ZP_03828381.1| diaminopimelate epimerase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P            + +    H  L    VVSMGNPH +  VE D+    + +
Sbjct: 121 PNFEPQQVPFRA---VKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVE-DVETAKVDT 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERANIGFMQVVDSHAVRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           + +V V + GG L I+W    H +FMTG A   ++G + +
Sbjct: 235 SASVRVSLPGGELDIQWDGPGHPLFMTGPATHVYDGFIHL 274


>gi|71278746|ref|YP_266845.1| diaminopimelate epimerase [Colwellia psychrerythraea 34H]
 gi|123634292|sp|Q48AR8|DAPF_COLP3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71144486|gb|AAZ24959.1| diaminopimelate epimerase [Colwellia psychrerythraea 34H]
          Length = 276

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 134/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  LV+D    +  ++ + I   +       FDQ++++    D  +D  
Sbjct: 2   LVNFSKMHGLGNDFLVLDNVTQNVFLSPEQITKFANRNFGVGFDQLLVVEPPYDPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  +F+  +        +  T  G +     RDG+ISV M 
Sbjct: 62  YRIYNADGSEVGQCGNGARCFAKFVRMKGLCNKHKIKVSTSTGKMNLHIERDGNISVTMP 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  + K IP         +        +         VSMGNPH +  V+  +   D+ 
Sbjct: 122 VPQFEPKKIPFTA-----QKTEGTYILRSESETVLCGAVSMGNPHCVVTVD-SVAEADVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S G  L+ H  F E  N+    + S   + LR +ERG   T ACGS ACA+VV      K
Sbjct: 176 SLGKELSVHERFPEDANVGFMEIVSPNYIKLRVYERGAAETLACGSGACAAVVIGYMQKK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             + V+V++ GG L I W    H V M+G A   ++G++ I
Sbjct: 236 LAKQVTVELPGGKLRIFWQGPGHPVKMSGPATHVFDGQISI 276


>gi|186685304|ref|YP_001868500.1| diaminopimelate epimerase [Nostoc punctiforme PCC 73102]
 gi|229813236|sp|B2J3A7|DAPF_NOSP7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|186467756|gb|ACC83557.1| diaminopimelate epimerase [Nostoc punctiforme PCC 73102]
          Length = 279

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 138/281 (49%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R     +     AI           D ++     ++   D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRSSSLPVLTPEQAIQLCDRHFGIGADGVIFALPGEN-GTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF----LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+  F          + S+   T+ G++  +   DG + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAGFLADLEGQSRNKDSYRIHTLGGVMTPQLLSDGLVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP   +   ++     +             V+MGNPH I FVE D+   +
Sbjct: 122 MGLPRLLAGEIPTTLA--PVEEKVISVPLEVAGKTWEVTCVNMGNPHCITFVE-DVAAIE 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L S G     HP F + +N    +V   + L +R WERG G+T ACG+ ACAS+VA    
Sbjct: 179 LESIGPKFEHHPAFPQRINTEFIQVVRRDYLKMRVWERGAGITLACGTGACASLVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            K +R  +V++ GG L IEW + +  V+MTG A++ + GKL
Sbjct: 239 GKCDRTATVELPGGPLQIEWSEIDQRVYMTGPAERVFTGKL 279


>gi|170769865|ref|ZP_02904318.1| diaminopimelate epimerase [Escherichia albertii TW07627]
 gi|170121303|gb|EDS90234.1| diaminopimelate epimerase [Escherichia albertii TW07627]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+    +  FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLSVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +  + ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLINKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274


>gi|188532372|ref|YP_001906169.1| diaminopimelate epimerase [Erwinia tasmaniensis Et1/99]
 gi|229807512|sp|B2VI49|DAPF_ERWT9 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|188027414|emb|CAO95261.1| Diaminopimelate epimerase [Erwinia tasmaniensis Et1/99]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V    +D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKNEIRVSTQSGRMVLSITQDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + IP      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPQQIPF-----RANKAENIYLMRAAEQTVMCGVVSMGNPHCVLQVD-NVKTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERVNVGFMEVVHREHIRLRVYERGAGETQACGSGACAAVAVGIQQASL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEKVRVDLPGGSLHIAWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|294637957|ref|ZP_06716224.1| diaminopimelate epimerase [Edwardsiella tarda ATCC 23685]
 gi|291088889|gb|EFE21450.1| diaminopimelate epimerase [Edwardsiella tarda ATCC 23685]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 128/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R+     T  G +    + D  ++V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNGRMTLHVDDDERVTVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D   IP   +     +                  VSMGNPH +  VE D+    +A 
Sbjct: 121 PQFDPGRIPFKAA-----KAEKTYILRVAQQTVLCGAVSMGNPHCVLQVE-DVSQAQVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E VN+   +V     + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPALESHERFPERVNVGFMQVVDRGYIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W      + M G A   ++G + +
Sbjct: 235 DEQVRVELPGGTLHICWQGPGTPLLMIGPATHVYDGFIHL 274


>gi|296105307|ref|YP_003615453.1| diaminopimelate epimerase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059766|gb|ADF64504.1| diaminopimelate epimerase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVNQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPSAVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-NVETAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGISQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHVYDGFIHL 274


>gi|241661657|ref|YP_002980017.1| diaminopimelate epimerase [Ralstonia pickettii 12D]
 gi|240863684|gb|ACS61345.1| diaminopimelate epimerase [Ralstonia pickettii 12D]
          Length = 292

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 94/286 (32%), Positives = 135/286 (47%), Gaps = 7/286 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      + T +   A++        DQ++L+       VD   
Sbjct: 3   LHFTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIADRHFGVGADQLLLVERSTRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG 
Sbjct: 63  RIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNGIATLTMQDDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P        +++ D        +        VSMGNPHA+  V+ D   + +
Sbjct: 123 PVFEAARLPFLPEGLPTRVEGDDTQHALQINGRTEWLSTVSMGNPHAVQIVD-DTEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  H +F   VN    ++    S+ LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKTGK 285
             +  V V   GG L I W      V MTG A   +EG LD+   K
Sbjct: 242 VLDSPVKVTTHGGDLTIAWAGGGQPVMMTGPATTVFEGTLDLDALK 287


>gi|238918090|ref|YP_002931604.1| diaminopimelate epimerase, [Edwardsiella ictaluri 93-146]
 gi|259595054|sp|C5BBD4|DAPF_EDWI9 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|238867658|gb|ACR67369.1| diaminopimelate epimerase, putative [Edwardsiella ictaluri 93-146]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 125/280 (44%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R+     T    +      D  ++V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNSRMTLHVGEDDRVTVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP   +     +                  VSMGNPH +  VE D+    +  
Sbjct: 121 PQFEPGRIPFKAA-----KAEKTYILRVAQQTVLCGAVSMGNPHCVLQVE-DISRAQVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E VN+   +V     + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPSLESHERFPERVNVGFMQVVERSHIRLRVYERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W      + MTG A   ++G + +
Sbjct: 235 DEQVQVDLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL 274


>gi|157368431|ref|YP_001476420.1| diaminopimelate epimerase [Serratia proteamaculans 568]
 gi|167012038|sp|A8G852|DAPF_SERP5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|157320195|gb|ABV39292.1| Diaminopimelate epimerase [Serratia proteamaculans 568]
          Length = 274

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P   + +      + +    H  L    VVSMGNPH +  V+ D+    +  
Sbjct: 121 PNFDPQTVPFRATKE---EKTYIMRAAEHTVLCG--VVSMGNPHCVLQVD-DVKTAKVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   ++ S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 SEEVHVELPGGSLHIRWKGPGSPLFMTGPATHVYDGFIHL 274


>gi|329113599|ref|ZP_08242379.1| Diaminopimelate epimerase [Acetobacter pomorum DM001]
 gi|326697121|gb|EGE48782.1| Diaminopimelate epimerase [Acetobacter pomorum DM001]
          Length = 288

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 140/283 (49%), Gaps = 15/283 (5%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASV 60
            S +  F KM G+GN  +++D RG H  +T   I AL+        DQ++ +        
Sbjct: 17  HSMLTSFRKMHGLGNDFVILDERGGHLPLTPARIAALAHRRRGIGCDQLVTLRPACAEGA 76

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D F+R  N DGSE  +CGN  RCV   +      ++   +T  G L A+   +G I+VDM
Sbjct: 77  DVFVRFFNPDGSEAGACGNASRCVADLIWRETGNRTPVLQTRAGRLPARIEENGLITVDM 136

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEP L+W+ +PL    D +                +P   SMGNPHA FF    +  +  
Sbjct: 137 GEPRLNWQDVPLVAEMDTLHL----------PLEGDPAAASMGNPHATFF----VEDFAR 182

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            S G  L   P+F E  N+  AR+     + L+  ERG G+T ACGS ACA+VV +    
Sbjct: 183 LSQGQALEHDPLFPERANIGFARIDGSARMRLKVHERGAGVTEACGSGACAAVVNAARRG 242

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKT 283
              R   V++ GG L IEW  NNHV MTG A   +EG +D+  
Sbjct: 243 LVERVCEVELDGGILQIEWAPNNHVLMTGSATTAFEGTVDLAA 285


>gi|91774552|ref|YP_544308.1| diaminopimelate epimerase [Methylobacillus flagellatus KT]
 gi|91708539|gb|ABE48467.1| diaminopimelate epimerase [Methylobacillus flagellatus KT]
          Length = 290

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 140/281 (49%), Gaps = 10/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  +V+D      ++ +D I  L+       FDQ++L+       VD   
Sbjct: 15  LSFTKMQGIGNDFIVVDGYSRPVSLDADTIRRLADRHFGIGFDQLLLVERPTVEGVDFRY 74

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VR++  +    ++    +T RGI++ +   +G ++V+MGE
Sbjct: 75  RIFNADGGEVEQCGNGARCFVRYVHDKSLTSKREIRVQTARGIILPRLEDNGLVTVNMGE 134

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P        DR+                V SMGNPHA+  VE D+    +  
Sbjct: 135 PRFEPAEVPF-----IADREAMTYLLQVADQALEISVASMGNPHAVTVVE-DVDTAPVER 188

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+V +       
Sbjct: 189 LGPLVERHERFPQRVNAGFMQIVDEHHIRLRVFERGSGETLACGTGACAAVASGIRRGLL 248

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIK 282
              V V   GG L+I W      V+MTG A+  +EG +DI+
Sbjct: 249 QSPVRVATRGGELIIAWEGGGQPVWMTGPAETVFEGSIDIE 289


>gi|304398151|ref|ZP_07380026.1| diaminopimelate epimerase [Pantoea sp. aB]
 gi|304354437|gb|EFM18809.1| diaminopimelate epimerase [Pantoea sp. aB]
          Length = 274

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 84/280 (30%), Positives = 128/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVQLKGLTNKTDIRVSTQNGRMVLTVTPDDQVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      + ++                  VSMGNPH +  VE  +    +  
Sbjct: 121 PNFEPQQVPF-----RANKAENLYLLRVAEQTVMLGAVSMGNPHCVIQVE-SVKTAQVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F + VN+    + + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPILESHERFPDRVNVGFMEIINPEHIRLRVYERGAGETQACGSGACAAVACGIQQGIL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W      ++MTG A   ++G + +
Sbjct: 235 APNVRVDLPGGTLHISWKGAGQPLYMTGPATHVYDGFIHL 274


>gi|126666599|ref|ZP_01737577.1| diaminopimelate epimerase [Marinobacter sp. ELB17]
 gi|126628987|gb|EAZ99606.1| diaminopimelate epimerase [Marinobacter sp. ELB17]
          Length = 328

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 135/284 (47%), Gaps = 10/284 (3%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
            ++ F KM G+GN  +V+D       +  + I  L+       FDQ++++       VD 
Sbjct: 34  GVLRFTKMHGLGNDFMVVDAISQMFRLRPEMIRELADRHFGIGFDQLLVVEPPGLPDVDF 93

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC  RF        +K    +T  GI+  +  +DG + VDM
Sbjct: 94  RYRIFNADGSEVEQCGNGARCFARFVRDQRLTNKKVMRVQTAGGIIELRVGKDGLVKVDM 153

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L+   +P +   +        +   N        VVSMGNPH +   + D+    +
Sbjct: 154 GVPRLEPATVPFSAD-EFAPVYNLDVNGQNIEL----SVVSMGNPHGVILTD-DVDSAPV 207

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A+ G LL KH  F    N+   ++     + LR +ERG G T ACG+ ACA+VVA     
Sbjct: 208 ATLGPLLEKHWRFPAKANIGFMQIVDRSHIRLRVFERGCGETLACGTGACAAVVAGCLRG 267

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKT 283
             +  V V++ GG L+IEW      V M G     +EG+L +  
Sbjct: 268 LLDSRVEVELPGGRLIIEWQGLGAAVMMDGPVASVFEGQLRLPA 311


>gi|261823391|ref|YP_003261497.1| diaminopimelate epimerase [Pectobacterium wasabiae WPP163]
 gi|261607404|gb|ACX89890.1| diaminopimelate epimerase [Pectobacterium wasabiae WPP163]
          Length = 274

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P            + +    H  L    VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPQQVPFRA---VKAEKTYIMRADEHTVLCG--VVSMGNPHCVIQVD-DVETAKVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   ++   +++ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERANIGFMQIVDSQTVRLRVYERGAGETQACGSGACAAVAVGILQGSL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L I+W    H +FMTG A   ++G + +
Sbjct: 235 SAKVRVSLPGGELDIQWDGPGHPLFMTGPATHVYDGFIHL 274


>gi|238784733|ref|ZP_04628736.1| Diaminopimelate epimerase [Yersinia bercovieri ATCC 43970]
 gi|238714329|gb|EEQ06338.1| Diaminopimelate epimerase [Yersinia bercovieri ATCC 43970]
          Length = 274

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDEEVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P      +  +                 VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFDPQSVPF-----RATKAEKTYIFRAAEQTVLCGVVSMGNPHCVLQVD-DVAVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S +++ LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSRDNIRLRVYERGAGETQACGSGACAAVAVGIQQDLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V+V++ GG LLI W    H ++MTG A   ++G + +
Sbjct: 235 DEEVTVELPGGSLLISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|320539386|ref|ZP_08039055.1| diaminopimelate epimerase [Serratia symbiotica str. Tucson]
 gi|320030511|gb|EFW12521.1| diaminopimelate epimerase [Serratia symbiotica str. Tucson]
          Length = 274

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + FAKM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFAKMHGLGNDFMVVDAITQNVYFSPELIRRLSDRHLGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVQLKGLTNKCELRVSTQSGRMVLNVTGNDQVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P            + +    H  L    +VSMGNPH +  V+ D+    +A 
Sbjct: 121 PNFDPQAVPFRA---TKAEKTYIMRAAEHTVLCG--IVSMGNPHCVLQVD-DVNTAKVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   ++ S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGSGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 SEEVRVELPGGSLHIRWKGPGSPLFMTGPATHVYDGFIHL 274


>gi|239993650|ref|ZP_04714174.1| diaminopimelate epimerase [Alteromonas macleodii ATCC 27126]
          Length = 276

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 145/280 (51%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I  L+       FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFMVIDNVTQNVFFSKEKIQQLANRNFGIGFDQLLMVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +  + R      T  G +V    +DG ++V+MG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIVVSTKAGKMVLYLEKDGQVTVNMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL  +     ++  +I  V    L      SMGNPH +  V+ D+   ++A 
Sbjct: 123 PEFEPANIPLKAN----KQENTYILRVGESTLFIGSA-SMGNPHCVMEVD-DVDTANVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ KH  F EGVN+   ++ +   + LR +ERG G T ACGS ACA+V       K 
Sbjct: 177 IGPLVEKHERFPEGVNVGFMQIINESHIKLRVFERGSGETLACGSGACAAVAIGQIQGKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
            + V V + GG L I W   ++V  MTG A+  ++G +++
Sbjct: 237 GKDVRVDLPGGSLRIRWPGPDNVLKMTGPAEHVYDGHINL 276


>gi|109900372|ref|YP_663627.1| diaminopimelate epimerase [Pseudoalteromonas atlantica T6c]
 gi|123170519|sp|Q15NG5|DAPF_PSEA6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|109702653|gb|ABG42573.1| diaminopimelate epimerase [Pseudoalteromonas atlantica T6c]
          Length = 276

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 97/280 (34%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I+ L+       FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFVVIDNVTQNVFFSKEKISQLADRNFGIGFDQLLVVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R      T  G +V    RDG I+V+MGE
Sbjct: 63  RIFNSDGSEVSQCGNGARCFARFVKMKGLTNRNKIVVSTKAGRIVLYHERDGQITVNMGE 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IPL  +     +         +        VSMGNPH +  V+ D+   D+  
Sbjct: 123 PIFEPAKIPLKAN-----KQENIYIIRENDHTFFCGAVSMGNPHCVLLVD-DVETADVEG 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F EG N+   ++ +   + LR +ERGVG T ACGS ACA+V       K 
Sbjct: 177 IGKTLVAHERFPEGANIGFMQILNSGHIKLRVYERGVGETLACGSGACAAVAVGQMQKKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           N+ V+V + GG L I W     +  MTG A+  ++G + +
Sbjct: 237 NKEVTVDLPGGTLKIRWQGPGSILKMTGTAEHVFDGNITL 276


>gi|6729756|pdb|1BWZ|A Chain A, Diaminopimelate Epimerase From Hemophilus Influenzae
          Length = 274

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V        I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDMNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|90581047|ref|ZP_01236847.1| diaminopimelate epimerase [Vibrio angustum S14]
 gi|90437743|gb|EAS62934.1| diaminopimelate epimerase [Vibrio angustum S14]
          Length = 276

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 93/278 (33%), Positives = 136/278 (48%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F+KM G+GN  +V+D    +   + DAI  L+       FDQ++++    D   D   
Sbjct: 3   INFSKMHGLGNDFVVVDCVTQNVFFSPDAIRRLADRHRGIGFDQLLVVEPPYDPETDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF++ +    +   +  T  G ++ K   D  ++V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVSMKGLTNKYHISVSTKAGKMLLKLENDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP+         ++ +I       L      SMGNPH    V DD+   D+ +
Sbjct: 123 PIFEPNKIPMKAK----QAEKTYILRAGEQTLFCG-AASMGNPHC-VTVVDDVDTADVDT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V    ++ LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGPLLESHERFPERVNAGFMQVLDRNNVRLRVYERGAGETQACGSGACAAVAIGRVQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           +  V V + GG L I W      +FMTG A   ++G+ 
Sbjct: 237 DENVKVSLPGGDLYIRWAGEGKPLFMTGPAAHVFDGQF 274


>gi|197103593|ref|YP_002128970.1| diaminopimelate epimerase [Phenylobacterium zucineum HLK1]
 gi|229813239|sp|B4RCE2|DAPF_PHEZH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|196477013|gb|ACG76541.1| diaminopimelate epimerase [Phenylobacterium zucineum HLK1]
          Length = 277

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 103/281 (36%), Positives = 147/281 (52%), Gaps = 7/281 (2%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDA 58
           M ++M   F KM G+GN  +V++ R      T+  + A++        DQ++ +   +  
Sbjct: 1   MSAAMGRPFLKMNGLGNDFVVVETRSAPFEPTAAQVRAIADRATGIGCDQLIAVDPAE-- 58

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISV 118
             DA +R  N DG EV +CGNG RCV   L     +     ET  G LVA    +  +SV
Sbjct: 59  GADAHVRFWNADGEEVGACGNGTRCVGWLLMQSSGKDEAVIETRAGRLVATRAGERLVSV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L+W  IPLA   D    D       +   +  P  VSMGNPH +FFV  D    
Sbjct: 119 DMGPPRLEWNEIPLAEPHDTRALDVVLY--HHADLMAPPGCVSMGNPHVVFFV-PDAEQA 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
             A  G  +  HP+F E VN+  A+V + + + LR WERG GLT ACG+ ACA++VA+  
Sbjct: 176 PAAEAGPAIEGHPLFPEHVNVGFAQVKAPDRIRLRVWERGAGLTKACGTGACAAMVAASR 235

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                R  ++++ GG L +EW  + HV MTG A  +++G+L
Sbjct: 236 RGLIGRHATMELDGGELFVEWRADGHVIMTGPAAVDFQGEL 276


>gi|292493803|ref|YP_003529242.1| diaminopimelate epimerase [Nitrosococcus halophilus Nc4]
 gi|291582398|gb|ADE16855.1| diaminopimelate epimerase [Nitrosococcus halophilus Nc4]
          Length = 276

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 133/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           V F KM+G+GN  +VID      ++T+  +  ++        DQ++L+       VD   
Sbjct: 3   VAFTKMQGLGNDFVVIDTISQSLSLTASQVRRIADRRLGIGCDQVLLVAPPPSPEVDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  +    ++    +T  G++      D  ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFARFVREQGLTGKERLQVQTAGGVIRLHLETDKQVTVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP     +  D                   VSMGNPH +  V   +    +A 
Sbjct: 123 PRFAPDEIPFKADHE-ADSYLLEFDKQRVEIG----AVSMGNPHCVLRVAA-IDAAPIAC 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           +G +L +HP F + VN+    V S   + LR +ERG G T ACG+ ACA++V        
Sbjct: 177 WGPILERHPRFPQRVNVGFVEVISPGHIRLRVYERGAGETPACGTGACAAMVIGRRRGWL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V+V + GG L I W      V+MTG A+  +EG +++
Sbjct: 237 SEQVNVDLPGGRLGIHWAGEGRSVWMTGPAETVFEGAIEL 276


>gi|332304597|ref|YP_004432448.1| diaminopimelate epimerase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171926|gb|AEE21180.1| diaminopimelate epimerase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 276

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I  L+       FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFVVIDNVTQNVFFSKEKIAQLADRNFGIGFDQLLVVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    R      T  G +V    RDG ++V+MGE
Sbjct: 63  RIFNSDGSEVSQCGNGARCFARFVKMKGLTNRNKIVVSTKAGRIVLYHERDGQVTVNMGE 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL  +     +         +        VSMGNPH +  V+ D+   D+  
Sbjct: 123 PEFEPSKIPLKAN-----KQENIYIIRENDHTFFCGAVSMGNPHCVLLVD-DIATTDVEG 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F EG N+   ++ +   + LR +ERGVG T ACGS ACA+V       K 
Sbjct: 177 IGKMLVAHERFPEGANIGFMQILNSGHIKLRVYERGVGETLACGSGACAAVAVGQMQKKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           N+ V+V + GG L I W     +  MTG A+  ++G + +
Sbjct: 237 NKDVTVDLPGGTLKIRWQGPGSILKMTGTAEHVFDGNITL 276


>gi|319897750|ref|YP_004135947.1| diaminopimelate epimerase [Haemophilus influenzae F3031]
 gi|317433256|emb|CBY81631.1| diaminopimelate epimerase [Haemophilus influenzae F3031]
          Length = 274

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  +F+T +    +K  +    +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFAQFVTLKGLTNKKDISVSAQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|16762187|ref|NP_457804.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143676|ref|NP_807018.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415801|ref|YP_152876.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161353579|ref|NP_462832.2| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|161617066|ref|YP_001591031.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|162139521|ref|YP_218833.2| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167993885|ref|ZP_02574978.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168233879|ref|ZP_02658937.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238400|ref|ZP_02663458.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244636|ref|ZP_02669568.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263163|ref|ZP_02685136.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168822683|ref|ZP_02834683.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443293|ref|YP_002043177.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194449106|ref|YP_002047959.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194471742|ref|ZP_03077726.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735174|ref|YP_002116876.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197249980|ref|YP_002148871.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262124|ref|ZP_03162198.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197364731|ref|YP_002144368.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243444|ref|YP_002217876.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388367|ref|ZP_03214979.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204930238|ref|ZP_03221215.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|213052016|ref|ZP_03344894.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213417519|ref|ZP_03350661.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425409|ref|ZP_03358159.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|238912950|ref|ZP_04656787.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289829105|ref|ZP_06546779.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|60392165|sp|P0A1F2|DAPF_SALTY RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|60392166|sp|P0A1F3|DAPF_SALTI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|81599710|sp|Q5PKM6|DAPF_SALPA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082839|sp|A9MY70|DAPF_SALPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813242|sp|B5EZS3|DAPF_SALA4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813243|sp|B5FNU5|DAPF_SALDC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813244|sp|B4TB37|DAPF_SALHS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813245|sp|B4SZ51|DAPF_SALNS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813246|sp|B5BIV6|DAPF_SALPK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813247|sp|B4TNV9|DAPF_SALSV RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|25294024|pir||AC0919 diaminopimelate epimerase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504491|emb|CAD09373.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139311|gb|AAO70878.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130058|gb|AAV79564.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161366430|gb|ABX70198.1| hypothetical protein SPAB_04899 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401956|gb|ACF62178.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194407410|gb|ACF67629.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194458106|gb|EDX46945.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710676|gb|ACF89897.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197096208|emb|CAR61805.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197213683|gb|ACH51080.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240379|gb|EDY22999.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288720|gb|EDY28095.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937960|gb|ACH75293.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605465|gb|EDZ04010.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204320642|gb|EDZ05844.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205328124|gb|EDZ14888.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205332064|gb|EDZ18828.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205336529|gb|EDZ23293.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340934|gb|EDZ27698.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205348176|gb|EDZ34807.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|267996226|gb|ACY91111.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|312915065|dbj|BAJ39039.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088357|emb|CBY98117.1| Diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321225465|gb|EFX50522.1| Diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613024|gb|EFY09975.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617388|gb|EFY14288.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625620|gb|EFY22442.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627043|gb|EFY23836.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631241|gb|EFY28004.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638274|gb|EFY34973.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642790|gb|EFY39377.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646968|gb|EFY43470.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650355|gb|EFY46768.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656354|gb|EFY52648.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657579|gb|EFY53849.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665990|gb|EFY62171.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666729|gb|EFY62906.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671028|gb|EFY67158.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679265|gb|EFY75317.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681669|gb|EFY77696.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686004|gb|EFY81992.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716909|gb|EFZ08480.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323192630|gb|EFZ77858.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196496|gb|EFZ81646.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203752|gb|EFZ88773.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205373|gb|EFZ90347.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210742|gb|EFZ95618.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215910|gb|EGA00643.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221403|gb|EGA05821.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227579|gb|EGA11735.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231764|gb|EGA15875.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236179|gb|EGA20256.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239584|gb|EGA23632.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244320|gb|EGA28328.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249583|gb|EGA33495.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250325|gb|EGA34211.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256532|gb|EGA40263.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259770|gb|EGA43403.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265178|gb|EGA48676.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268393|gb|EGA51865.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 274

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPAQVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-NVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL 274


>gi|16272691|ref|NP_438909.1| diaminopimelate epimerase [Haemophilus influenzae Rd KW20]
 gi|68249347|ref|YP_248459.1| diaminopimelate epimerase [Haemophilus influenzae 86-028NP]
 gi|145632103|ref|ZP_01787838.1| diaminopimelate epimerase [Haemophilus influenzae 3655]
 gi|145638454|ref|ZP_01794064.1| diaminopimelate epimerase [Haemophilus influenzae PittII]
 gi|145640834|ref|ZP_01796416.1| diaminopimelate epimerase [Haemophilus influenzae R3021]
 gi|260579841|ref|ZP_05847671.1| diaminopimelate epimerase [Haemophilus influenzae RdAW]
 gi|260583154|ref|ZP_05850934.1| diaminopimelate epimerase [Haemophilus influenzae NT127]
 gi|319775309|ref|YP_004137797.1| diaminopimelate epimerase [Haemophilus influenzae F3047]
 gi|329122695|ref|ZP_08251273.1| diaminopimelate epimerase [Haemophilus aegyptius ATCC 11116]
 gi|1169225|sp|P44859|DAPF_HAEIN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|81336228|sp|Q4QME8|DAPF_HAEI8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33356940|pdb|1GQZ|A Chain A, Refinement Of Haemophilus Influenzae Diaminopimelate
           Epimerase At 1.7a
 gi|109157880|pdb|2GKE|A Chain A, Crystal Structure Of Diaminopimelate Epimerase In Complex
           With An Irreversible Inhibitor Ll-Azidap
 gi|109157881|pdb|2GKJ|A Chain A, Crystal Structure Of Diaminopimelate Epimerase In Complex
           With An Irreversible Inhibitor Dl-Azidap
 gi|1573758|gb|AAC22409.1| diaminopimelate epimerase (dapF) [Haemophilus influenzae Rd KW20]
 gi|68057546|gb|AAX87799.1| diaminopimelate epimerase [Haemophilus influenzae 86-028NP]
 gi|144987010|gb|EDJ93540.1| diaminopimelate epimerase [Haemophilus influenzae 3655]
 gi|145272783|gb|EDK12690.1| diaminopimelate epimerase [Haemophilus influenzae PittII]
 gi|145274348|gb|EDK14212.1| diaminopimelate epimerase [Haemophilus influenzae 22.4-21]
 gi|260093125|gb|EEW77058.1| diaminopimelate epimerase [Haemophilus influenzae RdAW]
 gi|260093772|gb|EEW77680.1| diaminopimelate epimerase [Haemophilus influenzae NT127]
 gi|309751589|gb|ADO81573.1| Diaminopimelate epimerase [Haemophilus influenzae R2866]
 gi|317449900|emb|CBY86112.1| diaminopimelate epimerase [Haemophilus influenzae F3047]
 gi|327472569|gb|EGF17999.1| diaminopimelate epimerase [Haemophilus aegyptius ATCC 11116]
          Length = 274

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|163748704|ref|ZP_02155957.1| diaminopimelate epimerase [Shewanella benthica KT99]
 gi|161331814|gb|EDQ02618.1| diaminopimelate epimerase [Shewanella benthica KT99]
          Length = 274

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 88/273 (32%), Positives = 138/273 (50%), Gaps = 5/273 (1%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D   RI N 
Sbjct: 1   MHGLGNDFMVVDGVTQNVFFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG RC  RF+ ++    ++     T  G L  +  +DG+++V+MG P+L+ 
Sbjct: 61  DGGEVEQCGNGARCFARFVRNKGLTNKQKIKVSTSNGKLTLRLEQDGNVTVNMGIPVLEP 120

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             IP      +           + +       VSMGNPH +  VE D+   D+   G LL
Sbjct: 121 SKIPFNAKRPEKTYLLQTDTAESKMQTFLCGAVSMGNPHCVLDVE-DIQAADVEGIGALL 179

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
            +H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K ++ V 
Sbjct: 180 TQHERFPKGVNVGFMQVINSGHIKLRVYERGAAETLACGTGACAAVVVGQLQGKLDKRVR 239

Query: 248 VKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           V + GG L I W      ++MTG A+  ++G++
Sbjct: 240 VDLPGGTLTINWDGEGKPLWMTGPAEHVYDGQI 272


>gi|332289910|ref|YP_004420762.1| diaminopimelate epimerase [Gallibacterium anatis UMN179]
 gi|330432806|gb|AEC17865.1| diaminopimelate epimerase [Gallibacterium anatis UMN179]
          Length = 274

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D        + D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGITQSVYFSEDVIRRLADRNRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +    +K     T +G +V   N D ++ V+MGE
Sbjct: 61  RIFNADGSEVEQCGNGARCFARFVRLKGLTNKKEINVSTAKGKIVLIVNDDETVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      +      VVSMGNPH +  VE D+   ++  
Sbjct: 121 PIWEPAKVPF-----IANKFEKNYILRTDIQTVLCGVVSMGNPHCVLQVE-DVKTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F    N+   +V + + + LR +ERG G T ACG+ ACA+V         
Sbjct: 175 LGPLLEHHERFPARANIGFMQVLNRKQIKLRVFERGAGETQACGTGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V++ GG L+IEW      ++MTG+A   ++G + +
Sbjct: 235 DNQVEVELPGGKLMIEWQGVGYPLYMTGDATFVYDGNIQL 274


>gi|293393892|ref|ZP_06638199.1| diaminopimelate epimerase [Serratia odorifera DSM 4582]
 gi|291423719|gb|EFE96941.1| diaminopimelate epimerase [Serratia odorifera DSM 4582]
          Length = 274

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 135/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +++D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMMVDAVTQNVYFSPELIRRLADRHLGIGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P   +        + +    H  L    VVSMGNPH +  V+ D+    +  
Sbjct: 121 PNFDPQTVPFRAA---KAEKTYIMRAAEHTVLAG--VVSMGNPHCVLQVD-DVKTAKVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S + + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSRDRIKLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 SEEVHVELPGGSLHIRWKGPGTPLFMTGPATHVYDGFIHL 274


>gi|186474847|ref|YP_001856317.1| diaminopimelate epimerase [Burkholderia phymatum STM815]
 gi|229807493|sp|B2JJY4|DAPF_BURP8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|184191306|gb|ACC69271.1| Diaminopimelate epimerase [Burkholderia phymatum STM815]
          Length = 286

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 88/284 (30%), Positives = 138/284 (48%), Gaps = 8/284 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      N+T   + AL+        DQ++++       VD   
Sbjct: 3   LKFTKMHGAGNDFVVLDGYTQPLNLTETQVRALANRHFGVGADQLLVVEKPTVDGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F   +    ++S   +  +G++      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRDSRLTDKRSVRVQVQKGVITLTMQDNGEVVVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P   S  +  R+          +   R   VVSMGNPHA+  V+ D+  + +
Sbjct: 123 PVFEPVQVPFDASGVEARREGNDTLYALEVNGETRWVSVVSMGNPHAVQVVD-DVEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++  HP F + VN    ++     + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LVDGPVIETHPRFPQRVNAGFMQIVGRSEVKLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
             +  V V   GG L I W+    + + M G A   +EG++++ 
Sbjct: 242 LLDAPVKVHTHGGTLTITWNGESASSLMMAGPAATVFEGEIELA 285


>gi|326625664|gb|EGE32009.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 275

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 132/281 (46%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +       + ++                 VVSMGNPH +  V+ ++    + 
Sbjct: 121 EPNFEPAQVTF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-NVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL 275


>gi|148652161|ref|YP_001279254.1| diaminopimelate epimerase [Psychrobacter sp. PRwf-1]
 gi|172048462|sp|A5WCB3|DAPF_PSYWF RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148571245|gb|ABQ93304.1| diaminopimelate epimerase [Psychrobacter sp. PRwf-1]
          Length = 293

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 139/280 (49%), Gaps = 8/280 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+  +    FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLELTPELITLLADRNLGIGFDQLLVVEPPMRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ +R    ++    ET  GIL    +  G + VDMG
Sbjct: 62  YRIFNSDGSEVEQCGNGARCFARFVQARKLSFKQRIRVETKSGILTLSTDNYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP         ++ +H+           +V +MGNPHA+  V+ D+   D+ 
Sbjct: 122 KPRFEPAEIPFTPKAITKIQNAYHLDVEGTPV--QLYVANMGNPHAVIKVD-DILTADVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V        
Sbjct: 179 KLGKAIESHPAFPERVNVGFMQVMNQRHIRLRVYERGVGETQACGTGACAAVATGIREGW 238

Query: 242 TN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +    +  ++ GG LLI W     V MTG     +EG  
Sbjct: 239 LDEGEEIRAQLYGGSLLIRWSPGYSVMMTGPTAFVYEGVF 278


>gi|238798589|ref|ZP_04642065.1| Diaminopimelate epimerase [Yersinia mollaretii ATCC 43969]
 gi|238717545|gb|EEQ09385.1| Diaminopimelate epimerase [Yersinia mollaretii ATCC 43969]
          Length = 278

 Score =  238 bits (606), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 65  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDEEVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P            +      H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 125 PNFDPQSVPFRA---TKAEKTYIFRAAEHTVLCG--VVSMGNPHCVLQVD-DVSVANVAL 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S E++ LR +ERG G T ACGS ACA+V         
Sbjct: 179 LGPVLESHERFPERANIGFMQVVSRENIRLRVYERGAGETQACGSGACAAVAVGIQQELL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V+V++ GG LLI W    H ++MTG A   ++G + +
Sbjct: 239 DEEVTVELPGGSLLISWKGPGHPLYMTGPATHVYDGFIHL 278


>gi|167553870|ref|ZP_02347614.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168467638|ref|ZP_02701475.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195630012|gb|EDX48672.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205321786|gb|EDZ09625.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 274

 Score =  238 bits (606), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P   +        + +  V    L    VVSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPAQVPFRAN---KAEKTYIMRAVEQTILCG--VVSMGNPHCVIQVD-NVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL 274


>gi|145628368|ref|ZP_01784169.1| diaminopimelate epimerase [Haemophilus influenzae 22.1-21]
 gi|144980143|gb|EDJ89802.1| diaminopimelate epimerase [Haemophilus influenzae 22.1-21]
          Length = 274

 Score =  238 bits (606), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 144/280 (51%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIQRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G ++     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMILTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +      ++ +I   +   +     VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN----KFEKNYILRTDIQTVLCGT-VSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHVYDGFITL 274


>gi|311281512|ref|YP_003943743.1| diaminopimelate epimerase [Enterobacter cloacae SCF1]
 gi|308750707|gb|ADO50459.1| diaminopimelate epimerase [Enterobacter cloacae SCF1]
          Length = 274

 Score =  238 bits (606), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 131/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIHVSTANGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PNFEPSQVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   + + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKRDHIRLRVFERGAGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V++ GG L I W      +FMTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGQPLFMTGPAAHVYDGFIHL 274


>gi|240950051|ref|ZP_04754357.1| diaminopimelate epimerase [Actinobacillus minor NM305]
 gi|240295469|gb|EER46217.1| diaminopimelate epimerase [Actinobacillus minor NM305]
          Length = 274

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGVTQNVFLTEEIIQKLADRHRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +G + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLSLKENGQVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQIPFTA-----NKFEKNYILRTSLQTVLCGVVSMGNPHCVLQVE-DIQTAPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVINRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L+IEW    H ++MTG+A   ++G + +
Sbjct: 235 DSKVQVDLPGGSLMIEWEGVGHSLYMTGDATHIYDGFVKL 274


>gi|56752176|ref|YP_172877.1| diaminopimelate epimerase [Synechococcus elongatus PCC 6301]
 gi|81300736|ref|YP_400944.1| diaminopimelate epimerase [Synechococcus elongatus PCC 7942]
 gi|81561459|sp|Q5N013|DAPF_SYNP6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123556543|sp|Q31LW2|DAPF_SYNE7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56687135|dbj|BAD80357.1| diaminopimelate epimerase [Synechococcus elongatus PCC 6301]
 gi|81169617|gb|ABB57957.1| diaminopimelate epimerase [Synechococcus elongatus PCC 7942]
          Length = 280

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 134/282 (47%), Gaps = 8/282 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGC-HDNITSDA-INALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + FAK  G+GN  +++D R      +T +  +     +     D ++          D  
Sbjct: 3   LQFAKYHGLGNDFILVDNRESGEPRLTPEQAVQVCDRNFGVGADGVIFALPG-SGDSDYV 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           +RI N DGSE + CGNG+RC+ +F        +  +   T  G++V      G ++VDMG
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAKFLSELDGGAQSRYRIATGAGLIVPTLTETGLVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
              L    IP   +                        VSMGNPH I FVE D+    LA
Sbjct: 122 PAYLKPVEIPTTLTG--TGDRVVEADLEVGDRPWKVTTVSMGNPHCITFVE-DVAAVPLA 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L   HP+F +  N     V   + L +R WERG G T ACG+ ACA++VA+    +
Sbjct: 179 EIGPLFEHHPVFPQRTNTEFVEVVRPDYLKMRVWERGAGATLACGTGACATLVAAVLTGR 238

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKT 283
           ++R  +V++ GG L IEW ++ H+FMTG A K + G +++  
Sbjct: 239 SDRQATVELPGGPLQIEWREDGHLFMTGPAVKVFSGSMELAA 280


>gi|254788014|ref|YP_003075443.1| diaminopimelate epimerase [Teredinibacter turnerae T7901]
 gi|259595063|sp|C5BUL6|DAPF_TERTT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|237685672|gb|ACR12936.1| diaminopimelate epimerase [Teredinibacter turnerae T7901]
          Length = 276

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 131/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  ++ID       IT +    L+        DQ++++    +   D   
Sbjct: 3   LRFTKMHGLGNDFVMIDAISQKVTITPERARKLADRHFGVGCDQVLVVESPDNPDADFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV++CGNG RC            +     ET  G+L      D  ++V+MG 
Sbjct: 63  RIFNNDGSEVENCGNGARCFAVFVRQRQLTAKSDIVVETAAGLLRLHVLDDNQVTVNMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+L    IP     ++ +     +  +          VSMGNPHA+  V+ +L  + + +
Sbjct: 123 PVLAPAQIPFVTPHEQPEY-PLQLDNMEITI----SAVSMGNPHAVTLVD-NLASFPVKT 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  H  F   VN     + S + + LR +ERGVG T ACG+ ACA+VV+       
Sbjct: 177 LGAQIETHAQFPNRVNAGFMELISRQEVKLRVFERGVGETLACGTGACAAVVSGIVRGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V+V + GG L I W      V MTG AK  + G++ +
Sbjct: 237 DTTVAVHLPGGSLSITWEGAEKPVMMTGPAKAVFHGQVKL 276


>gi|291615718|ref|YP_003518460.1| DapF [Pantoea ananatis LMG 20103]
 gi|291150748|gb|ADD75332.1| DapF [Pantoea ananatis LMG 20103]
 gi|327395983|dbj|BAK13405.1| diaminopimelate epimerase DapF [Pantoea ananatis AJ13355]
          Length = 282

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 129/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 9   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGIGFDQLLVVEPPYDPDLDFHY 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V     D  + V+MGE
Sbjct: 69  RIFNADGSEVAQCGNGARCFARFVQLKGLTNKSDIRVSTQAGRMVLSVTPDDLVRVNMGE 128

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      + ++                  VSMGNPH +  VE       +  
Sbjct: 129 PNFEPQQVPF-----RANKAENLYLLRVAEQTVMFGAVSMGNPHCVIQVE-STKTAQVEL 182

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    + S E + LR +ERG G T ACGS ACA+V         
Sbjct: 183 LGPVLESHERFPERVNVGFMEIISPEHIRLRVYERGAGETQACGSGACAAVACGIQQGIL 242

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           ++ V V + GG L I W      ++MTG A   ++G + +
Sbjct: 243 SQKVRVDLPGGTLHIAWKGVGQPLYMTGPATHVYDGFIHL 282


>gi|88861275|ref|ZP_01135907.1| diaminopimelate epimerase [Pseudoalteromonas tunicata D2]
 gi|88816756|gb|EAR26579.1| diaminopimelate epimerase [Pseudoalteromonas tunicata D2]
          Length = 276

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 139/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           +V+F+KM G+GN  +VID    +  I  D I  L+       FDQ++++    D  +D  
Sbjct: 2   LVNFSKMHGLGNDFMVIDNVTQNVFIARDQIIKLADRNFGIGFDQLLMVEAPYDPDLDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+  +           T  G +     +DG +SV+MG
Sbjct: 62  YRIFNSDGTEVEQCGNGARCFARFVRMKGLTNRHKILVSTKSGNMTLHIEKDGLVSVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P L+   IP   +      + +     +H        VSMGNPH +  V+ D+    + 
Sbjct: 122 QPKLEPHTIPFKAAKR---ENTYIFRAQDHTVFCG--AVSMGNPHCVVEVD-DITTAPVN 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL  H  F +  N+   ++ S E + LR WERG G T ACG+ ACA+VV      K
Sbjct: 176 VLGPLLENHERFPQRANIGFMQIISPEHIKLRVWERGAGETLACGTGACAAVVVGILQKK 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V + GG L + W    H V MTG A+  ++G++ +
Sbjct: 236 LAPHVQVDLPGGRLEVRWQGEGHSVRMTGPAEHVFDGQIAL 276


>gi|253991594|ref|YP_003042950.1| diaminopimelate epimerase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638472|emb|CAR67094.1| diaminopimelate epimerase (ec 5.1.1.7) (dap epimerase)
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253783044|emb|CAQ86209.1| diaminopimelate epimerase [Photorhabdus asymbiotica]
          Length = 278

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+  +    FDQ++++    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLADRNTGIGFDQLLVVEAPYDPDLDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +  + ++     T  G +V     D  + V+MGE
Sbjct: 65  RIFNSDGSEVAQCGNGARCFARFVRLKGLINKREIKVSTQSGRMVLSITNDDQVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP      +  R                 VVSMGNPH +  V  D+   ++  
Sbjct: 125 PEFEPHNIPF-----RALRAEKTYILRVIEKTVLCSVVSMGNPHCVIQV-ADVETAEVEI 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+   ++ +   + LR +ERGVG T ACGS ACA+V         
Sbjct: 179 LGPALESHERFPERANIGFMQILNRGHIRLRVYERGVGETQACGSGACAAVAVGIQQQLL 238

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W    N ++MTG A   ++G + +
Sbjct: 239 DSNVRVDLPGGSLFICWAGPGNPLYMTGPATHVYDGTIHL 278


>gi|262172885|ref|ZP_06040563.1| diaminopimelate epimerase [Vibrio mimicus MB-451]
 gi|261893961|gb|EEY39947.1| diaminopimelate epimerase [Vibrio mimicus MB-451]
          Length = 276

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I       L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPSKIPF----RAKQSEKTYILRAGEQTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEISWKGPGKALYMTGPATHVYDGQI 274


>gi|317046393|ref|YP_004114041.1| diaminopimelate epimerase [Pantoea sp. At-9b]
 gi|316948010|gb|ADU67485.1| diaminopimelate epimerase [Pantoea sp. At-9b]
          Length = 274

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 130/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKSDIRVSTQTGRMVLSVTNDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      + ++                  VSMGNPH +  VE ++    + +
Sbjct: 121 PNFEPQHVPF-----RANKAENLYLLRVAEQTVMFGAVSMGNPHCVIQVE-NVKTAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E VN+    V + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERVNVGFMEVVNPEHIRLRVYERGAGETQACGSGACAAVACGIQQGIL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W      +FMTG A   ++G + +
Sbjct: 235 AEKVRVDLPGGTLHIAWKGAGQPLFMTGPATHVYDGFIHL 274


>gi|224585762|ref|YP_002639561.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224470290|gb|ACN48120.1| diaminopimelate epimerase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 275

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F+KM G+GN  +V+D    +   + + I  LS       F+Q++++    D  +D  
Sbjct: 1   MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFEQLLVVEPPYDPELDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MG
Sbjct: 61  YRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP  +   +P      + ++                 VVSMGNPH +  V+ ++    + 
Sbjct: 121 EPNFEPAQVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-NVDTAAVE 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V        
Sbjct: 175 TLGPVLESHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGL 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 LAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL 275


>gi|123440586|ref|YP_001004580.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166225763|sp|A1JI90|DAPF_YERE8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|122087547|emb|CAL10328.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 274

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P   +        + +    H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFEPQSVPFRAA---KAEKTYILRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 GEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|238756292|ref|ZP_04617607.1| Diaminopimelate epimerase [Yersinia ruckeri ATCC 29473]
 gi|238705498|gb|EEP97900.1| Diaminopimelate epimerase [Yersinia ruckeri ATCC 29473]
          Length = 278

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 135/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  +SV+MGE
Sbjct: 65  RIFNADGSEVSQCGNGARCFARFVRIKGLTNKRDIRVSTQTGRMVLSVTDDEMVSVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + IP            + +    H  L    VVSMGNPH +  V+ D+   ++  
Sbjct: 125 PNFEPQAIPFKA---IKAEKTYILRAAEHTVLCG--VVSMGNPHCVLQVD-DVSAANVEL 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+   +V S + + LR +ERG G T ACGS ACA+V         
Sbjct: 179 LGPELENHERFPERANIGFMQVVSRQHIRLRVYERGAGETQACGSGACAAVAVGIQQALL 238

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W      ++MTG A   ++G + +
Sbjct: 239 DEDVHVELPGGSLDISWKGLGQPLYMTGPATHVYDGFIHL 278


>gi|332977414|gb|EGK14191.1| diaminopimelate epimerase [Psychrobacter sp. 1501(2011)]
          Length = 293

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 138/280 (49%), Gaps = 8/280 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+       FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLELTEELIALLADRHMGIGFDQLLVVEPPMRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ +R    ++    ET  GIL    +  G + VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVQARKLSFKQRIRVETKSGILTLTTDNYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP         ++ +H+           +V +MGNPHA+  V+ D+   D+ 
Sbjct: 122 KPRFEPAEIPFTPKAITKIQNAYHLDVEGTPV--QLYVANMGNPHAVIKVD-DILTADVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V        
Sbjct: 179 KLGGAIESHPAFPEKVNVGFVQVMNQRHIRLRVYERGVGETQACGTGACAAVATGIREGW 238

Query: 242 TN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +    +  ++ GG LLI W     V MTG     +EG  
Sbjct: 239 LDEGEEIRAQLYGGSLLIRWSPGYSVMMTGPTAFVYEGVF 278


>gi|229845797|ref|ZP_04465909.1| diaminopimelate epimerase [Haemophilus influenzae 7P49H1]
 gi|229810801|gb|EEP46518.1| diaminopimelate epimerase [Haemophilus influenzae 7P49H1]
          Length = 274

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNTGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|145630493|ref|ZP_01786273.1| diaminopimelate epimerase [Haemophilus influenzae R3021]
 gi|144983883|gb|EDJ91325.1| diaminopimelate epimerase [Haemophilus influenzae R3021]
          Length = 274

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGLLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|258543519|ref|YP_003188952.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634597|dbj|BAI00573.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637653|dbj|BAI03622.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640707|dbj|BAI06669.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643762|dbj|BAI09717.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646817|dbj|BAI12765.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649870|dbj|BAI15811.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652860|dbj|BAI18794.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655914|dbj|BAI21841.1| diaminopimelate epimerase [Acetobacter pasteurianus IFO 3283-12]
          Length = 270

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 100/277 (36%), Positives = 140/277 (50%), Gaps = 15/277 (5%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRI 66
           F KM G+GN  +++D R  H ++T   I AL+        DQ++ +        D F+R 
Sbjct: 5   FRKMHGLGNDFVILDERNGHLSLTPARIAALAHRRRGIGCDQLVTLRPACAEGADVFVRF 64

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
            N DGSE  +CGN  RCV   +      ++   +T  G L A+   +G I+VDMGEP L+
Sbjct: 65  FNPDGSEAGACGNASRCVADLIWRETGNRTPVLQTRAGRLPARIEENGLITVDMGEPRLN 124

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ +PLA   D +                +P   SMGNPHA FF    +  +   S G+ 
Sbjct: 125 WQDVPLAAEMDTLHL----------PLEGDPAAASMGNPHATFF----VEDFVRLSQGHA 170

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L   P+F E  N+  AR+     + L+  ERG G+T ACGS ACA+VV +       R  
Sbjct: 171 LEHDPLFPERANIGFARIDGPARMRLKVHERGAGVTEACGSGACAAVVNAARRGLIGRVC 230

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKT 283
            V++ GG L IEW  NNHV MTG A   +EG +D+  
Sbjct: 231 EVELDGGVLRIEWAANNHVLMTGSATTAFEGTVDLAA 267


>gi|332139611|ref|YP_004425349.1| diaminopimelate epimerase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549633|gb|AEA96351.1| diaminopimelate epimerase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 276

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 142/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           V F+KM G+GN  +VID    +   + + I  L+       FDQ++++    D   D   
Sbjct: 3   VQFSKMHGLGNDFMVIDNVTQNVFFSKEKIQQLADRNFGIGFDQLLMVEPPYDPEQDFHY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC  RF+  +  + R      T  G +V    +DG ++V+MG+
Sbjct: 63  RIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIVVSTKAGKMVLYLEKDGQVTVNMGK 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IPL  +     +                   SMGNPH +  V+ D+   ++A 
Sbjct: 123 PEFEPANIPLKAN-----KQENTYILRVGESTLFIGAASMGNPHCVMEVD-DVDTANVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ KH  FSEGVN+   ++ +   + LR +ERG G T ACGS ACA+V       K 
Sbjct: 177 IGPLVEKHERFSEGVNVGFMQIINDSHIKLRVFERGSGETLACGSGACAAVAIGQIQGKL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVF-MTGEAKKEWEGKLDI 281
           ++ V V + GG L I W   ++V  MTG A+  ++G +++
Sbjct: 237 SKDVRVDLPGGSLRIRWPGPDNVLKMTGPAEHVYDGHINL 276


>gi|270264255|ref|ZP_06192522.1| diaminopimelate epimerase [Serratia odorifera 4Rx13]
 gi|270041904|gb|EFA15001.1| diaminopimelate epimerase [Serratia odorifera 4Rx13]
          Length = 274

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P   + +      + +    H  L    VVSMGNPH +  V+ D+    +  
Sbjct: 121 PNFDPQAVPFRATKE---ERTYIMRAAEHTVLCG--VVSMGNPHCVLQVD-DVKTAKVEL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   ++ S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W    N +FMTG A   ++G + +
Sbjct: 235 SEEVHVELPGGSLHIRWKGPGNPLFMTGPATHVYDGFIHL 274


>gi|283787514|ref|YP_003367379.1| diaminopimelate epimerase [Citrobacter rodentium ICC168]
 gi|282950968|emb|CBG90645.1| diaminopimelate epimerase [Citrobacter rodentium ICC168]
          Length = 274

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 132/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      + ++                 VVSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPSQVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVLQVD-NVDTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVKREHIRLRVYERGTGETQACGSGACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 ADEVRVELTGGRLDIVWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|238763613|ref|ZP_04624573.1| Diaminopimelate epimerase [Yersinia kristensenii ATCC 33638]
 gi|238698091|gb|EEP90848.1| Diaminopimelate epimerase [Yersinia kristensenii ATCC 33638]
          Length = 274

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P            +      H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFDPQAVPFRA---TKAEKTYIFRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 GEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|148826606|ref|YP_001291359.1| diaminopimelate epimerase [Haemophilus influenzae PittEE]
 gi|166224259|sp|A5UDX5|DAPF_HAEIE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148716766|gb|ABQ98976.1| diaminopimelate epimerase [Haemophilus influenzae PittEE]
          Length = 274

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VS+GNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSIGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|309973754|gb|ADO96955.1| Diaminopimelate epimerase [Haemophilus influenzae R2846]
          Length = 274

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGSLLENHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|332159816|ref|YP_004296393.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607641|emb|CBY29139.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664046|gb|ADZ40690.1| diaminopimelate epimerase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862563|emb|CBX72717.1| diaminopimelate epimerase [Yersinia enterocolitica W22703]
          Length = 274

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P   +        + +    H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFEPQSVPFRAA---KAEKTYILRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAIGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 GEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|121587735|ref|ZP_01677496.1| diaminopimelate epimerase [Vibrio cholerae 2740-80]
 gi|121728312|ref|ZP_01681343.1| diaminopimelate epimerase [Vibrio cholerae V52]
 gi|147673333|ref|YP_001218293.1| diaminopimelate epimerase [Vibrio cholerae O395]
 gi|153214851|ref|ZP_01949659.1| diaminopimelate epimerase [Vibrio cholerae 1587]
 gi|153803077|ref|ZP_01957663.1| diaminopimelate epimerase [Vibrio cholerae MZO-3]
 gi|153818937|ref|ZP_01971604.1| diaminopimelate epimerase [Vibrio cholerae NCTC 8457]
 gi|153830024|ref|ZP_01982691.1| diaminopimelate epimerase [Vibrio cholerae 623-39]
 gi|161582035|ref|NP_229784.2| diaminopimelate epimerase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|229508404|ref|ZP_04397908.1| diaminopimelate epimerase [Vibrio cholerae BX 330286]
 gi|229508915|ref|ZP_04398405.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|229515839|ref|ZP_04405297.1| diaminopimelate epimerase [Vibrio cholerae TMA 21]
 gi|229517029|ref|ZP_04406475.1| diaminopimelate epimerase [Vibrio cholerae RC9]
 gi|229520082|ref|ZP_04409510.1| diaminopimelate epimerase [Vibrio cholerae TM 11079-80]
 gi|229606677|ref|YP_002877325.1| diaminopimelate epimerase [Vibrio cholerae MJ-1236]
 gi|255743921|ref|ZP_05417876.1| diaminopimelate epimerase [Vibrio cholera CIRS 101]
 gi|262151160|ref|ZP_06028299.1| diaminopimelate epimerase [Vibrio cholerae INDRE 91/1]
 gi|262167029|ref|ZP_06034746.1| diaminopimelate epimerase [Vibrio cholerae RC27]
 gi|262190132|ref|ZP_06048418.1| diaminopimelate epimerase [Vibrio cholerae CT 5369-93]
 gi|21362496|sp|Q9KVL6|DAPF_VIBCH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|172047519|sp|A5F4I6|DAPF_VIBC3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|121548034|gb|EAX58112.1| diaminopimelate epimerase [Vibrio cholerae 2740-80]
 gi|121629442|gb|EAX61871.1| diaminopimelate epimerase [Vibrio cholerae V52]
 gi|124115094|gb|EAY33914.1| diaminopimelate epimerase [Vibrio cholerae 1587]
 gi|124121396|gb|EAY40139.1| diaminopimelate epimerase [Vibrio cholerae MZO-3]
 gi|126510499|gb|EAZ73093.1| diaminopimelate epimerase [Vibrio cholerae NCTC 8457]
 gi|146315216|gb|ABQ19755.1| diaminopimelate epimerase [Vibrio cholerae O395]
 gi|148874509|gb|EDL72644.1| diaminopimelate epimerase [Vibrio cholerae 623-39]
 gi|229342870|gb|EEO07860.1| diaminopimelate epimerase [Vibrio cholerae TM 11079-80]
 gi|229346092|gb|EEO11064.1| diaminopimelate epimerase [Vibrio cholerae RC9]
 gi|229347102|gb|EEO12063.1| diaminopimelate epimerase [Vibrio cholerae TMA 21]
 gi|229354032|gb|EEO18965.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|229354677|gb|EEO19599.1| diaminopimelate epimerase [Vibrio cholerae BX 330286]
 gi|229369332|gb|ACQ59755.1| diaminopimelate epimerase [Vibrio cholerae MJ-1236]
 gi|255738404|gb|EET93794.1| diaminopimelate epimerase [Vibrio cholera CIRS 101]
 gi|262024547|gb|EEY43231.1| diaminopimelate epimerase [Vibrio cholerae RC27]
 gi|262031054|gb|EEY49679.1| diaminopimelate epimerase [Vibrio cholerae INDRE 91/1]
 gi|262033986|gb|EEY52440.1| diaminopimelate epimerase [Vibrio cholerae CT 5369-93]
          Length = 276

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPNKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 274


>gi|238789381|ref|ZP_04633167.1| Diaminopimelate epimerase [Yersinia frederiksenii ATCC 33641]
 gi|238722524|gb|EEQ14178.1| Diaminopimelate epimerase [Yersinia frederiksenii ATCC 33641]
          Length = 274

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P   +        + +    H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFDPQTVPFRAA---KAEKTYILRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPELESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 SEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|297816660|ref|XP_002876213.1| diaminopimelate epimerase family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297322051|gb|EFH52472.1| diaminopimelate epimerase family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 362

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 94/288 (32%), Positives = 137/288 (47%), Gaps = 13/288 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           ++ ++ F K  G+GN  +++D R   +  IT +    L         D ++      +  
Sbjct: 74  ETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVN-G 132

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +   + SFT  T  G++V +   DG +
Sbjct: 133 TDYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQV 192

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED--- 173
            VDMG PIL  + +P     +           V      N   VSMGNPH I F +    
Sbjct: 193 KVDMGTPILKAQDVPTKLPGN-KGEAVVQAELVVDGESWNVTCVSMGNPHCITFGKKGGP 251

Query: 174 --DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +   +L   G    +H MF    N     V S   L +R WERG G T ACG+ ACA
Sbjct: 252 NLKVDDLNLPEIGPKFERHEMFPARTNTEFVEVLSHSHLKMRVWERGAGATLACGTGACA 311

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGK 278
            VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G 
Sbjct: 312 LVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS 359


>gi|188026351|ref|ZP_02961775.2| hypothetical protein PROSTU_03841 [Providencia stuartii ATCC 25827]
 gi|188020072|gb|EDU58112.1| hypothetical protein PROSTU_03841 [Providencia stuartii ATCC 25827]
          Length = 278

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 88/285 (30%), Positives = 134/285 (47%), Gaps = 11/285 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M+ +M  F+KM G+GN  +V+D    +   + + I+ L+       FDQ++L+    D  
Sbjct: 1   MERNM-QFSKMHGLGNDFMVVDGVTQNVYFSPELISRLADRHTGVGFDQLLLVEAPYDPD 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D   RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V   N +  + 
Sbjct: 60  LDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKQKIKVSTQSGRMVLTINENDDVC 119

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MGEP  + + +P      +  +                 VVSMGNPH +  VE  +  
Sbjct: 120 VNMGEPEFEPQKVPF-----RAIKAEKTYIIRALERTVLCGVVSMGNPHCVIQVE-SVKT 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            ++   G +L  H  F E  N+    + S   + LR +ERG G T ACGS ACA+V    
Sbjct: 174 AEVEILGPVLESHERFPERTNVGFMEIVSAHHIRLRVFERGAGETQACGSGACAAVAIGI 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
                   V V + GG L I W+     ++MTG A   ++G + +
Sbjct: 234 QQGLLANQVKVDLPGGSLDISWNGPGTPLYMTGPASHVYDGVIQL 278


>gi|297581833|ref|ZP_06943754.1| diaminopimelate epimerase [Vibrio cholerae RC385]
 gi|297533927|gb|EFH72767.1| diaminopimelate epimerase [Vibrio cholerae RC385]
          Length = 290

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 18  HFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 77

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 78  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 137

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I       L     VSMGNPH +  V+ D+    + + 
Sbjct: 138 EFEPNKIPF----RAKQSEKTYILRAGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 191

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V         +
Sbjct: 192 GPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGLLD 251

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 252 EQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 288


>gi|329297031|ref|ZP_08254367.1| diaminopimelate epimerase [Plautia stali symbiont]
          Length = 274

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 129/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +      T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKSDIRVSTQTGRMVLSVTSDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +PL     + ++                  VSMGNPH +  VE  +    + +
Sbjct: 121 PNFDPQQVPL-----RANKAENLYLQRVAEQTVMFGAVSMGNPHCVIQVE-SVKTAAVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E VN+    V + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPALESHERFPERVNVGFMEVVNPEHIRLRVYERGAGETQACGSGACAAVACGIQQGIL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W      +FMTG A   ++G + +
Sbjct: 235 AVKVRVDLPGGTLHIAWKGAGQPLFMTGPATHVYDGFIHL 274


>gi|260428165|ref|ZP_05782144.1| diaminopimelate epimerase [Citreicella sp. SE45]
 gi|260422657|gb|EEX15908.1| diaminopimelate epimerase [Citreicella sp. SE45]
          Length = 279

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 150/289 (51%), Gaps = 19/289 (6%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
           S  + F KM G+GN  +V+D R     +T   + A++       FDQ+ LI      + D
Sbjct: 8   SDTLPFMKMHGLGNDFVVLDGRAQTMRLTPSLVRAIADRHRGVGFDQLALIEP---GAGD 64

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A +   N DGS   +CGN  RC+ R+L  +  R   T  T RG L+A++   G  SV+MG
Sbjct: 65  ARLTFYNADGSTAGACGNATRCIARYLMDKTGRDRLTLVTERGALLAEDAGAGLTSVNMG 124

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P LDW  IPLAR  D ++                P    MGNPH  FFVE D    DL 
Sbjct: 125 QPQLDWHEIPLAREMDTLEL----------PIDGAPTATGMGNPHCTFFVE-DAEAVDLT 173

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           SFG +   HP++ E  N+ +A +   + + +R WERG GLT A GS++CA+ VA+     
Sbjct: 174 SFGPVHEHHPLYPERTNVQVASIIGPDHIRMRVWERGAGLTLASGSSSCATAVAAARRGL 233

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKN 290
           T R V++++ GG L ++W ++  V+MTG     ++G     +  W++  
Sbjct: 234 TGRKVTIELDGGTLQVDWREDG-VWMTGGTAHVFDGSF---SRAWLEAA 278


>gi|118591329|ref|ZP_01548727.1| diaminopimelate epimerase [Stappia aggregata IAM 12614]
 gi|118436001|gb|EAV42644.1| diaminopimelate epimerase [Stappia aggregata IAM 12614]
          Length = 303

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 123/296 (41%), Positives = 169/296 (57%), Gaps = 5/296 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M S    F KM G+GN  +V D R     +  +AI AL        FDQ++ +       
Sbjct: 1   MASETRPFLKMNGLGNDFVVWDARENPLRLAPEAIAALGDRETGIGFDQMITVERS-SLG 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKE-NRDGSISV 118
           VDAF+RI N DGSEV +CGN  RC+ R L     +   T ET  G+L A + +   S++V
Sbjct: 60  VDAFMRIHNRDGSEVSACGNATRCIGRLLMEEAGKDLVTIETGAGLLHAFDADGPRSVTV 119

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L W  IPLA  F         IGP++   L  P VV+MGNPHAIF+V+ D+  Y
Sbjct: 120 DMGVPRLAWNEIPLAEEFADTRAIELQIGPIDDPILHTPAVVNMGNPHAIFWVD-DVEAY 178

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           +L   G LL  HP+F E  N+S+A V   + + ++ WERGVGLT ACG+AACA  VA+  
Sbjct: 179 ELERVGPLLEHHPIFPEYANISLAHVFDTDQIRVKVWERGVGLTLACGTAACAVGVAAAR 238

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDD 293
             +T+R  ++ + GG + IEW + +NHV M+G  + E+EG++D+ T  W K    D
Sbjct: 239 DGRTSRKTTIHLPGGPIGIEWRESDNHVLMSGLTEVEFEGEVDLDTLAWRKTAAGD 294


>gi|153822333|ref|ZP_01975000.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|153826286|ref|ZP_01978953.1| diaminopimelate epimerase [Vibrio cholerae MZO-2]
 gi|227080362|ref|YP_002808913.1| diaminopimelate epimerase [Vibrio cholerae M66-2]
 gi|254291935|ref|ZP_04962716.1| diaminopimelate epimerase [Vibrio cholerae AM-19226]
 gi|254851510|ref|ZP_05240860.1| diaminopimelate epimerase [Vibrio cholerae MO10]
 gi|298501106|ref|ZP_07010906.1| diaminopimelate epimerase [Vibrio cholerae MAK 757]
 gi|9654526|gb|AAF93303.1| diaminopimelate epimerase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|126520159|gb|EAZ77382.1| diaminopimelate epimerase [Vibrio cholerae B33]
 gi|149739954|gb|EDM54133.1| diaminopimelate epimerase [Vibrio cholerae MZO-2]
 gi|150422145|gb|EDN14111.1| diaminopimelate epimerase [Vibrio cholerae AM-19226]
 gi|227008250|gb|ACP04462.1| diaminopimelate epimerase [Vibrio cholerae M66-2]
 gi|227011872|gb|ACP08082.1| diaminopimelate epimerase [Vibrio cholerae O395]
 gi|254847215|gb|EET25629.1| diaminopimelate epimerase [Vibrio cholerae MO10]
 gi|297540140|gb|EFH76201.1| diaminopimelate epimerase [Vibrio cholerae MAK 757]
          Length = 290

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 18  HFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 77

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 78  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 137

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 138 EFEPNKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 191

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V         +
Sbjct: 192 GPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGLLD 251

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 252 EQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 288


>gi|262163684|ref|ZP_06031425.1| diaminopimelate epimerase [Vibrio mimicus VM223]
 gi|262027900|gb|EEY46564.1| diaminopimelate epimerase [Vibrio mimicus VM223]
          Length = 290

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 18  HFSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 77

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 78  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMGVP 137

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I       L     VSMGNPH +  V+ D+    + + 
Sbjct: 138 EFEPSKIPF----RAKQSEKTYILRAGEQTLFCG-AVSMGNPHVVTVVD-DIRAAAVETL 191

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V         +
Sbjct: 192 GPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 251

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 252 EQVRVHLPGGELEISWKGPGKPLYMTGPATHVYDGQI 288


>gi|229525022|ref|ZP_04414427.1| diaminopimelate epimerase [Vibrio cholerae bv. albensis VL426]
 gi|229338603|gb|EEO03620.1| diaminopimelate epimerase [Vibrio cholerae bv. albensis VL426]
          Length = 276

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 136/277 (49%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPNKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
             V V + GG L I W   +  ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEIHWQGPSKPLYMTGPATHIYDGQI 274


>gi|325266086|ref|ZP_08132772.1| diaminopimelate epimerase [Kingella denitrificans ATCC 33394]
 gi|324982724|gb|EGC18350.1| diaminopimelate epimerase [Kingella denitrificans ATCC 33394]
          Length = 283

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 141/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDA 62
           + + F+KM G+GN  +VID         +  I A +       FDQ++L+       VD 
Sbjct: 2   TTLKFSKMHGLGNDFMVIDGTRQTFRPDAAQIQAWADRHTGIGFDQLLLVEKTDTPDVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DG EV+ CGNG RC V+F++      +++   ET RGI+    N +G I+V+M
Sbjct: 62  RYRIFNADGGEVEQCGNGARCFVKFVSEHGLTDKRTIRVETARGIIEPSLNDNGLITVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P    + +P      +   ++     VN L      ++SMGNPHA+  VE D     +
Sbjct: 122 GQPQFAPQDVPFVLRSGEQAGEK-SYIVVNELDSAQMSLLSMGNPHAVMLVE-DTASAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A +G  L  HP F   VN+   +V     + LR +ERG G T ACG+ ACA+VV+     
Sbjct: 180 AEWGAALQNHPRFPARVNVGFMQVVDAHHIRLRVFERGSGETQACGTGACAAVVSGVRWG 239

Query: 241 KT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                  V V + GG L I W +   V+MTG A   +EG+L
Sbjct: 240 LLAAGEDVRVSLPGGDLYIRWAEGEPVWMTGPAVTVFEGEL 280


>gi|144897540|emb|CAM74404.1| Diaminopimelate epimerase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 280

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 102/274 (37%), Positives = 150/274 (54%), Gaps = 8/274 (2%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
            F KM G+GN  +V+D+R     +T     A++        DQ+++I   +    DA++ 
Sbjct: 8   PFLKMHGLGNDFVVVDVRRSGFVLTPAMARAIADRRTGLGCDQVVVIETARSGLSDAWMS 67

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           + N DGS   +CGN  RCV   L  +        ET  G+L A+   D  ++VDMG   L
Sbjct: 68  LWNADGSVTSACGNATRCVAWLLMQQAGSDHAVIETKAGLLDAEMRGDKLVAVDMGPARL 127

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW+ IPLA+  D +         +    L +P  VSMGNPHA+FFV+ D+   DLA+ G 
Sbjct: 128 DWREIPLAKPVDTL------HMGIGIGSLTDPVGVSMGNPHAVFFVD-DVAAIDLAALGP 180

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  H +F E  N+ +A+V + + + +R WERG G+T+ACG+ ACA++VA+     T R 
Sbjct: 181 VLEHHDLFPERANIEVAQVLAPDRIRMRVWERGTGITSACGTGACATLVAAARRGLTARK 240

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             V + GG L IEW  ++HV MTG      EG+L
Sbjct: 241 ADVVLDGGVLTIEWLPDDHVMMTGPVALVAEGRL 274


>gi|294678992|ref|YP_003579607.1| diaminopimelate epimerase [Rhodobacter capsulatus SB 1003]
 gi|294477812|gb|ADE87200.1| diaminopimelate epimerase [Rhodobacter capsulatus SB 1003]
          Length = 277

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 98/275 (35%), Positives = 137/275 (49%), Gaps = 17/275 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R   + +T     AL        FDQ+ +I   +    D  +
Sbjct: 11  LRFLKMHGLGNDFVVIDARSGENPVTPALARALGDRHRGVGFDQLAVILPAE--GADFTL 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS+  +CGN  RCV   +   + +   T  T RG L A+   DG +SV+MG PI
Sbjct: 69  EFWNSDGSKAGACGNATRCVSDLMMRDLGKDRVTLTTARGRLSAERRADGLVSVNMGAPI 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LD   IP+A              P+      +P  V MGNPH +FFVE D    D++  G
Sbjct: 129 LDPAAIPVAAD------------PLALPLTGDPVAVGMGNPHCVFFVE-DAETADVSGLG 175

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +  HP+F E  N+  A +   + L +R WERG G+T ACGS  CA+ VA+     T R
Sbjct: 176 PKIEHHPLFPERTNVEFASLIGPDHLRMRVWERGAGITLACGSGTCATAVAAHLRGLTGR 235

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V V + GG L I+W ++  V+MTG     +  +L
Sbjct: 236 RVIVDVDGGRLEIDWREDG-VWMTGPTALVFAAEL 269


>gi|15231841|ref|NP_190926.1| diaminopimelate epimerase family protein [Arabidopsis thaliana]
 gi|75263858|sp|Q9LFG2|DAPF_ARATH RecName: Full=Diaminopimelate epimerase, chloroplastic; Short=DAP
           epimerase; Flags: Precursor
 gi|6729509|emb|CAB67665.1| diaminopimelate epimerase-like protein [Arabidopsis thaliana]
 gi|22022530|gb|AAM83223.1| AT3g53580/F4P12_280 [Arabidopsis thaliana]
 gi|23505901|gb|AAN28810.1| At3g53580/F4P12_280 [Arabidopsis thaliana]
 gi|332645592|gb|AEE79113.1| diaminopimelate epimerase [Arabidopsis thaliana]
          Length = 362

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 95/288 (32%), Positives = 137/288 (47%), Gaps = 13/288 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           ++ ++ F K  G+GN  +++D R   +  IT +    L         D ++      +  
Sbjct: 74  ETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVN-G 132

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +   + SFT  T  G++V +   DG +
Sbjct: 133 TDYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQV 192

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED--- 173
            VDMG PIL  + +P   S +           V      N   VSMGNPH I F +    
Sbjct: 193 KVDMGTPILKAQDVPTKLSGN-KGEAVVEAELVVDGVSWNVTCVSMGNPHCITFGKKGGP 251

Query: 174 --DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +   +L   G     H MF    N     V S   L +R WERG G T ACG+ ACA
Sbjct: 252 NLKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWERGAGATLACGTGACA 311

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGK 278
            VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G 
Sbjct: 312 LVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS 359


>gi|206890939|ref|YP_002248958.1| diaminopimelate epimerase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742877|gb|ACI21934.1| diaminopimelate epimerase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 279

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 93/279 (33%), Positives = 148/279 (53%), Gaps = 8/279 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  ++ID          + AI+  +       DQ++L++  Q A  D  +
Sbjct: 4   INFVKMHGLGNDFILIDCLKNDLPKPQEFAIHYCNRRFGIGADQLLLLYPSQIA--DFKM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGS-ISVDMGEP 123
           +I N DGSEV+ CGNG+RC  +++  R        E      + K  + G  + VDMG+P
Sbjct: 62  KIFNADGSEVEMCGNGIRCFAKYIWDRGLSNKDVLEVETLAGIIKPKKVGELVQVDMGKP 121

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
                 IP+    D        +   +         VSMGNPHA+ F++++  ++ +  +
Sbjct: 122 EFHPNKIPVDVEGDSAFDLMLEVSGWHARIN----CVSMGNPHAVIFLDEEPKNFAVTKY 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+  HP+F +  N+  A V +   + +R WERG G T ACG+ ACA+ VA+     TN
Sbjct: 178 GPLIENHPIFPKRTNVEFAYVKNSSEIVMRVWERGAGETLACGTGACATAVAAMVKEFTN 237

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           + V+V +LGG LLIEW  + HV+MTG A++ +EG + + 
Sbjct: 238 KKVTVHLLGGDLLIEWAADGHVYMTGPAQEVFEGVVKVP 276


>gi|238760179|ref|ZP_04621326.1| Diaminopimelate epimerase [Yersinia aldovae ATCC 35236]
 gi|238701615|gb|EEP94185.1| Diaminopimelate epimerase [Yersinia aldovae ATCC 35236]
          Length = 274

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P            +      H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFDPQTVPFKA---IKAERTYIFRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 SEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|113461746|ref|YP_719815.1| diaminopimelate epimerase [Haemophilus somnus 129PT]
 gi|122945419|sp|Q0I572|DAPF_HAES1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|112823789|gb|ABI25878.1| diaminopimelate epimerase [Haemophilus somnus 129PT]
          Length = 274

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 144/280 (51%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAVTQNVYFPTEVIKRLADRNRGIGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +K     T +G ++ +   D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVVLKGLTDKKEIAVSTAKGKMMLRVKDDDMVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   + +K +++      +  L      VVSMGNPH +  VE D+ H ++  
Sbjct: 121 PIWEPNKIPF--NANKFEKNYIIRTDIQTLLCG---VVSMGNPHCVTQVE-DIQHANIEI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINRNHIKLRVYERGAGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L+IEW    H ++MTGEA   ++G + +
Sbjct: 235 DNNVQVDLPGGRLMIEWQGKGHPLYMTGEATHIYDGVIRL 274


>gi|258622842|ref|ZP_05717859.1| diaminopimelate epimerase [Vibrio mimicus VM573]
 gi|258584903|gb|EEW09635.1| diaminopimelate epimerase [Vibrio mimicus VM573]
          Length = 276

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPSKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEISWKGPGKPLYMTGPATHVYDGQI 274


>gi|282600071|ref|ZP_05972889.2| diaminopimelate epimerase [Providencia rustigianii DSM 4541]
 gi|282566942|gb|EFB72477.1| diaminopimelate epimerase [Providencia rustigianii DSM 4541]
          Length = 278

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 129/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAI-NALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I           FDQ++L+    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDGVTQNVYFSPELICRLADRHTGVGFDQLLLVEAPYDPDLDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +    N +  + V+MGE
Sbjct: 65  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKQKIKVSTQSGRMTLTINENDDVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +  ++                VVSMGNPH +  VE  +   ++  
Sbjct: 125 PEFEPQKVPF-----RAVKEEKTYIIRAQERTVLCGVVSMGNPHCVVQVE-SVQTAEVEV 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+    + S E + LR +ERG G T ACGS ACA+V         
Sbjct: 179 LGPALESHERFPERANIGFMEIVSAEHIRLRVYERGAGETQACGSGACAAVAVGIGQGLL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           ++ V V + GG L I W      ++MTG A   ++G + I
Sbjct: 239 SKRVRVDLPGGSLDISWDGPGTPLYMTGPATHVYDGVIQI 278


>gi|322513262|ref|ZP_08066386.1| diaminopimelate epimerase [Actinobacillus ureae ATCC 25976]
 gi|322120969|gb|EFX92816.1| diaminopimelate epimerase [Actinobacillus ureae ATCC 25976]
          Length = 279

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 6   MQFSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHTGVGFDQLLLVEPPYDPDLDFHY 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G ++     +  + V+MGE
Sbjct: 66  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMILTLKGEEKVRVNMGE 125

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 126 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DIKTAPVNE 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 180 LGPLLENHERFPERANIGFIQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGLL 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 240 DSNVQVDLPGGSLQIEWKGVGHPLYMTGDATHIYDGFIKL 279


>gi|58039894|ref|YP_191858.1| diaminopimelate epimerase [Gluconobacter oxydans 621H]
 gi|81557036|sp|Q5FQZ4|DAPF_GLUOX RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|58002308|gb|AAW61202.1| Diaminopimelate epimerase [Gluconobacter oxydans 621H]
          Length = 257

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 100/274 (36%), Positives = 135/274 (49%), Gaps = 22/274 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R     + +  I  L         DQ++L+     A  D  +
Sbjct: 3   LSFTKMHGLGNDFVVIDGRQNDPALETATIRHLCDRRFGIGCDQLVLLTPPTLAGADVHV 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           R  N DGSE  +CGN  RCV +F+         T +T  G L+         +VDMG P 
Sbjct: 63  RFFNPDGSEAGACGNASRCVAKFVGGA-----PTLQTAAG-LLPTAQDGDLFTVDMGTPR 116

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ +PL+R+ D +           HL L +    SMGNPHA  F       +   + G
Sbjct: 117 LDWQDVPLSRACDTL-----------HLPLHDAAACSMGNPHATLFG----DAFRAEALG 161

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             L + P+F E  N+  A++ S   + LR WERG GLT ACGS ACA+VV +     T R
Sbjct: 162 PGLERDPLFPERANIGFAQILSPIHMRLRVWERGAGLTLACGSGACAAVVNAVRRGLTER 221

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
             +V M GG L I W ++ HVFMTG A   + G 
Sbjct: 222 TCTVTMDGGDLRITWREDGHVFMTGPAVTVFHGT 255


>gi|145343420|ref|XP_001416323.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144576548|gb|ABO94616.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 407

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 91/293 (31%), Positives = 138/293 (47%), Gaps = 15/293 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGC-HDNITSDAINALSTD-DNTHFDQIMLIHDFQDASV 60
           S  +DF K +G+GN  ++ID R      ++S+A   +         D ++      DAS 
Sbjct: 116 SRTIDFIKYQGLGNDFILIDNRDSATVKMSSEAAAKMCDRNFGIGGDGVIFAMPPNDASE 175

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D  +R+ N DGSE + CGNG+RC+ RF++    M  K +   T+ G++  +   DG ++V
Sbjct: 176 DYSMRMFNSDGSEPEMCGNGIRCLARFVSDLDAMPPKKYKVGTLAGLIQPEMRADGQVAV 235

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-------- 170
           DMG PI +   +P   +    D                   VSMGNPH I F        
Sbjct: 236 DMGMPIFEPSEVPTTLAA-TQDGKVVRAEMDVDGEKWLVNAVSMGNPHCITFGRAGGEAD 294

Query: 171 -VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
                L  + L+  G     HP F    N    +V +   + +  WERG G T ACG+ A
Sbjct: 295 GPGLKLDEFPLSVVGPKFESHPCFPARTNTEFTQVVNRNYVKMHVWERGAGATLACGTGA 354

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           CA+VVA     + +R  +V++ GG L IEW + +  + MTG A+  + GK  +
Sbjct: 355 CATVVAGVLEGRVDRRCTVELPGGPLEIEWRESDGRIIMTGPAEPVFAGKYFL 407


>gi|300313578|ref|YP_003777670.1| diaminopimelate epimerase [Herbaspirillum seropedicae SmR1]
 gi|300076363|gb|ADJ65762.1| diaminopimelate epimerase protein [Herbaspirillum seropedicae SmR1]
          Length = 287

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 91/283 (32%), Positives = 138/283 (48%), Gaps = 7/283 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      +++      ++        DQ++++   +   VD   
Sbjct: 3   IKFTKMHGAGNDFVVLDAINQSISLSPAQWQFIADRRFGIGADQMLVVEKARGEGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG R  V+F+T +    +++   ET+ G++  +   DG I+VDMG 
Sbjct: 63  RIYNADGGEVEQCGNGARAFVKFVTDKGLTSKRAIRVETMSGVIEPRLEDDGQITVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           PIL    +P      +   +                  VVSMGNPHA+  VE D     +
Sbjct: 123 PILTPADVPFDSHGLQHRNEAEDTLWPLDVAGKTTWISVVSMGNPHAVQVVE-DSEAAPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            S G L+ +H  F + VN    +V     ++LR +ERG G T ACG+ ACA+VVA     
Sbjct: 182 LSEGPLIERHERFPKRVNAGFMQVVDRHHVNLRVYERGAGETLACGTGACAAVVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIK 282
             +  V+V+  GG L I W      V MTG A   +EG++++ 
Sbjct: 242 LLDSPVAVQTHGGVLNIAWAGPGEAVMMTGPAVSVYEGEIELP 284


>gi|33151302|ref|NP_872655.1| diaminopimelate epimerase [Haemophilus ducreyi 35000HP]
 gi|71153321|sp|Q7VPN0|DAPF_HAEDU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33147522|gb|AAP95044.1| diaminopimelate epimerase [Haemophilus ducreyi 35000HP]
          Length = 274

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEDMIRKLADRHYGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF++ +  + R      T +G +V     + ++ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVSLKGLINRSDMYVSTAKGKMVLTLVDEENVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      L      VVSMGNPH +  V+ D+    +  
Sbjct: 121 PIWEPAKIPF-----IANKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVD-DIEQATVHQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL KH  F E  N+   ++     + LR +ERGVG T ACGS ACA+V         
Sbjct: 175 LGALLEKHHRFPERANVGFMQIIDRHHIKLRVFERGVGETKACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW      ++MTG A   ++G + +
Sbjct: 235 DANVQVSLPGGTLQIEWQGKGKPLYMTGTATHIYDGFIKL 274


>gi|149191482|ref|ZP_01869731.1| diaminopimelate epimerase [Vibrio shilonii AK1]
 gi|148834670|gb|EDL51658.1| diaminopimelate epimerase [Vibrio shilonii AK1]
          Length = 276

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSPDLIRRLADRHTGVGFDQLLIVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +    + S +  T +G +V K   +  ++V+MG+P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVQMKGLTNKYSVSVSTKKGKMVLKLEENDLVTVNMGQP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH +  V+      D+   
Sbjct: 124 EFEPNKIPFKAK----QKEKTYILRAGEHTLFCG-AVSMGNPHVVTVVD-STEEADVDRL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S   ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVLSRHEVNLRVYERGAGETQACGSGACGAVAVGIVQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V+V + GG L I W    H + MTG A   ++G++
Sbjct: 238 ENVTVHLPGGDLKISWKGEGHPLTMTGPATHVFDGQI 274


>gi|34497983|ref|NP_902198.1| diaminopimelate epimerase [Chromobacterium violaceum ATCC 12472]
 gi|81655424|sp|Q7NV18|DAPF_CHRVO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|34103838|gb|AAQ60199.1| diaminopimelate epimerase [Chromobacterium violaceum ATCC 12472]
          Length = 276

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID      ++T + I  L        FDQ++L+   ++A  D   
Sbjct: 3   LKFSKMHGLGNDFMVIDGVRQTVSLTPEQIRLLGNRQLGIGFDQLLLVEPAREAGHDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  +F+  +    +     ET RG++  +   DG   VDMG 
Sbjct: 63  RIFNNDGGEVEQCGNGARCFAKFVRDQGLTGKSRIEVETARGVIAPEYLGDGLARVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      +P     + +            + +      SMGNPHA+  V+ D+    +A 
Sbjct: 123 PRFRPADLPFLADAEALTYSLPLPEGRCEIGI-----ASMGNPHAVQRVD-DVDAAPVAE 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F + VN    ++ +   + LR +ERG G T ACG+ ACA+VV        
Sbjct: 177 VGPAIESHPAFPQRVNAGFMQIVNRGEIRLRVYERGAGETLACGTGACAAVVCGIRQGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V+V   GG ++IEW      V MTG A   ++G++++
Sbjct: 237 DARVTVHARGGDIVIEWAGEGSPVIMTGPAVTVFQGEIEL 276


>gi|291327138|ref|ZP_06127132.2| diaminopimelate epimerase [Providencia rettgeri DSM 1131]
 gi|291311701|gb|EFE52154.1| diaminopimelate epimerase [Providencia rettgeri DSM 1131]
          Length = 278

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 84/280 (30%), Positives = 129/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAI-NALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I           FDQ++L+    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDGVTQNVYFSPELICRLADRHTGVGFDQLLLVEAPYDPDLDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +    N +  + V+MGE
Sbjct: 65  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKQKIKVSTQSGRMTLTINENDGVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +  ++                VVSMGNPH +  VE  ++  ++  
Sbjct: 125 PDFEPQRVPF-----RAVKEEKTYIIRAQERTVLCGVVSMGNPHCVIQVE-SIHTAEVEV 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+    + S + + LR +ERG G T ACGS ACA+V         
Sbjct: 179 LGPALENHERFPERANIGFMEIISADHIRLRVYERGAGETQACGSGACAAVAVGITQGLL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            + V V + GG L I W      ++MTG A   ++G + +
Sbjct: 239 AKRVKVDLPGGSLDISWEGPGSPLYMTGPATHVYDGVIQL 278


>gi|298369275|ref|ZP_06980593.1| diaminopimelate epimerase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283278|gb|EFI24765.1| diaminopimelate epimerase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 282

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 139/284 (48%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID            ++A S       FDQ++L+       
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDGINQTFEPKEAPLSAWSDRFRGVGFDQLLLVERPSSEL 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV  CGNG RC VRF+T +    +K    ET  G++V +   +G ++
Sbjct: 59  VDFRYRIFNADGGEVGQCGNGARCFVRFVTDKGLTDKKEILVETAGGVIVPRLLENGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP        D D      +  L       V+MGNPHA+  VE D   
Sbjct: 119 VNMGQPRFMPSEIPFVPDSG-EDSDALTHIILVGLESVPVSCVNMGNPHAVIIVE-DTET 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +  +G  +  H  F E VN+   ++ +   + LR +ERG G T ACG+ ACA+VVA  
Sbjct: 177 APVGQWGEAIESHEQFPERVNVGFMQIINRREIRLRVYERGTGETQACGTGACAAVVAGV 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +   +V V + GG L I W     V MTG A+  +EG+L
Sbjct: 237 RLGLLDAGESVKVMLPGGDLFISWAPEGGVMMTGPAETVFEGEL 280


>gi|190150861|ref|YP_001969386.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|307264212|ref|ZP_07545803.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|229807483|sp|B3GYL3|DAPF_ACTP7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189915992|gb|ACE62244.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|306870458|gb|EFN02211.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 274

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLAPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 235 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 274


>gi|303253047|ref|ZP_07339199.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302648111|gb|EFL78315.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
          Length = 274

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLAPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 235 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 274


>gi|238793578|ref|ZP_04637202.1| Diaminopimelate epimerase [Yersinia intermedia ATCC 29909]
 gi|238727168|gb|EEQ18698.1| Diaminopimelate epimerase [Yersinia intermedia ATCC 29909]
          Length = 274

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +P            + +    H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PNFDPQTVPFRA---TKAEKTYILRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLESHERFPERANIGFMQVVSREQIRLRVYERGAGETQACGSGACAAVAVGIQQELL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL 274


>gi|89091914|ref|ZP_01164869.1| diaminopimelate epimerase [Oceanospirillum sp. MED92]
 gi|89083649|gb|EAR62866.1| diaminopimelate epimerase [Oceanospirillum sp. MED92]
          Length = 280

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 135/281 (48%), Gaps = 6/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           +V F KM G+GN  +V+D+      +T   +  L        FDQ++++    +  +D  
Sbjct: 2   LVRFTKMHGLGNDFMVLDLVTQRVKVTPKLVKKLGDRNFGVGFDQLLIVEPPSEPDIDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV++CGNG RC  +F+  +    +     +T  G +  K + D  + V+MG
Sbjct: 62  YRIFNQDGSEVENCGNGARCFAKFVRDKRLTGKSEVVVQTANGQMTLKIHPDKRVEVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PIL    +P                      +     +SMGNPH +  V+    +  + 
Sbjct: 122 APILAPVDVPFQADQKATTYAIDVPLSQGDQQVELS-AISMGNPHGVLIVD-STENAPVE 179

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  L  H  F    N+   +V S   ++LR +ERGVG T ACG+ ACA+VVA      
Sbjct: 180 TLGPALEAHERFPAKANIGFMQVISRNEVNLRVFERGVGETIACGTGACAAVVAGKLRGV 239

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            +  V+V + GG L IEWH +   V MTG A   +EG++ +
Sbjct: 240 LDMPVTVHLPGGDLEIEWHGEGQPVIMTGPATTVYEGQIFV 280


>gi|307132971|ref|YP_003884987.1| diaminopimelate epimerase [Dickeya dadantii 3937]
 gi|306530500|gb|ADN00431.1| diaminopimelate epimerase [Dickeya dadantii 3937]
          Length = 274

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 133/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHCGVGFDQLLIVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDINVSTHNGRMVLSVTEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P   +        + +    H  L     VSMGNPH +  V+ ++    + +
Sbjct: 121 PNFEPQQVPFRAA---KPEKTYILRAAEHTVLCG--AVSMGNPHCVIQVD-NVDTAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLESHERFPERANVGFMQVVNSGLIRLRVFERGAGETQACGSGACGAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H +FMTG A   ++G + +
Sbjct: 235 AADVKVQLPGGELEIHWDGPGHPLFMTGPATHVYDGFMHL 274


>gi|303250998|ref|ZP_07337186.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|302650155|gb|EFL80323.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 274

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKSLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLTPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 235 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 274


>gi|160896900|ref|YP_001562482.1| diaminopimelate epimerase [Delftia acidovorans SPH-1]
 gi|160362484|gb|ABX34097.1| Diaminopimelate epimerase [Delftia acidovorans SPH-1]
          Length = 286

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 88/283 (31%), Positives = 142/283 (50%), Gaps = 8/283 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +++     L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETAGPLGLSAAQYRFLAHRQFGVGADQILTVRPSPAEGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC  R++  +    +     +T+ G++  + + DG ++VDMG+
Sbjct: 63  VIHNADGGEVEQCGNGARCFARYVHDKGLTGKSVIRVQTLAGLIAPELHADGRVTVDMGQ 122

Query: 123 PILDWKLIPLARSF---DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           P+L+  L+P   +      +   +     +          VSMGNPHA+  V+ D+ H  
Sbjct: 123 PVLEPSLVPFNGADLVPRPLGAAQQWPLQLGDEATVWIAPVSMGNPHAVQLVD-DVDHAP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A++G L+ +H  F + VN    ++     + LR +ERG G T ACG+ ACA+VVA    
Sbjct: 182 VATWGPLIERHVRFPQRVNAGFMQIVDRGQIRLRVYERGAGETLACGTGACAAVVAGIRW 241

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +  V V   GG L IEW D   V MTG A+  +EG++++ 
Sbjct: 242 GLLDARVDVHTRGGRLTIEW-DGGAVRMTGPAEFVFEGQIEVP 283


>gi|255636095|gb|ACU18392.1| unknown [Glycine max]
          Length = 359

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 95/291 (32%), Positives = 139/291 (47%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNIT--SDAINALSTDDNTHFDQIMLIHDFQDAS 59
           +S  + FAK  G+GN  ++ID R   +       A+     +     D ++ +     + 
Sbjct: 71  ESGFLHFAKYHGLGNDFVLIDNRDSSEPKISAEKAVQLCDRNFGVGADGVIFVLPG-ISG 129

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  +F+    +   R SFT  T  G+++ +   DG++
Sbjct: 130 TDYTMRIFNSDGSEPEMCGNGVRCFAKFVSQLENLHGRHSFTIHTGAGLIIPEVLEDGNV 189

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-----V 171
            VDMGEPIL    +P     +  D        V    + +   VSMGNPH + F      
Sbjct: 190 RVDMGEPILKASDVPTKLHAN-KDNAVVKSELVVDGVIWHVTCVSMGNPHCVTFSREGSQ 248

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    LA  G     H +F    N    +V S   L +  WERG G T ACG+ ACA
Sbjct: 249 NLLVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSNSHLKMCVWERGAGATLACGTGACA 308

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +VVA+    +  R  +V + GG L IEW  ++NHV+MTG A   + G L +
Sbjct: 309 TVVAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGSADVVYYGSLPL 359


>gi|169831756|ref|YP_001717738.1| diaminopimelate epimerase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|229807496|sp|B1I545|DAPF_DESAP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169638600|gb|ACA60106.1| Diaminopimelate epimerase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 278

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 88/282 (31%), Positives = 136/282 (48%), Gaps = 15/282 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC--HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F KM G+GN  ++++  G    D+  + A            D ++L+     A+ D  
Sbjct: 1   MEFTKMHGLGNDFVIVNGFGQSLPDDPGALARRVCDRRLGVGADGLVLLLPS--AAADLR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTS-----RMKRKSFTFETIRGILVAKENRDGSISV 118
           +R+ N DGSE + CGN +RCV  +        + + +  T   +    +  +    ++ V
Sbjct: 59  MRVFNPDGSEPEMCGNAIRCVALYARRRGLVAKTQLEVETLAGLIRPEILLDGDRETVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L+   IP+      +  +    G  + +       VSMGNPH + F   DL   
Sbjct: 119 DMGRPRLERAEIPMRGPAGPVVGEVLDAGERSFM----VTAVSMGNPHCVVF-GADLDDA 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
               +G LL  HP F    N+    V S   + +R WERGVG T ACG+ ACA  VA   
Sbjct: 174 GFRKYGPLLEVHPAFPARTNVEFVEVLSPGEVAVRVWERGVGPTPACGTGACAVAVAGVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKL 279
             +T R V V++ GG LLIEW D+   V+M+G A++ ++GK 
Sbjct: 234 TGRTARRVHVRLPGGVLLIEWPDDAGPVYMSGPAEEVFDGKW 275


>gi|159795185|pdb|2Q9H|A Chain A, Crystal Structure Of The C73s Mutant Of Diaminopimelate
           Epimerase
          Length = 274

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV   GNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQSGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|325982879|ref|YP_004295281.1| diaminopimelate epimerase [Nitrosomonas sp. AL212]
 gi|325532398|gb|ADZ27119.1| diaminopimelate epimerase [Nitrosomonas sp. AL212]
          Length = 275

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 138/280 (49%), Gaps = 11/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +V+D      N+    I  L+        DQ++L+   +    D   
Sbjct: 3   LKFTKMQGLGNDFVVVDGINQTVNLDRQQIRHLADRHFGIGCDQLLLVEKAE-GQADFRY 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VR++      +      ET+ G++  +   +G+I+V+MG+
Sbjct: 62  RIFNADGGEVEQCGNGARCFVRYVHDHGLTQNSEIRIETLSGVISPRLENNGNITVNMGK 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI + + IP       +                    +SMGNPHA+  V  D+    +A+
Sbjct: 122 PIFEPERIPFIADQCALTYQLELPDSP-----VTICALSMGNPHAVRVV-TDIARAPVAT 175

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ +H  F   VN+   +V     + LR +ERG G T ACG+ ACA+VVA   L   
Sbjct: 176 EGALIEQHWRFPNKVNVGYLQVIDRNHIKLRVFERGAGETLACGTGACAAVVAGITLGLL 235

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +R V V   GG L I W      V+MTG A   +EG++++
Sbjct: 236 DRQVVVSTQGGELTISWQGYGEPVWMTGPAVTVFEGEINL 275


>gi|148827940|ref|YP_001292693.1| diaminopimelate epimerase [Haemophilus influenzae PittGG]
 gi|166224260|sp|A5UHQ4|DAPF_HAEIG RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|148719182|gb|ABR00310.1| diaminopimelate epimerase [Haemophilus influenzae PittGG]
          Length = 274

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLSGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|212710175|ref|ZP_03318303.1| hypothetical protein PROVALCAL_01229 [Providencia alcalifaciens DSM
           30120]
 gi|212687174|gb|EEB46702.1| hypothetical protein PROVALCAL_01229 [Providencia alcalifaciens DSM
           30120]
          Length = 278

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 85/280 (30%), Positives = 127/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAI-NALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I           FDQ++L+    D  +D   
Sbjct: 5   LQFSKMHGLGNDFMVVDGVTQNVYFSPELICRLADRHTGVGFDQLLLVEAPYDPDLDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +    N +  + V+MGE
Sbjct: 65  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKQKIKVSTQSGRMTLTINENDDVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +  +                 VVSMGNPH +  V+ ++   ++  
Sbjct: 125 PDFEPQNVPF-----RAVKAEKTYIIRAQERTVFAGVVSMGNPHCVVQVD-NVQTAEVEV 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+    V S + + LR +ERG G T ACGS ACA+V         
Sbjct: 179 LGPALESHERFPERANIGFMEVVSADYIRLRVYERGAGETQACGSGACAAVAVGVGQGLL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L I W      ++MTG A   ++G + I
Sbjct: 239 ANRVRVDLPGGSLDISWDGPGSPLYMTGPATHVYDGVIQI 278


>gi|257465051|ref|ZP_05629422.1| diaminopimelate epimerase [Actinobacillus minor 202]
 gi|257450711|gb|EEV24754.1| diaminopimelate epimerase [Actinobacillus minor 202]
          Length = 274

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDGVTQNVFLTQEIIQKLADRHRGIGFDQLLLVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +G + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLSLKENGQVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQIPFTA-----NKFEKNYILRTSLQTVLCGVVSMGNPHCVLQVE-DIKTAPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVINRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L+IEW    H ++MTG+A   ++G + +
Sbjct: 235 DSKVQVDLPGGSLMIEWEGVGHPLYMTGDATHIYDGFVTL 274


>gi|224139194|ref|XP_002323003.1| predicted protein [Populus trichocarpa]
 gi|222867633|gb|EEF04764.1| predicted protein [Populus trichocarpa]
          Length = 281

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 139/283 (49%), Gaps = 9/283 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           + F K  G+GN  +++D R   +  IT +    L         D ++          D  
Sbjct: 1   LHFVKYHGLGNDFILVDNRDSSEPKITPEQAAKLCDRNFGIGADGVIFALPG-INGTDYT 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC  RF+        K+ SF+  T  G++V +   DG + VD
Sbjct: 60  MRIFNSDGSEPEMCGNGVRCFARFIAEIENLHGKKLSFSVHTGAGLIVPEIQEDGKVKVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MGEP+L    +P   + +K D        V      N   VSMGNPH + F +  +   +
Sbjct: 120 MGEPVLKAADVPTKLAANKNDA-VVKSELVVDGVTWNVTCVSMGNPHCVTFGDLQVDSLN 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           LA  G     H +F    N    +V S   L +R WERG G T ACG+ ACA+VVA+   
Sbjct: 179 LAQIGPKFEHHEVFPARTNTEFVQVCSPSHLKMRVWERGAGATLACGTGACATVVAAVLE 238

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
               R  +V + GG L IEW  ++NHV+MTG A+  ++G + +
Sbjct: 239 GNAGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 281


>gi|30249581|ref|NP_841651.1| diaminopimelate epimerase [Nitrosomonas europaea ATCC 19718]
 gi|81584626|sp|Q82U84|DAPF_NITEU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|30138944|emb|CAD85523.1| Diaminopimelate epimerase [Nitrosomonas europaea ATCC 19718]
          Length = 275

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 130/280 (46%), Gaps = 11/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAIN-ALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      ++    I           FDQ++++    ++  D   
Sbjct: 3   LKFTKMHGLGNDFIVIDAINQSVSLDPATIRRWADRHFGIGFDQLLVVEKPGESG-DFRY 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+      +  T   ET  GI++     +G +SVDMG 
Sbjct: 62  RIFNADGGEVEQCGNGARCFARFVRDHDLTRKNTIRVETACGIIMPTVEENGEVSVDMGI 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D   IP                   +        VSMGNPHA+  V  D+    + S
Sbjct: 122 PRFDPARIPF-----ITQERALTYPLNVNDREIEISAVSMGNPHAVQIV-PDIDLAPVTS 175

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F E VN    ++     + LR +ERG G T ACG+ ACA+VV+       
Sbjct: 176 EGPAIESHPFFPEKVNAGYMQIVDRTHIRLRVFERGTGETLACGTGACAAVVSGISRGLL 235

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +  V V M GG L I W  ++  V+MTG A   +EG +D+
Sbjct: 236 DSEVQVTMRGGNLRIRWEGEDQPVWMTGPAVSVFEGTIDL 275


>gi|46143537|ref|ZP_00135025.2| COG0253: Diaminopimelate epimerase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208995|ref|YP_001054220.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae L20]
 gi|307246450|ref|ZP_07528523.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307255433|ref|ZP_07537240.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307259885|ref|ZP_07541599.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|166224236|sp|A3N2H9|DAPF_ACTP2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|126097787|gb|ABN74615.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|306852654|gb|EFM84886.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306861617|gb|EFM93604.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306866055|gb|EFM97929.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 274

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLTPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 235 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 274


>gi|301169469|emb|CBW29069.1| diaminopimelate epimerase [Haemophilus influenzae 10810]
          Length = 274

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +   +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKNDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V +LGG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLLGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|156935866|ref|YP_001439782.1| diaminopimelate epimerase [Cronobacter sakazakii ATCC BAA-894]
 gi|166224257|sp|A7MQK2|DAPF_ENTS8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|156534120|gb|ABU78946.1| hypothetical protein ESA_03749 [Cronobacter sakazakii ATCC BAA-894]
          Length = 274

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPDMIRRLADRHQGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V   N D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKREIRVSTANGRMVLTVNEDEQVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ +  L+P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PVFEPSLVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVATAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E  N+   +V + E + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLMESHERFPERANIGFMQVMNTEHIRLRVFERGAGETQACGSGACGAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W    N +FMTG A   ++G + +
Sbjct: 235 AAQVRVDLPGGRLDIAWKGPGNPLFMTGPATHVYDGFIHL 274


>gi|126657883|ref|ZP_01729036.1| diaminopimelate epimerase [Cyanothece sp. CCY0110]
 gi|126620823|gb|EAZ91539.1| diaminopimelate epimerase [Cyanothece sp. CCY0110]
          Length = 286

 Score =  235 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 146/283 (51%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K +G+GN  +++D R     +  + +AI           D ++      D + D  
Sbjct: 1   MEFTKYQGLGNDFILVDNRHNAIPLLSSKEAIKLCDRHFGIGADGVIFALPG-DENTDYT 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF----LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE Q CGNG+RC+ RF           KS+  +T+ GI++ +   DG + VD
Sbjct: 60  MRIFNSDGSEPQMCGNGIRCLARFLAKLEGIETVGKSYRIQTLAGIMIPRLEEDGQVKVD 119

Query: 120 MGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P L  K IP  L +  +K+      +G  +     +   VSMGNPH I FV+ ++  
Sbjct: 120 MGNPFLLAKEIPTTLTKGEEKVVNQFLEVGGQS----WSVTCVSMGNPHCITFVD-NVAT 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L + G +   H +F E  N     V   + L +R WERG G+T ACG+ ACASVVA  
Sbjct: 175 IPLETIGPMFEHHAVFPERTNTEFIEVVRSDYLKMRVWERGAGITLACGTGACASVVAGV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
                +R  +V++ GG L IEW + +N ++MTG A+  + G +
Sbjct: 235 LTGNCDRLCTVELPGGCLTIEWSEQDNRLYMTGPAEAVFTGVM 277


>gi|229844619|ref|ZP_04464758.1| diaminopimelate epimerase [Haemophilus influenzae 6P18H1]
 gi|229812333|gb|EEP48023.1| diaminopimelate epimerase [Haemophilus influenzae 6P18H1]
          Length = 274

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS A A+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGAGAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|261210167|ref|ZP_05924464.1| diaminopimelate epimerase [Vibrio sp. RC341]
 gi|260840707|gb|EEX67256.1| diaminopimelate epimerase [Vibrio sp. RC341]
          Length = 276

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 92/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  VE D+    + + 
Sbjct: 124 EFEPSKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVE-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEISWQGPGKPLYMTGPATHIYDGQI 274


>gi|254428919|ref|ZP_05042626.1| diaminopimelate epimerase [Alcanivorax sp. DG881]
 gi|196195088|gb|EDX90047.1| diaminopimelate epimerase [Alcanivorax sp. DG881]
          Length = 282

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 132/284 (46%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-----ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           + F KM G+GN  +VID            + +D I  L        FDQ++++   + A 
Sbjct: 3   LRFTKMHGLGNDFMVIDGIRQTLPETGLPLPADEIRRLGDRNFGVGFDQMLIVQPSRSAD 62

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
            D   RI+N DGSEV  CGNG RC  RF+  +    ++    ET  G +      D  ++
Sbjct: 63  ADFRYRILNADGSEVSQCGNGARCFARFVREQGLTDKREIQVETAAGQMTLTVTDDEQVT 122

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P      IP+    +           V+         V +GNPH    VE ++ +
Sbjct: 123 VDMGAPRWAPDAIPMTAKAEAD-----SYFLVSGTQAWEVGAVGLGNPHCTLLVE-NVDN 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             + S G LL  H  F E VN+   ++ S   + LR +ERG G T ACGS ACA+VV   
Sbjct: 177 APVESVGPLLESHEQFPERVNVGFMQIVSRNEIRLRVYERGAGETLACGSGACAAVVIGQ 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
                + AV+V + GG L + +     + MTG A   ++G ++I
Sbjct: 237 RRGWLDAAVTVHLPGGTLQVCYDGQGGIQMTGPASHVYDGAIEI 280


>gi|146313615|ref|YP_001178689.1| diaminopimelate epimerase [Enterobacter sp. 638]
 gi|167012036|sp|A4WG08|DAPF_ENT38 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|145320491|gb|ABP62638.1| diaminopimelate epimerase [Enterobacter sp. 638]
          Length = 274

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 130/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHVGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDICVSTANGRMILSVTDDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      +  +                 VVSMGNPH +  V+ D+    +  
Sbjct: 121 PNFEPSAVPF-----RAIKAEKTYIMRASEQTVLCGVVSMGNPHCVIQVD-DVDTAAVEI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G ++  H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPIMESHERFPERANIGFMQVMKREHIRLRVYERGAGETRACGSGACAAVAVGISQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H +FMTG A   ++G + +
Sbjct: 235 AEEVRVELPGGRLDIAWKGPGHPLFMTGPAAHVYDGFIHL 274


>gi|268634733|gb|ACZ16581.1| diaminopimelate epimerase [uncultured bacterium]
          Length = 276

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 90/282 (31%), Positives = 137/282 (48%), Gaps = 11/282 (3%)

Query: 5   MV-DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           M+  F KM+GIGN  +V+D       +    I+ L+       FDQ+++I   Q    D 
Sbjct: 1   MIVPFTKMQGIGNDFMVVDAISQPVYLNQGQISQLAHRNFGIGFDQLLMIEAPQHPEADF 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSE   CGNG R V +++  +    ++     T    +      +G I+++M
Sbjct: 61  HFRIFNADGSEAGHCGNGARAVAKYVRQKGLTWKRELRLSTNTATMNTVMEDNGLITINM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P L+ + IPL        +   ++     +  +    VSMGNPH +  VE D+    +
Sbjct: 121 GKPRLEPEKIPL----RFAQQSETYMIDAEGIRYKIG-AVSMGNPHCVLQVE-DIDKAAV 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G +L+ H  F    N+   +V     + LR +ERGVG T ACG+ ACA+VVA     
Sbjct: 175 GKVGPILSHHSYFPAQANVGFMQVVDSNEIKLRVFERGVGETLACGTGACAAVVAGRLQK 234

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             +  V V + GG L I W      V+MTG AK  +EG++D+
Sbjct: 235 ILDEKVKVTLPGGSLWIRWAGKGSPVYMTGPAKVVFEGQIDV 276


>gi|83309314|ref|YP_419578.1| diaminopimelate epimerase [Magnetospirillum magneticum AMB-1]
 gi|82944155|dbj|BAE49019.1| Diaminopimelate epimerase [Magnetospirillum magneticum AMB-1]
          Length = 301

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 150/286 (52%), Gaps = 13/286 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M      F KM G+GN  +V+D R    ++T + + A+++       DQ++++    D  
Sbjct: 18  MSDRAWPFLKMHGLGNDFVVLDARARALDLTPERVRAIASRGTGVGCDQLVVMTQATDPC 77

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
            DA + I N DGSEV +CGN  RCV   L   +      F+T  G+L A+      ++VD
Sbjct: 78  ADATMLIYNADGSEVAACGNASRCVAWLLMKEIAADKVVFQTKAGLLDAESRGPHQVAVD 137

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG   LDW+ IPLA + D +         ++   L +P  VSMGNPHA+FFV+ D    +
Sbjct: 138 MGPARLDWREIPLAEAVDTL------HLGISAGPLADPVGVSMGNPHAVFFVD-DAEAVN 190

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSL-----ESLDLRTWERGVGLTAACGSAACASVV 234
           LA  G  L  H +F E  N+ +A+V +        + +R WERG G+T ACG+ ACA++V
Sbjct: 191 LAQLGRGLEHHALFPERANIEVAQVLTPPDAEMGRIRMRVWERGAGITMACGTGACATLV 250

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           A+     + R   + + GG L IEW  + HV MTG     + G LD
Sbjct: 251 AAARRGLSPRKAEIILDGGTLTIEWLKDGHVLMTGPVAVAFTGTLD 296


>gi|330892011|gb|EGH24672.1| diaminopimelate epimerase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 276

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 138/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H + +   A           FDQ++L+    +  VD  
Sbjct: 2   LLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDPHTGIGFDQLLLVEAPNNPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +K    ET  GI+      DG ISVDMG
Sbjct: 62  YRIFNSDGSEVEQCGNGARCFARFVLDKRLTAKKQIRVETKSGIIELDIRSDGQISVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    + IP   + ++  R    +   N         VSMGNPHA+  V+ D+ +  + 
Sbjct: 122 PPRFVPEEIPF-EAAEQATRYNVEVDGQNIEL----AAVSMGNPHAVLRVD-DINNAPVH 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  HP F   VN+    V   +   LR WERG G T ACG+ ACA  VA+     
Sbjct: 176 ELGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWERGAGETQACGTGACAGAVAAISQGW 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +  + + + GG L IEW    H V MTG A + +EG++ +
Sbjct: 236 MDSPLLIDLPGGRLSIEWAGPGHSVMMTGPAVRVYEGQVRL 276


>gi|261364272|ref|ZP_05977155.1| diaminopimelate epimerase [Neisseria mucosa ATCC 25996]
 gi|288567517|gb|EFC89077.1| diaminopimelate epimerase [Neisseria mucosa ATCC 25996]
          Length = 283

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 96/284 (33%), Positives = 141/284 (49%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDDNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +V++      + +T+             FDQ++L+      +
Sbjct: 1   MKT--LKFTKMHGLGNDFMVVNGIAQDFDPLTAPLAEWSDRFRGVGFDQLLLVEKPSSDA 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV+ CGNG RC  RF+  +    +K    ET +G+++ K   +G ++
Sbjct: 59  VDFRYRIFNADGSEVEQCGNGARCFARFVADKGLTDKKEILVETAKGVIIPKLLDNGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP          D      +  L       V+MGNPHA+  VE D+  
Sbjct: 119 VNMGKPRFTSSEIPFV-PVPDEVEDALTHMVMVGLETVQVSCVNMGNPHAVIVVE-DVQT 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +A +G  +  H  F E VN+   ++   ES+ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVAHWGEAIESHEQFPERVNVGFMQIVDRESIRLRVFERGVGETQACGTGACAAVVAGV 236

Query: 238 CLHKTNR--AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L        V V + GG L I W     V MTG  +  +EG+L
Sbjct: 237 RLGLLAEGVPVKVSLPGGDLFITWSHGEDVLMTGPVQTVFEGEL 280


>gi|307248575|ref|ZP_07530590.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306854925|gb|EFM87113.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
          Length = 279

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 6   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 66  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 125

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P   +     +   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 126 PIWEPAQVPFTAN-----KFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLAPVNE 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 180 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 240 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 279


>gi|212633302|ref|YP_002309827.1| diaminopimelate epimerase [Shewanella piezotolerans WP3]
 gi|212554786|gb|ACJ27240.1| Diaminopimelate epimerase [Shewanella piezotolerans WP3]
          Length = 269

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 89/273 (32%), Positives = 139/273 (50%), Gaps = 10/273 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D    +   + D I  L+       FDQ++L+    D  +D   RI N 
Sbjct: 1   MHGLGNDFMVVDGVTQNVFFSPDQIKRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDG ++V+MG P+L+ 
Sbjct: 61  DGSEVEQCGNGARCFARFVRNKGLTQKHKIRVSTSSGKITLRLERDGKVTVNMGVPMLEP 120

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             IP         +       +          VSMGNPH +  V+ D+ + D+ + G+ L
Sbjct: 121 SKIPFNAK-----KVEKTYLLMASTGTYLCGAVSMGNPHCVIDVD-DVANTDVDTIGSEL 174

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
            +H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+VV      K  R V 
Sbjct: 175 TQHERFPKGVNVGFMQVVNPGYIKLRVYERGAAETLACGTGACAAVVVGILQGKLERNVR 234

Query: 248 VKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           V + GG L+I W      ++MTG A+  ++G++
Sbjct: 235 VDLPGGTLMINWDGEGKPLWMTGPAEHVYDGQI 267


>gi|307253187|ref|ZP_07535063.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306859331|gb|EFM91368.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 279

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 6   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 66  RIFNADGSEVAQCGNGARCFARFVTLKSLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 125

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 126 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLTPVNE 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 180 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 240 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 279


>gi|255671799|gb|ACU26532.1| diaminopimelate epimerase [Glycine max]
          Length = 359

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 95/291 (32%), Positives = 139/291 (47%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNIT--SDAINALSTDDNTHFDQIMLIHDFQDAS 59
           +S  + FAK  G+GN  ++ID R   +       A+     +     D ++ +     + 
Sbjct: 71  ESGFLHFAKYHGLGNDFVLIDNRDSSEPKISAEKAVQLCDRNFGVGADGVIFVLPG-ISG 129

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  +F+    +   R SFT  T  G+++ +   DG++
Sbjct: 130 TDYTMRIFNSDGSEPEMCGNGVRCFAKFVSQLENLHGRHSFTIHTGAGLIIPEVLEDGNV 189

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-----V 171
            VDMGEPIL    +P     +  D        V    + +   VSMGNPH + F      
Sbjct: 190 RVDMGEPILKXXDVPTKLHAN-KDNAVVKSELVVDGVIWHVTCVSMGNPHCVTFSREGSQ 248

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    LA  G     H +F    N    +V S   L +  WERG G T ACG+ ACA
Sbjct: 249 NLLVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSNSHLKMCVWERGAGATLACGTGACA 308

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +VVA+    +  R  +V + GG L IEW  ++NHV+MTG A   + G L +
Sbjct: 309 TVVAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGSADVVYYGSLPL 359


>gi|229527132|ref|ZP_04416526.1| diaminopimelate epimerase [Vibrio cholerae 12129(1)]
 gi|229335363|gb|EEO00846.1| diaminopimelate epimerase [Vibrio cholerae 12129(1)]
 gi|327483027|gb|AEA77434.1| Diaminopimelate epimerase [Vibrio cholerae LMA3894-4]
          Length = 276

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPNKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS ACA+V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACAAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVCVHLPGGELEIHWQGPGKPLYMTGPATHIYDGQI 274


>gi|170734435|ref|YP_001766382.1| diaminopimelate epimerase [Burkholderia cenocepacia MC0-3]
 gi|169817677|gb|ACA92260.1| Diaminopimelate epimerase [Burkholderia cenocepacia MC0-3]
          Length = 309

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 90/288 (31%), Positives = 137/288 (47%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFK 82

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    R+S   + ++G++      +G + VDMG
Sbjct: 83  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDRRSVRVQVMKGLITLTLQDNGEVVVDMG 142

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   S    + + +            R    VSMGNPHA+  V+ D+  Y 
Sbjct: 143 APVFAPAQVPFEPSGLDGRQEGNDTLWPLDVGGATRWISTVSMGNPHAVQVVD-DVEAYP 201

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 202 VLEEGPLIERHARFPQRVNAGFMQIVSRREVKLRVYERGAGETLACGTGACAAVAAGIRR 261

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 262 GLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPATTVFEGEIDLNA 309


>gi|304413631|ref|ZP_07395075.1| diaminopimelate epimerase [Candidatus Regiella insecticola LSR1]
 gi|304283722|gb|EFL92116.1| diaminopimelate epimerase [Candidatus Regiella insecticola LSR1]
          Length = 278

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 5   MQFSKMHGLGNDFMVVDNVTQNVYFSPELIRRLANRHTGVGFDQMLVVEPPYDPKLDFHY 64

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RFL  +    +K     T  G +  +   D  + V+MGE
Sbjct: 65  RIFNADGSEVFQCGNGARCFARFLHLKGLTSKKIIHISTQTGRMSLEITGDEKVCVNMGE 124

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+   + IP                           VVS+GNPH +  VE D+   ++A 
Sbjct: 125 PVFTPRQIPF-----CATTTEKTYILRTAGHTTLCGVVSIGNPHCVLQVE-DVATANVAL 178

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F +  N+   ++   ++++LR  ERGVG T ACGS ACA+V         
Sbjct: 179 LGPMLEYHERFPQRTNVGFMQIIDRKNINLRVHERGVGETQACGSGACAAVAIGIEQQLL 238

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           ++ V VK+ GG L I+W    H ++MTG A   ++G + +
Sbjct: 239 DKNVDVKLPGGKLSIQWKGKGHPLYMTGSAVHIYDGYIHL 278


>gi|225075130|ref|ZP_03718329.1| hypothetical protein NEIFLAOT_00129 [Neisseria flavescens
           NRL30031/H210]
 gi|224953614|gb|EEG34823.1| hypothetical protein NEIFLAOT_00129 [Neisseria flavescens
           NRL30031/H210]
          Length = 283

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 139/284 (48%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +V++      +  +  +   +       FDQ +++      +
Sbjct: 1   MKT--LKFTKMHGLGNDFMVVNAINQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDA 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++
Sbjct: 59  VDFRYRIFNADGREVEQCGNGARCFARFVADKGLTDKTEILVETAKGIIVPKLLDNGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP        + D      +  L       V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPRFMPSEIPFV-PAHGENEDALTHIVLVGLESVPVSCVNMGNPHAVILVD-DVET 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +  +G ++  H  F E VN+   +V    S+ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVEHWGGVIESHEQFPERVNVGFLQVEDELSVRLRVFERGVGETQACGTGACAAVVAGV 236

Query: 238 CLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                     V V + GG L I W +   V MTG A+  +EG+L
Sbjct: 237 RNGLLKAGAPVRVTLPGGELFISWEEGGDVQMTGPAETVFEGEL 280


>gi|262404863|ref|ZP_06081417.1| diaminopimelate epimerase [Vibrio sp. RC586]
 gi|262348947|gb|EEY98086.1| diaminopimelate epimerase [Vibrio sp. RC586]
          Length = 276

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPSKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEISWKGPGKPLYMTGPATHIYDGQI 274


>gi|260596033|ref|YP_003208604.1| diaminopimelate epimerase [Cronobacter turicensis z3032]
 gi|260215210|emb|CBA27065.1| Diaminopimelate epimerase [Cronobacter turicensis z3032]
          Length = 274

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVFFSPEMIRRLADRHQGVGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V   N D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLTNKREIRVSTANGRMVLTVNEDELVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ +  L+P      + ++                 VVSMGNPH +  V+ D+    + +
Sbjct: 121 PVFEPSLVPF-----RANKAEKTYIMRAAEQTVLCGVVSMGNPHCVIQVD-DVATAPVET 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F E  N+   ++ + E + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLMESHERFPERANIGFMQIMNTEHIRLRVFERGAGETQACGSGACGAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              V V + GG L I W    N +FMTG A   ++G + +
Sbjct: 235 AAQVRVDLPGGRLDIAWKGPGNPLFMTGPATHVYDGFIHL 274


>gi|119510990|ref|ZP_01630111.1| diaminopimelate epimerase [Nodularia spumigena CCY9414]
 gi|119464335|gb|EAW45251.1| diaminopimelate epimerase [Nodularia spumigena CCY9414]
          Length = 279

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 135/281 (48%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  +++D R     +     AI           D ++     ++   D  
Sbjct: 3   IEFTKYHGLGNDFILVDNRASSLPVLTPEQAIQLCDRHFGIGADGVIFALPGEN-GADYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM----KRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ RF+         + S+   T+ G++  +   DG + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLGRFIADLEGESRNKDSYRIHTLAGMITPQLMADGQVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP        +    +              VSMGNPH I FV  D+    
Sbjct: 122 MGLPRLLAGEIPTTLG--TAETKVINQPLEVAGQTWEVTCVSMGNPHCITFVS-DVAAIP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G     HP F + +N    +V S + + +R WERG G+T ACG+ ACAS+VA    
Sbjct: 179 LEIIGPQFEHHPAFPQRINTEFIQVVSRDYVKMRVWERGAGITLACGTGACASLVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
              +R  +V++ GG L IEW + +  ++MTG A+K + G+L
Sbjct: 239 GNCDRIATVELPGGPLQIEWSEIDQRIYMTGPAQKVFTGQL 279


>gi|23015511|ref|ZP_00055285.1| COG0253: Diaminopimelate epimerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 284

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 101/286 (35%), Positives = 148/286 (51%), Gaps = 13/286 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M      F KM G+GN  +V+D R    ++T + + A+++       DQ++++    D+ 
Sbjct: 1   MSERAWPFLKMHGLGNDFVVLDARAHAIDLTPERVRAIASRGTGVGCDQLVVMTQATDSC 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
            DA + I N DGSEV +CGN  RCV   L   +      F+T  G+L A+      ++VD
Sbjct: 61  ADAQMLIYNADGSEVAACGNASRCVAWLLMKEIAADKVVFQTKAGLLDAESRGPHQVAVD 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG   LDW+ IPLA + D +         +    L +P  VSMGNPHA+FFV+ D     
Sbjct: 121 MGPARLDWREIPLAEAMDTL------HLGITAGPLSDPVGVSMGNPHAVFFVD-DAEAVP 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVT-----SLESLDLRTWERGVGLTAACGSAACASVV 234
           LA  G  L  H +F E  N+ +A+V       +  + +R WER  G+T ACG+ ACA++V
Sbjct: 174 LAQLGRGLEHHALFPERANIEVAQVLSPPDADMGRIRMRVWERSAGITMACGTGACATLV 233

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           A+     + R   + + GG L IEW  + HV MTG     + G LD
Sbjct: 234 AAARRGLSPRKAEIILDGGSLTIEWLKDGHVLMTGPVAVAFTGVLD 279


>gi|224087786|ref|XP_002308231.1| predicted protein [Populus trichocarpa]
 gi|222854207|gb|EEE91754.1| predicted protein [Populus trichocarpa]
          Length = 314

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 98/291 (33%), Positives = 141/291 (48%), Gaps = 14/291 (4%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           S  + F K  G+GN  +V+D R   +       A+     +     D ++      +   
Sbjct: 26  SRFLHFVKYHGLGNDFIVLDNRDSSEPKIRPEQAVKLCDRNFGIGADGVIFALPGVN-GT 84

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFL----TSRMKRKSFTFETIRGILVAKENRDGSI 116
           D  +RI N DGSE + CGNG+RC  RF+        KR+SFT  T  G++V +   DG +
Sbjct: 85  DYTMRIFNSDGSEPEMCGNGVRCFARFIAELENFHGKRQSFTVHTGAGLIVPEIQEDGQV 144

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-----V 171
            VDMGEP+L    +P   + +K D        V      N   VSMGNPH + F      
Sbjct: 145 KVDMGEPVLKAANVPTKLASNKNDA-VVKSELVVDGVTWNVTCVSMGNPHCVTFGTKGGE 203

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
           +  +   +LA  G     H +F    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 204 DLQVDALNLAQIGPKFEHHDVFPARTNTEFVQVYSPSHLKMRVWERGAGATLACGTGACA 263

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +VVA+    +  R  +V + GG L IEW  ++NHV+MTG A+  + G + +
Sbjct: 264 TVVAAVLEGRAGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEVVFYGSVRL 314


>gi|121595979|ref|YP_987875.1| diaminopimelate epimerase [Acidovorax sp. JS42]
 gi|120608059|gb|ABM43799.1| diaminopimelate epimerase [Acidovorax sp. JS42]
          Length = 315

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 138/288 (47%), Gaps = 12/288 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+++     A +D   
Sbjct: 26  IRFTKMQGAGNDFVVLDETQGRLGLTPAQYRFLADRHFGVGADQILIVRPSPGAGIDFEY 85

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG +V+ CGNG RC  R++  +    + +   +T+ G++      DG ++VDMG 
Sbjct: 86  VIHNADGGQVEQCGNGARCFARYVRDKGLTAQDTIRVQTMAGVIAPHLTADGRVTVDMGR 145

Query: 123 PILDWKLIPLAR------SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P L+   +P         S     +    +            VVSMGNPHA+  V+ D+ 
Sbjct: 146 PELEPARVPFDTTGLAPVSQGSGQKWPLALDGQASAATILIAVVSMGNPHAVQLVD-DVD 204

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F + VN    ++ +   + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 205 TAPVAQTGPLIESHPRFPQRVNAGYLQIVNRGEVRLRVYERGAGETLACGTGACAAVVAG 264

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
             L   +  V V   GG L I+W     + VFMTG A   +EG++DI 
Sbjct: 265 IRLGLLDARVQVHTRGGLLTIDWAGGLQDPVFMTGPATTVFEGEIDIP 312


>gi|329117998|ref|ZP_08246711.1| diaminopimelate epimerase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465886|gb|EGF12158.1| diaminopimelate epimerase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 287

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 135/281 (48%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDA 62
           +++ F KM G+GN   VID      +  +  I A         FDQ++L+        D 
Sbjct: 2   AVLKFTKMHGLGNDFAVIDGISQPFDPAAAPIAAWADRHTGIGFDQLLLVEQPVSPEADF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DG EV+ CGNG RC  RF+  +    ++    ET RGI+V K    G ++VDM
Sbjct: 62  RYRIFNADGGEVEQCGNGARCFARFVADKGLTDKREIVVETARGIIVPKLEEGGLVTVDM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P L    IP     +    D        +    +  +V+MGNPHA+  V+ D     +
Sbjct: 122 GKPRLRPSEIPF-LPAEGAAEDALRHDIAANGAAVSVGLVNMGNPHAVLTVD-DTDAAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A+ G  L  HP F E  N+   +V     + LR +ERGVG T ACG+ ACA+VV    L 
Sbjct: 180 ATLGAALETHPQFPEKANIGFMQVLDPHRIRLRVFERGVGETQACGTGACAAVVHGVRLG 239

Query: 241 KT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                  V V + GG L I W +   V MTG A+  ++G +
Sbjct: 240 LLAAGEPVEVSLPGGRLRISWREGGSVMMTGPAQTVFDGVI 280


>gi|255584553|ref|XP_002533003.1| Diaminopimelate epimerase, putative [Ricinus communis]
 gi|223527214|gb|EEF29378.1| Diaminopimelate epimerase, putative [Ricinus communis]
          Length = 369

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 142/291 (48%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           +S +  F K +G+GN  +++D R   +  IT +    L         D ++      +  
Sbjct: 81  ESGIHHFVKYQGLGNDFILVDNRDSTEPRITPEQAVRLCDRNFGIGADGVIFAMPGTN-G 139

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +   ++SFT  T  G++V +   DG +
Sbjct: 140 TDYSMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKQSFTIHTGAGLIVPEIQEDGKV 199

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMGEPIL    +P  R  +                  N   VSMGNPH + F  ++  
Sbjct: 200 KVDMGEPILKASDVP-TRLRENKGDAVVKAKLNIDGVTWNVTCVSMGNPHCVTFGSNENQ 258

Query: 175 ---LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +   +LA  G     H +F    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 259 DLQVDKLNLAEIGPKFEHHDVFPARTNTEFVQVHSHSHLKMRVWERGAGATLACGTGACA 318

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +VVA+    +  R  +V + GG L IEW  ++NHV+MTG A+  + G + +
Sbjct: 319 TVVAAVLEGRAGRNCTVDLPGGPLEIEWKEEDNHVYMTGPAEAVFYGAVAL 369


>gi|307262015|ref|ZP_07543670.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306868298|gb|EFN00120.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 279

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 6   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 66  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 125

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P   +     +   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 126 PIWEPAQVPFTAN-----KFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLTPVNE 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 180 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 240 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 279


>gi|119503713|ref|ZP_01625795.1| Diaminopimelate epimerase [marine gamma proteobacterium HTCC2080]
 gi|119460221|gb|EAW41314.1| Diaminopimelate epimerase [marine gamma proteobacterium HTCC2080]
          Length = 279

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           V F KM G GN  +VID    + ++++  I  L+        DQ++++        D   
Sbjct: 3   VRFTKMHGAGNDFVVIDNVRQNLDLSASQIRRLANRQRGIGCDQVLIVGPPDSPDADFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DGSE   CGNG RC  RF+  +    +     +   G++      DG I  +MG 
Sbjct: 63  HIFNADGSEAGQCGNGARCFARFVREQRLSLKPKLRVQAPNGLMQLDTANDGRILAEMGI 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI     +P        D+++               V+SMGNPHA+  VE ++    +AS
Sbjct: 123 PIFTPSAVPF-----DTDKEQLEYTLTVSDTSLAMGVLSMGNPHAVIIVE-NVQTAPVAS 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F++ VN+   ++ S + + LR +ERG G T ACG+ ACA+VV     +  
Sbjct: 177 LGETIEGHPKFTDRVNVGFMQILSRDEIKLRVFERGAGETLACGTGACAAVVHGIRKNLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N AV+V + GG L I W  N    +++G     +EG +++
Sbjct: 237 NNAVTVHLPGGKLSITWEGNGTAAWLSGPTASVFEGTINL 276


>gi|258625071|ref|ZP_05719990.1| diaminopimelate epimerase [Vibrio mimicus VM603]
 gi|258582622|gb|EEW07452.1| diaminopimelate epimerase [Vibrio mimicus VM603]
          Length = 276

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCVTQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTINVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I       L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPSKIPF----RAKQSEKTYILRAGEQTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S E ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSREEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G++
Sbjct: 238 EQVRVHLPGGELEISWKGPGKPLYMTGPATHAYDGQI 274


>gi|218247127|ref|YP_002372498.1| diaminopimelate epimerase [Cyanothece sp. PCC 8801]
 gi|226724207|sp|B7K1E7|DAPF_CYAP8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218167605|gb|ACK66342.1| Diaminopimelate epimerase [Cyanothece sp. PCC 8801]
          Length = 281

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 94/283 (33%), Positives = 142/283 (50%), Gaps = 11/283 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F+K +G+GN  ++ID R  H  +     AI           D ++ +     A+ D  
Sbjct: 3   IEFSKYQGLGNDFILIDNRSSHTPLVSPEQAIKMCDRHFGIGADGVIFVLPGT-ANTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE Q CGNG+RC+ RF+          K++  +T+ G++  +    G + VD
Sbjct: 62  MRIFNSDGSEPQMCGNGIRCLARFIAHLEGGETLGKTYQIDTLAGVISPRLEAQGQVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L  K IP        +    +              VSMGNPH I FV+ D++  D
Sbjct: 122 MGTPYLLAKEIPTTLG--NSNDKVINHSLEVAGQTWLVTCVSMGNPHCITFVK-DVWGID 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L + G     HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA    
Sbjct: 179 LPTLGPQFEHHPGFPERTNTEFIEVVRRDYVKMRVWERGAGITLACGTGACASVVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           ++ +R   V++ GG L IEW + +N ++MTG A+  + G  ++
Sbjct: 239 NQCDRYCIVELPGGNLTIEWSEMDNRIYMTGPAELVFTGIYNL 281


>gi|261379692|ref|ZP_05984265.1| diaminopimelate epimerase [Neisseria subflava NJ9703]
 gi|284797356|gb|EFC52703.1| diaminopimelate epimerase [Neisseria subflava NJ9703]
          Length = 283

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 91/284 (32%), Positives = 138/284 (48%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +V++      +  +  +   +       FDQ +++      +
Sbjct: 1   MKT--LKFTKMHGLGNDFMVVNAINQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDA 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++
Sbjct: 59  VDFRYRIFNADGREVEQCGNGARCFARFVADKGLTDKTEILVETTKGIIVPKLLDNGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP        + D      +  L       V+MGNPHA+  V+ ++  
Sbjct: 119 VNMGKPRFMPSEIPFV-PAHGENEDALTHIVLVGLESVPVSCVNMGNPHAVILVD-NVET 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +  +G  +  H  F E VN+   +V    S+ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVEHWGGAIESHEQFPERVNVGFLQVEDELSVRLRVFERGVGETQACGTGACAAVVAGV 236

Query: 238 CLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                     V V + GG L I W +   V MTG A+  +EG+L
Sbjct: 237 RNGLLKAGAPVRVTLPGGELFISWEEGGDVQMTGPAETVFEGEL 280


>gi|328541782|ref|YP_004301891.1| diaminopimelate epimerase [polymorphum gilvum SL003B-26A1]
 gi|326411534|gb|ADZ68597.1| Diaminopimelate epimerase [Polymorphum gilvum SL003B-26A1]
          Length = 304

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/295 (41%), Positives = 167/295 (56%), Gaps = 5/295 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M S+   F KM G+GN  +V D R    +++ + I AL        FDQ++ +     A 
Sbjct: 1   MASARRPFLKMNGLGNDFVVWDARAEALSLSPETIAALGNRSTGIGFDQMITVECSP-AG 59

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKEN-RDGSISV 118
            DAF+RI NCDGS+V +CGN  RCV R L     R     ET  G+LVA+       ++V
Sbjct: 60  ADAFMRIHNCDGSQVSACGNATRCVGRLLMEESGRPDANIETRAGLLVARATGDPRVVTV 119

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L W  IPLA  F         IGP++   L  P VV+MGNPHAIF+V  D+  Y
Sbjct: 120 DMGVPRLRWDEIPLAEEFADTRAIELQIGPIDAPILHTPAVVNMGNPHAIFWVG-DVEAY 178

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL   G LL +HP+F EG N+S+A V + + + ++ WERG GLT ACG+AACA  VA+  
Sbjct: 179 DLGRIGPLLERHPIFPEGANISLAHVFAPDQIRVKVWERGAGLTRACGTAACAVAVAAAR 238

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
             +  R  +V + GG L IEW + + HV MTG  + E+EG++D+ T  W +    
Sbjct: 239 DGRAGRRSTVHLPGGPLTIEWREGDGHVLMTGATEVEFEGEIDLDTLAWERTGPG 293


>gi|222112167|ref|YP_002554431.1| diaminopimelate epimerase [Acidovorax ebreus TPSY]
 gi|254767102|sp|B9MFT0|DAPF_DIAST RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|221731611|gb|ACM34431.1| diaminopimelate epimerase [Acidovorax ebreus TPSY]
          Length = 292

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 137/288 (47%), Gaps = 12/288 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+ +     A +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGRLGLTPAQYRFLADRHFGVGADQILTVRPSPGAGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG +V+ CGNG RC  R++  +    + +   +T+ G++      DG ++VDMG 
Sbjct: 63  VIHNADGGQVEQCGNGARCFARYVRDKGLTAQDTIRVQTMAGVIAPHLTADGRVTVDMGR 122

Query: 123 PILDWKLIPLAR------SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P L+   +P         S     +    +            VVSMGNPHA+  V+ D+ 
Sbjct: 123 PELEPARVPFDTTGLAPVSQGSGQKWPLALDGQASEATLLVAVVSMGNPHAVQLVD-DVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F + VN    ++ +   + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 182 TAPVAQTGPLIESHPRFPQRVNAGYLQIVNRGEVRLRVYERGAGETLACGTGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
             L   +  V V   GG L I+W     + VFMTG A   +EG++DI 
Sbjct: 242 IRLGLLDARVQVHTRGGLLTIDWAGGLQDPVFMTGPATTVFEGEIDIP 289


>gi|257060198|ref|YP_003138086.1| diaminopimelate epimerase [Cyanothece sp. PCC 8802]
 gi|256590364|gb|ACV01251.1| diaminopimelate epimerase [Cyanothece sp. PCC 8802]
          Length = 281

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 11/283 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F+K +G+GN  ++ID R  H  +     AI           D ++ +     A+ D  
Sbjct: 3   IEFSKYQGLGNDFILIDNRSSHTPLVSPEQAIKMCDRHFGIGADGVIFVLPGT-ANTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE Q CGNG+RC+ RF+          K++  +T+ G++  +    G + VD
Sbjct: 62  MRIFNSDGSEPQMCGNGIRCLARFIAHLEGGETLGKTYQIDTLAGVISPRLEAQGQVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L  K IP        +    +              VSMGNPH I FV+ D++  D
Sbjct: 122 MGTPYLLAKEIPTTLG--NSNDKVINHSLEVAGQTWLVTCVSMGNPHCITFVK-DVWGID 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L + G     HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA    
Sbjct: 179 LPTLGPQFEHHPGFPERTNTEFIEVVRRDYVKMRVWERGAGITLACGTGACASVVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           ++ +R   V++ GG L IEW + NN ++MTG A+  + G  ++
Sbjct: 239 NQCDRYCIVELPGGNLTIEWSEMNNRIYMTGPAELVFTGIYNL 281


>gi|254226602|ref|ZP_04920183.1| diaminopimelate epimerase [Vibrio cholerae V51]
 gi|125620874|gb|EAZ49227.1| diaminopimelate epimerase [Vibrio cholerae V51]
          Length = 285

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 90/275 (32%), Positives = 132/275 (48%), Gaps = 10/275 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     +T    T +G +V     +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH +  V+ D+    + + 
Sbjct: 124 EFEPNKIPF----RAKQSEKTYILRVGEHTLFCG-AVSMGNPHVVTVVD-DIRTAAVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDEINLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEG 277
             V V + GG L I W      ++MTG A   ++G
Sbjct: 238 EQVRVHLPGGELEIHWQGPGKPLYMTGPATHIYDG 272


>gi|260774851|ref|ZP_05883753.1| diaminopimelate epimerase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609276|gb|EEX35431.1| diaminopimelate epimerase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 276

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     D  ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMILSIEEDDQVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I       L     VSMGNPH +  V+ D    D+ + 
Sbjct: 124 EFEPNKIPFKAK----QTEKTYILRAEEKTLFCG-AVSMGNPHVVTVVD-DTQTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S   ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVLSRNEVNLRVYERGAGETQACGSGACGAVAVGIVQELLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V+V + GG L I W      ++MTG A   ++G+L
Sbjct: 238 EKVTVNLPGGSLKISWQGPGKPLYMTGPATHVFDGQL 274


>gi|218767882|ref|YP_002342394.1| diaminopimelate epimerase [Neisseria meningitidis Z2491]
 gi|21362492|sp|Q9JV69|DAPF_NEIMA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|121051890|emb|CAM08196.1| putative diaminopimelate epimerase [Neisseria meningitidis Z2491]
 gi|319410129|emb|CBY90465.1| diaminopimelate epimerase (DAP epimerase) [Neisseria meningitidis
           WUE 2594]
          Length = 283

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPRFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAQV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|329847627|ref|ZP_08262655.1| diaminopimelate epimerase [Asticcacaulis biprosthecum C19]
 gi|328842690|gb|EGF92259.1| diaminopimelate epimerase [Asticcacaulis biprosthecum C19]
          Length = 270

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 108/274 (39%), Positives = 158/274 (57%), Gaps = 9/274 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D R        D I A S       FDQ++ I D +D   DAF+R+ N 
Sbjct: 1   MNGLGNDFIVVDARETAFQPAPDQIRAWSNRVSGIGFDQLIAIEDSRDG--DAFMRVWNA 58

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR----DGSISVDMGEPIL 125
           DG  V++CGN +RCV  +L      K+   +T+ G   A+  R     G+ S+DMG+P L
Sbjct: 59  DGGGVETCGNALRCVAWYLNRDASDKTLKIDTLGGATKARVLRADATTGTASIDMGKPGL 118

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW+ IPL+   +    +   +GP +      P  VSMGNPH +FFV+ D+   D+ + G+
Sbjct: 119 DWRDIPLSEEMNTAKLE-LKVGPYDAPLYHTPVAVSMGNPHCVFFVD-DIATVDVKATGS 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  HP+F E VN+  A++   +++ +R WERG G+T ACG+ ACA++VA+     T RA
Sbjct: 177 LIEHHPLFPESVNVEFAQILDKDTIRMRVWERGAGITQACGTGACATLVAAARRGLTGRA 236

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +V M GG L I W +N+HV MTG  + E+EG L
Sbjct: 237 ATVHMDGGPLHIVWAENDHVIMTGPVEVEFEGTL 270


>gi|255065307|ref|ZP_05317162.1| diaminopimelate epimerase [Neisseria sicca ATCC 29256]
 gi|255050728|gb|EET46192.1| diaminopimelate epimerase [Neisseria sicca ATCC 29256]
          Length = 283

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 145/284 (51%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDDNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +V++  G   + +T+             FDQ++L+      +
Sbjct: 1   MKT--LKFTKMHGLGNDFMVVNGIGQDFDPLTAPLAEWSDRFRGVGFDQLLLVEKPSSDA 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV+ CGNG RC  RF+  +    +K    ET +G+++ K   +G ++
Sbjct: 59  VDFRYRIFNADGSEVEQCGNGARCFARFVADKGLTDKKEILVETAKGVIIPKLLDNGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP     D+ D D      +  L       V+MGNPHA+  VE D+  
Sbjct: 119 VNMGKPRFTSSEIPFVPVPDEAD-DALTHMVMVGLETVQVSCVNMGNPHAVIVVE-DVQT 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +A +G  +  H  F E VN+   ++   ES+ LR +ERGVG T ACG+ ACA+VV+  
Sbjct: 177 APVAHWGEAIESHEQFPERVNVGFMQIVDRESIRLRVFERGVGETQACGTGACAAVVSGV 236

Query: 238 CLHKTNR--AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L        V V + GG L I W     V MTG  +  +EG+L
Sbjct: 237 RLGLLAEGVPVKVSLPGGDLFITWSHGEDVLMTGPVQTVFEGEL 280


>gi|145634839|ref|ZP_01790547.1| diaminopimelate epimerase [Haemophilus influenzae PittAA]
 gi|145268005|gb|EDK08001.1| diaminopimelate epimerase [Haemophilus influenzae PittAA]
          Length = 274

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 97/280 (34%), Positives = 141/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTA-----NKFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQIANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLENHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V +LGG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLLGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|237747588|ref|ZP_04578068.1| diaminopimelate epimerase [Oxalobacter formigenes OXCC13]
 gi|229378950|gb|EEO29041.1| diaminopimelate epimerase [Oxalobacter formigenes OXCC13]
          Length = 287

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 92/286 (32%), Positives = 134/286 (46%), Gaps = 11/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V++      N+T +    L+        DQI+L+    +  VD   
Sbjct: 3   LKFTKMHGAGNDFIVLNAIDQVINLTREQYRFLADRRYGIGADQILLVEKPDNPEVDFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG R   +F+T     ++     ET  GI+     +DGS++VDMG 
Sbjct: 63  RIFNSDGGEVEQCGNGARAFAKFVTESGLSRQNPIKVETRVGIIELHLEKDGSVTVDMGN 122

Query: 123 PILDWKLIPL------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P+ +   IP       +            +            VVSMGNPHA+  V+ D+ 
Sbjct: 123 PVFETSRIPFLTKGLTSDEIGSDTIWNLILDTGGIKKSIPISVVSMGNPHAVQIVD-DVN 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  H  F E VN     +    S+ LR +ERG   T ACG+ ACA+VV+ 
Sbjct: 182 RAAVAEEGPLIENHERFPERVNAGFMEIQDRHSIKLRVYERGAAETLACGTGACAAVVSG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                 +  V+VK  GG L I W    H V M+G A   + G++++
Sbjct: 242 IRRKLLDSPVTVKARGGELKIAWEGEGHNVIMSGPAIIVFNGEINL 287


>gi|254515503|ref|ZP_05127563.1| diaminopimelate epimerase [gamma proteobacterium NOR5-3]
 gi|219675225|gb|EED31591.1| diaminopimelate epimerase [gamma proteobacterium NOR5-3]
          Length = 276

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 126/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           V F KM G GN  ++ID       +    I  ++        DQ++L+      S D   
Sbjct: 3   VKFTKMHGAGNDFVMIDTISQRIKLKPRDIRKIADRRRGIGCDQVLLVEPPGQPSADFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSE   CGNG RC  RF         +    E    ++      +  + VDMG 
Sbjct: 63  RIFNADGSEAGQCGNGARCFARFVRHRRLTHLQKMVVEAGNSLMTLTIRDNHDVEVDMGP 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IPL R  + ++ D    G    +       VSMGNPHAI  V+  + +  L  
Sbjct: 123 PNFAPNDIPLRRDQEALEYDLVAAGEQLRIG-----AVSMGNPHAILRVDA-VDNGSLER 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  H  F EG N     +   +++ LR +ERGVG T ACGS ACA+VV    +   
Sbjct: 177 LGEAIRSHSDFPEGSNAGFLEIVDRQNVRLRVFERGVGETQACGSGACAAVVYGRRMGWL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V+V++ GG L I W  +N  V MTG     +EG + +
Sbjct: 237 DDQVTVELTGGKLSIHWQGDNSPVLMTGPTAISFEGTIRL 276


>gi|298490598|ref|YP_003720775.1| diaminopimelate epimerase ['Nostoc azollae' 0708]
 gi|298232516|gb|ADI63652.1| diaminopimelate epimerase ['Nostoc azollae' 0708]
          Length = 279

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 136/281 (48%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGC--HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R           A+           D ++     Q+   D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRSSLTPVITPQQAVKWCDRHFGIGADGVIFALPGQN-DTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+  FLT        +  +   T+ G++  +   DG + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAAFLTELEGISRTKDYYRIHTLAGVITPQLTHDGQVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L  + IP    F   D    ++         +   VSMGNPH I F+E D+    
Sbjct: 122 MGLPRLLAQEIPTT--FAPADNKVINLPLEVAGTTWDVTCVSMGNPHCITFIE-DVAAIP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G     HP F + +NL    + +   L +R WERG G+T ACG+ ACA +VA    
Sbjct: 179 LEKIGPKFEHHPAFPQRINLEFIEIVNRNYLKMRVWERGAGITLACGTGACAVLVAGVLN 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            K +R  ++++ GG L IEW + +  ++MTG A++ + GK 
Sbjct: 239 DKCDRTATIELPGGPLEIEWSEIDQRIYMTGPAERVFIGKF 279


>gi|316983746|gb|EFV62727.1| diaminopimelate epimerase [Neisseria meningitidis H44/76]
 gi|325200553|gb|ADY96008.1| diaminopimelate epimerase [Neisseria meningitidis H44/76]
 gi|325203848|gb|ADY99301.1| diaminopimelate epimerase [Neisseria meningitidis M01-240355]
 gi|325206397|gb|ADZ01850.1| diaminopimelate epimerase [Neisseria meningitidis M04-240196]
          Length = 283

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|307257602|ref|ZP_07539362.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306863905|gb|EFM95828.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
          Length = 279

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 6   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MG 
Sbjct: 66  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGG 125

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P   +     +   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 126 PIWEPAQVPFTAN-----KFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLTPVNE 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 180 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 240 DNNVQVDLPGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 279


>gi|255645761|gb|ACU23373.1| unknown [Glycine max]
          Length = 359

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 141/291 (48%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSD-AINALSTDDNTHFDQIMLIHDFQDAS 59
           +S  + FAK  G+GN  ++ID R   +  I+++ A+     +     D ++ +       
Sbjct: 71  ESGFLHFAKYHGLGNDFVLIDNRDTSEPRISAEKAVQLCDRNFGVGADGVIFVLPG-ING 129

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N D SE + CGNG+RC  +F+    +   R SFT  T  G+++ +   DG++
Sbjct: 130 TDYTMRIFNSDSSEPEMCGNGVRCFAKFVSQLENLHGRHSFTIHTGAGLIIPEVLEDGNV 189

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-----V 171
            VDMGEP+L    +P     +  D        V    + +   VSMGNPH + F      
Sbjct: 190 RVDMGEPVLKALDVPTKLPAN-KDNAVVKSQLVVDGVIWHVTCVSMGNPHCVTFSREGSQ 248

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    LA  G     H +F    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 249 NLLVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSNSHLKMRVWERGAGATLACGTGACA 308

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           +V A+    +  R  +V + GG L IEW  ++NHV+MTG A   + G L +
Sbjct: 309 TVAAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGSADVVYYGSLPL 359


>gi|325144201|gb|EGC66508.1| diaminopimelate epimerase [Neisseria meningitidis M01-240013]
          Length = 301

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 20  NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 79

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 80  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 139

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 140 GKPRFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 197

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 198 RETGSLIEPHRQFPERVNVGFMQIISRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 257

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 258 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 298


>gi|170718542|ref|YP_001783749.1| diaminopimelate epimerase [Haemophilus somnus 2336]
 gi|189082834|sp|B0UWU6|DAPF_HAES2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|168826671|gb|ACA32042.1| Diaminopimelate epimerase [Haemophilus somnus 2336]
          Length = 274

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +    ++ I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAVTQNIYFPTEVIKRLADRNRGIGFDQLLVVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    +K     T +G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVVLKGLTNKKEIAVSTAKGKMMLCVKDDDMVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +      VVSMGNPH +  VE D+ H ++  
Sbjct: 121 PIWEPNKIPFNA-----NKFEKNYIIRTDIQTLLCGVVSMGNPHCVTQVE-DIQHANIEI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINRNHIKLRVYERGAGETQACGSGACAAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V + GG L+IEW    H ++MTGEA   ++G + +
Sbjct: 235 GSCVQVDLPGGRLMIEWQGKGHPLYMTGEATHIYDGVIRL 274


>gi|78044318|ref|YP_360325.1| diaminopimelate epimerase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123576129|sp|Q3AC09|DAPF_CARHZ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|77996433|gb|ABB15332.1| diaminopimelate epimerase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 274

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 139/282 (49%), Gaps = 14/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGC----HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++F KM G+GN  +V+D        + N++  A            D ++L+   + A  D
Sbjct: 1   MEFLKMHGLGNDFVVVDEIKNQNLVNKNLSDLAKKICDRRFGIGADGLVLLLPSEKA--D 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKR--KSFTFETIRGILVAKENRDGSISVD 119
             +RIIN DGSE + CGN +RCV R+   +     K    ET+ GI+  +   +  + VD
Sbjct: 59  FKMRIINSDGSEAEMCGNAIRCVARYYVEKYNPAKKQLEVETLAGIIKPEVLENNMVRVD 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG PIL  + IP+A   + ++     +G   +        VSMGNPHA+ FV+  L   +
Sbjct: 119 MGRPILKPQEIPVAVEEEPVNIPLEVLGQKFY-----FTAVSMGNPHAVIFVD-SLAKIE 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L  +G L+  HP+F    N+    + S   + +  WERG G T ACG+ A A VVA   L
Sbjct: 173 LEKYGPLIETHPLFPRKTNVEFVEILSPAKVKVFVWERGAGATLACGTGASAVVVAGRIL 232

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
                 V V + GG L I W     V+MTG A+  ++G+  +
Sbjct: 233 GHLQEDVEVVLPGGSLFINWVFGESVYMTGPAEIVFKGEYFL 274


>gi|254804641|ref|YP_003082862.1| Diaminopimelate epimerase [Neisseria meningitidis alpha14]
 gi|254668183|emb|CBA04889.1| Diaminopimelate epimerase [Neisseria meningitidis alpha14]
          Length = 283

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 142/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGN HA+  V+ D+    +
Sbjct: 122 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNSHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|75909296|ref|YP_323592.1| diaminopimelate epimerase [Anabaena variabilis ATCC 29413]
 gi|75703021|gb|ABA22697.1| diaminopimelate epimerase [Anabaena variabilis ATCC 29413]
          Length = 282

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/286 (33%), Positives = 142/286 (49%), Gaps = 11/286 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSD-AINALSTDDNTHFDQIMLIHDFQDA 58
           M    ++F K  G+GN  ++ID R      IT + A+           D ++     ++ 
Sbjct: 1   MGKMAIEFTKYHGLGNDFILIDNRASKTPAITPEKAVEMCDRHFGIGADGVIFALPGEN- 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRM----KRKSFTFETIRGILVAKENRDG 114
             D  +RI N DGSE + CGNG+RC+  FL         + ++   T+ G++  +   DG
Sbjct: 60  GTDYTMRIFNSDGSEPEMCGNGIRCLAAFLADLEGLSRNKDTYRIHTLAGVITPQLTPDG 119

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            I VDMG P L    IP   +    D+   +              VSMGNPH I FVE D
Sbjct: 120 QIKVDMGLPRLLAGEIPT--NIAAADQKVINQPLEVEGKTWEVTCVSMGNPHCITFVE-D 176

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    L + G     HP F +  N    +V S + L +R WERG G+T ACG+ ACAS+V
Sbjct: 177 VAAIPLETIGPKFEHHPAFPQRTNTEFIQVVSRDYLKMRVWERGAGITLACGTGACASLV 236

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           A+    +++R  +V++ GG L IEW + +  ++MTG A + + GKL
Sbjct: 237 AAVLTGRSDRLATVELPGGPLEIEWSEVDQRIYMTGPADRVFTGKL 282


>gi|166368685|ref|YP_001660958.1| diaminopimelate epimerase [Microcystis aeruginosa NIES-843]
 gi|189082835|sp|B0JJ58|DAPF_MICAN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166091058|dbj|BAG05766.1| diaminopimelate epimerase [Microcystis aeruginosa NIES-843]
          Length = 281

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 92/285 (32%), Positives = 144/285 (50%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD--AINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F K +G+GN  ++ID R   + + +   A+           D ++     Q A  D  
Sbjct: 3   IPFTKYQGLGNDFILIDNRHSPEPLITAEMAVAMCDRHFGIGADGVIFALPGQ-AETDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ +F+     +    +++   T+ G ++ +   +  ++VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAQFIARLEANNAIGRTYRIHTLAGTIIPRLEANEQVTVD 121

Query: 120 MGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P L    IP  L +  +K+      +   + L       VSMGNPH + FV  DL  
Sbjct: 122 MGPPQLLGSEIPTTLVKGSEKVLAVPLEVEGKDWL----VTCVSMGNPHCVTFVG-DLAS 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L + G     HP+F +  N+    V + + + +R WERG G+T ACG+ ACA VVA+ 
Sbjct: 177 IPLETIGPKFEHHPVFPQRTNVEFVEVIAPDYMKMRVWERGAGITLACGTGACAVVVAAL 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              K +R  +V++ GG L I W   +N V+MTG AK  +EG   I
Sbjct: 237 LTGKCDRRCTVELPGGCLQIHWSQTDNRVYMTGPAKAVFEGIYPI 281


>gi|307250808|ref|ZP_07532737.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306857167|gb|EFM89294.1| Diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
          Length = 274

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T D I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLAPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++M G+A   ++G + +
Sbjct: 235 DNNVQVDLPGGSLQIEWEGVGHPLYMAGDATHIYDGFIKL 274


>gi|121634557|ref|YP_974802.1| diaminopimelate epimerase [Neisseria meningitidis FAM18]
 gi|120866263|emb|CAM10004.1| putative diaminopimelate epimerase [Neisseria meningitidis FAM18]
 gi|308388948|gb|ADO31268.1| putative diaminopimelate epimerase [Neisseria meningitidis
           alpha710]
 gi|325132004|gb|EGC54703.1| diaminopimelate epimerase [Neisseria meningitidis M6190]
 gi|325137835|gb|EGC60410.1| diaminopimelate epimerase [Neisseria meningitidis ES14902]
          Length = 283

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPRFMPSEIPFVPELGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|332528838|ref|ZP_08404812.1| diaminopimelate epimerase [Hylemonella gracilis ATCC 19624]
 gi|332041697|gb|EGI78049.1| diaminopimelate epimerase [Hylemonella gracilis ATCC 19624]
          Length = 302

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 134/287 (46%), Gaps = 10/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       + +     L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGQLGLNTAQYRWLADRHFGVGADQILSVRPSPAPGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
            I N DG+EV+ CGNG RC  RF+  R   +  +   +T+ G++  +   DG ++VDMG 
Sbjct: 63  VIHNADGAEVEQCGNGARCFARFVHDRGLSEKPSIRVQTLGGVIEPRITLDGRVTVDMGA 122

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPFVVS-----MGNPHAIFFVEDDLY 176
           PI D   +P  A     +D+   H          +   V+     MGNPHA+  V  D+ 
Sbjct: 123 PIFDLVRVPFDAEGLTPLDQGNAHGAWQTWPVSVDGVPVNLAVLSMGNPHAVQIV-ADVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G  + +H  F   VN    +V + + + LR WERG G T ACG+ ACA+VVA 
Sbjct: 182 AAPVREQGPRIEQHARFPRRVNAGFMQVVARDRVKLRVWERGAGETLACGTGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKT 283
             L      V V   GG L IEW +   V MTG A   + G++D+  
Sbjct: 242 IRLGLLEARVDVHTRGGVLTIEWSEGRPVLMTGPATTVFHGEIDVPE 288


>gi|149177050|ref|ZP_01855658.1| diaminopimelate epimerase [Planctomyces maris DSM 8797]
 gi|148844115|gb|EDL58470.1| diaminopimelate epimerase [Planctomyces maris DSM 8797]
          Length = 279

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 134/282 (47%), Gaps = 15/282 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC--HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  + ++       ++I S AI           D ++LI   + A  DA 
Sbjct: 1   MKFTKMHGAGNDYVYVNCFEETLPEDIASLAIAVSDRHTGIGSDGLILICPSEKA--DAQ 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKEN------RDGSIS 117
           +R+ N DGSE + CGNG+RCV +++         T +   G  V   +      +   + 
Sbjct: 59  MRMFNADGSESEMCGNGVRCVAKYVYDHGISNQQTLKIETGAGVLSLDLELAGSKVSQVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+PIL    IP     D        +G            VSMGNPH I FV+ ++  
Sbjct: 119 VNMGKPILTSAEIPTLLPGDPPVNAPLEVGAQ----TLEVTCVSMGNPHCITFVD-EVND 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G  +  HPMF   VN     V S   L +R WERG G T ACG+ ACAS VA  
Sbjct: 174 HWVHGIGPQVEVHPMFPRRVNAEFIEVISPAELKMRVWERGSGETQACGTGACASAVAGV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              ++ R V + + GG L +EW DN+ VFMTG A + ++G  
Sbjct: 234 LTGRSERNVLIHLPGGDLRLEWADNDEVFMTGPAVEVYQGIW 275


>gi|294340801|emb|CAZ89196.1| Diaminopimelate epimerase (DAP epimerase) [Thiomonas sp. 3As]
          Length = 287

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/283 (32%), Positives = 138/283 (48%), Gaps = 7/283 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           V F KM G GN  +V+D       +++  +  L+        DQI+L+       VD   
Sbjct: 3   VAFTKMHGAGNDFVVLDATRAPLALSAAQLRLLADRHFGVGADQILLVEAAPSPEVDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V ++  +    ++    +T+ G++  +   DG ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVAYVHGKGLTAKRRIRVQTLSGLIEPELQPDGRVTVDMGA 122

Query: 123 PILDWKLIPLARS-FDKMDRDRFHIGPVNHLF-LRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ D   +P           D +   P++ +       V+SMGNPHA+  V+ D+    +
Sbjct: 123 PVFDLPRVPFEAHGLRPRQVDGWEQWPLDLVGATAWVSVLSMGNPHAVQRVD-DVDTAPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            S G L+  HP F   VN    ++   + + LR WERG G T ACG+ ACA+VVA     
Sbjct: 182 LSHGPLIEHHPRFPRRVNAGFMQIVDAQHIRLRVWERGAGETLACGTGACAAVVAGLRHG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
               AV V+  GG L I W      V MTG A   ++G +D+ 
Sbjct: 242 WLQGAVDVQTHGGELTISWAGAGQPVRMTGPAAFVFDGTIDLP 284


>gi|325129925|gb|EGC52726.1| diaminopimelate epimerase [Neisseria meningitidis OX99.30304]
 gi|325136015|gb|EGC58625.1| diaminopimelate epimerase [Neisseria meningitidis M0579]
 gi|325202442|gb|ADY97896.1| diaminopimelate epimerase [Neisseria meningitidis M01-240149]
 gi|325207806|gb|ADZ03258.1| diaminopimelate epimerase [Neisseria meningitidis NZ-05/33]
          Length = 283

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 144/281 (51%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVEQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPRFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|167855050|ref|ZP_02477823.1| glucosamine-6-phosphate deaminase [Haemophilus parasuis 29755]
 gi|219872103|ref|YP_002476478.1| diaminopimelate epimerase [Haemophilus parasuis SH0165]
 gi|254767106|sp|B8F878|DAPF_HAEPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167853788|gb|EDS25029.1| glucosamine-6-phosphate deaminase [Haemophilus parasuis 29755]
 gi|219692307|gb|ACL33530.1| diaminopimelate epimerase [Haemophilus parasuis SH0165]
          Length = 274

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 92/279 (32%), Positives = 137/279 (49%), Gaps = 10/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I   +       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEELIRKWADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +           T +G +V     DG + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKQDIGVSTAKGKMVLSLQDDGQVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +      VVSMGNPH +  VE ++   ++  
Sbjct: 121 PIWEPAQIPFTA-----NKFEKNYILRTDIQTVLCGVVSMGNPHCVLQVE-NIQTANVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL +H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGALLERHERFPERANIGFMQVINRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           +  V V + GG L IEW    + ++MTG+A+  ++G + 
Sbjct: 235 DSRVQVDLPGGTLHIEWQGVGSPLYMTGDAEHIYDGAVK 273


>gi|107024016|ref|YP_622343.1| diaminopimelate epimerase [Burkholderia cenocepacia AU 1054]
 gi|116691103|ref|YP_836726.1| diaminopimelate epimerase [Burkholderia cenocepacia HI2424]
 gi|105894205|gb|ABF77370.1| diaminopimelate epimerase [Burkholderia cenocepacia AU 1054]
 gi|116649192|gb|ABK09833.1| diaminopimelate epimerase [Burkholderia cenocepacia HI2424]
          Length = 309

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 137/288 (47%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFK 82

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 83  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDQRSVRVQVMKGLITLTLQENGEVVVDMG 142

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   +    + + +            R    VSMGNPHA+  V+ D+  Y 
Sbjct: 143 APVFAPAQVPFDAAGLDSRKEGNDTLWPLDVGGATRWISTVSMGNPHAVQVVD-DVEAYP 201

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 202 VLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 261

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 262 GLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPATTVFEGEIDLNA 309


>gi|325142033|gb|EGC64465.1| diaminopimelate epimerase [Neisseria meningitidis 961-5945]
 gi|325197981|gb|ADY93437.1| diaminopimelate epimerase [Neisseria meningitidis G2136]
          Length = 283

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I   +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVEQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPRFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|319637644|ref|ZP_07992410.1| diaminopimelate epimerase [Neisseria mucosa C102]
 gi|317400799|gb|EFV81454.1| diaminopimelate epimerase [Neisseria mucosa C102]
          Length = 283

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 141/284 (49%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +V++      +  +  +   +       FDQ +++      +
Sbjct: 1   MKT--LKFTKMHGLGNDFMVVNAIEQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDA 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++
Sbjct: 59  VDFRYRIFNADGREVEQCGNGARCFARFVADKGLTDKTEILVETAKGIIVPKLLDNGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP   +  + + D      +  L       V+MGNPHA+  V+ ++  
Sbjct: 119 VNMGKPRFMPSEIPFVPAHGETE-DALTHIVLVGLESVPVSCVNMGNPHAVILVD-NVET 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +  +G+ +  H  F E VN+   ++    S+ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVDHWGSAIESHEQFPERVNVGFMQIEDELSVRLRVFERGVGETQACGTGACAAVVAGV 236

Query: 238 CLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                     V V + GG L I W +   V MTG A+  +EG+L
Sbjct: 237 RNGLLKAGAPVRVTLPGGELFISWEEGGDVQMTGPAETVFEGEL 280


>gi|254246906|ref|ZP_04940227.1| Diaminopimelate epimerase [Burkholderia cenocepacia PC184]
 gi|124871682|gb|EAY63398.1| Diaminopimelate epimerase [Burkholderia cenocepacia PC184]
          Length = 309

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 136/288 (47%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFK 82

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 83  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDQRSVRVQVMKGLITLTLQDNGEVVVDMG 142

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   +     ++              R    VSMGNPHA+  V+ D+  Y 
Sbjct: 143 APVFAPAQVPFDAAGLDSRQEGRDTLWPLDVGGATRWISTVSMGNPHAVQVVD-DVEAYP 201

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 202 VLEEGPLIERHARFPQRVNAGFMQIVSRREVKLRVYERGAGETLACGTGACAAVAAGIRR 261

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 262 GLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPATTVFEGEIDLNA 309


>gi|223673992|pdb|3EJX|A Chain A, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673993|pdb|3EJX|B Chain B, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673994|pdb|3EJX|C Chain C, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673995|pdb|3EJX|D Chain D, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673996|pdb|3EJX|E Chain E, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223673997|pdb|3EJX|F Chain F, Crystal Structure Of Diaminopimelate Epimerase From
           Arabidopsis Thaliana In Complex With Ll-Azidap
 gi|223674010|pdb|3EKM|A Chain A, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674011|pdb|3EKM|B Chain B, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674012|pdb|3EKM|C Chain C, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674013|pdb|3EKM|D Chain D, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674014|pdb|3EKM|E Chain E, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
 gi|223674015|pdb|3EKM|F Chain F, Crystal Structure Of Diaminopimelate Epimerase Form
           Arabidopsis Thaliana In Complex With Irreversible
           Inhibitor Dl-Azidap
          Length = 317

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 95/288 (32%), Positives = 137/288 (47%), Gaps = 13/288 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           ++ ++ F K  G+GN  +++D R   +  IT +    L         D ++      +  
Sbjct: 23  ETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVN-G 81

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +   + SFT  T  G++V +   DG +
Sbjct: 82  TDYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQV 141

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED--- 173
            VDMG PIL  + +P   S +           V      N   VSMGNPH I F +    
Sbjct: 142 KVDMGTPILKAQDVPTKLSGN-KGEAVVEAELVVDGVSWNVTCVSMGNPHCITFGKKGGP 200

Query: 174 --DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +   +L   G     H MF    N     V S   L +R WERG G T ACG+ ACA
Sbjct: 201 NLKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWERGAGATLACGTGACA 260

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGK 278
            VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G 
Sbjct: 261 LVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS 308


>gi|88813058|ref|ZP_01128300.1| Diaminopimelate epimerase [Nitrococcus mobilis Nb-231]
 gi|88789691|gb|EAR20816.1| Diaminopimelate epimerase [Nitrococcus mobilis Nb-231]
          Length = 277

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 145/282 (51%), Gaps = 10/282 (3%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDA 62
           + + F KM+ +GN  +VID       ++SD I  LS        DQ++L    Q    D 
Sbjct: 2   TKLRFTKMQALGNDFIVIDAMSQTVALSSDQIRQLSNRRLGIGCDQVLLAERPQRPDTDI 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSF--TFETIRGILVAKENRDGSISVDM 120
             R+ N DG EV+ CGNG+RC+ RFL  +   +      ET  G+ +     DG+I+V+M
Sbjct: 62  RYRVFNADGGEVEHCGNGVRCLARFLHEKALLEQHELRVETRNGLTLVHLCDDGAIAVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P+L+ + IP   +    +           +       VSMGNPHA+  V+ D+    +
Sbjct: 122 GPPVLEPERIPFRPTKQASEYALALEDKRIMIG-----AVSMGNPHAVLQVD-DIDSAPI 175

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            +FG L+ +H  F + VN+   +V S + + LR +ERG G T ACG+ ACA+VV+     
Sbjct: 176 DTFGPLIMEHADFPQRVNVGFMQVISRDRIRLRVYERGAGETPACGTGACAAVVSGRLRG 235

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
             +  V V + GG L+I W   +  V+MTG A   +EG++ +
Sbjct: 236 LLDARVKVNLPGGELMIYWDGGDTSVWMTGPALTVYEGEIRL 277


>gi|165976961|ref|YP_001652554.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|229807484|sp|B0BRC5|DAPF_ACTPJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|165877062|gb|ABY70110.1| diaminopimelate epimerase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 274

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID    +  +T + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    ++     T +G +V     +  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   +P        ++   +      L      VVSMGNPH +  VE D+    +  
Sbjct: 121 PIWEPAQVPFTA-----NKFEKNYILRTDLQTVLCGVVSMGNPHCVLQVE-DINLTPVNE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E  N+   +V +   + LR +ERG G T ACGS AC +V         
Sbjct: 175 LGPLLENHERFPERANIGFMQVVNRNHIKLRVFERGAGETQACGSGACGAVAVGIMQGVL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L IEW    H ++MTG+A   ++G + +
Sbjct: 235 DNNVQVDLSGGSLQIEWEGVGHPLYMTGDATHIYDGFIKL 274


>gi|254483234|ref|ZP_05096466.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2148]
 gi|214036457|gb|EEB77132.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2148]
          Length = 276

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 130/281 (46%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G GN  +V+D+      +    I  L+        DQ++++       VD  
Sbjct: 2   LLKFTKMHGAGNDFIVVDLISQRCKLRPREIRKLADRRFGVGCDQVLIVEPPGSPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC  RF+       ++  + ET  GI+  +   +  + VDMG
Sbjct: 62  YRIFNADGGEVEQCGNGARCFARFVRDNKLTSKRIISVETACGIIQLRLRDNNQVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PIL+ + IP          +           +     +SMGNPH++  V+ D+   ++ 
Sbjct: 122 APILEPQKIPFDAP-----EEATSYPLQVEENVLEIGALSMGNPHSVCRVD-DVDSINIE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  HP F +  N    ++ S   + LR +ERGVG T ACG+ ACA+VV       
Sbjct: 176 HLGPLIEHHPRFPQRTNAGFMQIVSETEIKLRVFERGVGETLACGTGACAAVVYGLSRGW 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V+V + GG L I W      V MTG     +EG + I
Sbjct: 236 LRDTVTVNLSGGKLSISWAGPGQPVIMTGPTASVFEGTIRI 276


>gi|198284450|ref|YP_002220771.1| Diaminopimelate epimerase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|198248971|gb|ACH84564.1| Diaminopimelate epimerase [Acidithiobacillus ferrooxidans ATCC
           53993]
          Length = 297

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 126/282 (44%), Gaps = 10/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +V D      ++  + +  ++        DQI+L+        D   
Sbjct: 13  LRFTKMQGLGNDFVVFDGIRQRVDLPPEMVRTIADRHFGIGCDQILLVEAAASPDCDFRY 72

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG+EV  CGNG RC            +   T ET  G L+     +G+I+V MG 
Sbjct: 73  RIFNADGTEVAQCGNGARCFAVFVRRAKLTGKDIITVETRTGRLILHHRGNGNITVHMGV 132

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L    +P      + D +                 V MGNPHA+  V        +A+
Sbjct: 133 PRLVPADVPF-----RADEESPEYLLSAGKHTLRIAAVGMGNPHAVLRVASAAE-APVAT 186

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F E  N+    +     + LR WERG G T ACGS ACA+VVA     + 
Sbjct: 187 LGPRIETHPAFPERCNVGFMEIRDRNHIQLRVWERGAGETLACGSNACAAVVAGIRWDEL 246

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
           + AV+V + GG L IEW    H V MTG A+  ++G   +  
Sbjct: 247 DHAVAVTLPGGTLEIEWAGPGHPVMMTGPAQVVFDGVWPLPA 288


>gi|261378786|ref|ZP_05983359.1| diaminopimelate epimerase [Neisseria cinerea ATCC 14685]
 gi|269144763|gb|EEZ71181.1| diaminopimelate epimerase [Neisseria cinerea ATCC 14685]
          Length = 283

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 99/281 (35%), Positives = 146/281 (51%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFIPEHAPIAAWADRFRGIGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC  RF+  +    +K    ET +GI+  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVEQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP     D+ D D    G      ++    V++GNPHA+  V+ D+    +
Sbjct: 122 GKPKFMPSEIPFVPVSDEGD-DACIYGVHLESGIQPVSCVNIGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|218666260|ref|YP_002427117.1| diaminopimelate epimerase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|218518473|gb|ACK79059.1| diaminopimelate epimerase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 288

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 126/282 (44%), Gaps = 10/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +V D      ++  + +  ++        DQI+L+        D   
Sbjct: 4   LRFTKMQGLGNDFVVFDGIRQRVDLPPEMVRTIADRHFGIGCDQILLVEAAASPDCDFRY 63

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG+EV  CGNG RC            +   T ET  G L+     +G+I+V MG 
Sbjct: 64  RIFNADGTEVAQCGNGARCFAVFVRRAKLTGKDIITVETRTGRLILHHRGNGNITVHMGV 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L    +P      + D +                 V MGNPHA+  V        +A+
Sbjct: 124 PRLVPADVPF-----RADEESPEYLLSAGKHTLRIAAVGMGNPHAVLRVASAAE-APVAT 177

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F E  N+    +     + LR WERG G T ACGS ACA+VVA     + 
Sbjct: 178 LGPRIETHPAFPERCNVGFMEIRDRNHIQLRVWERGAGETLACGSNACAAVVAGIRWDEL 237

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
           + AV+V + GG L IEW    H V MTG A+  ++G   +  
Sbjct: 238 DHAVAVTLPGGTLEIEWAGPGHPVMMTGPAQVVFDGVWPLPA 279


>gi|161869705|ref|YP_001598872.1| diaminopimelate epimerase [Neisseria meningitidis 053442]
 gi|161595258|gb|ABX72918.1| diaminopimelate epimerase [Neisseria meningitidis 053442]
 gi|325127855|gb|EGC50761.1| diaminopimelate epimerase [Neisseria meningitidis N1568]
 gi|325133725|gb|EGC56381.1| diaminopimelate epimerase [Neisseria meningitidis M13399]
          Length = 283

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|304387930|ref|ZP_07370103.1| diaminopimelate epimerase [Neisseria meningitidis ATCC 13091]
 gi|304338027|gb|EFM04164.1| diaminopimelate epimerase [Neisseria meningitidis ATCC 13091]
          Length = 301

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 142/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 20  NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 79

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 80  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 139

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 140 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 197

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 198 RETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 257

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 258 LLDEGKTVEVILPGGTLYIEWACGGDVRMTGPAETVFEGEL 298


>gi|56477674|ref|YP_159263.1| diaminopimelate epimerase [Aromatoleum aromaticum EbN1]
 gi|81598729|sp|Q5P2V2|DAPF_AZOSE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56313717|emb|CAI08362.1| Diaminopimelate epimerase [Aromatoleum aromaticum EbN1]
          Length = 277

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 131/281 (46%), Gaps = 10/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      ++T + +  L+        DQ++++ +     VD   
Sbjct: 3   LRFTKMHGLGNDFVVIDAIRQSVDLTPEQVRRLADRHFGIGCDQLLVVEEATRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+  +    ++    ET  GI+  +   DG ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVRFVHEQGLTAKRRIRVETRSGIIAPQLEDDGLVTVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+L+   +P     D                      VSMGNPHA+  V D       A 
Sbjct: 123 PVLEPARVPFVSDSDA-----IVQPLDVGGETVAITAVSMGNPHAVQVVADVDAAPVAAQ 177

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+ +HP F   VN    +V     + LR +ERG G T ACG+ ACA+VV        
Sbjct: 178 -GALIERHPRFPARVNAGFVQVVDAHRIRLRVFERGAGETLACGTGACAAVVTVILRELA 236

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
              V V+  GG L I W      V MTG A   + G++D+ 
Sbjct: 237 QSPVRVETRGGELDIAWEGPGQPVLMTGPAVTVFAGEIDVD 277


>gi|159795186|pdb|2Q9J|A Chain A, Crystal Structure Of The C217s Mutant Of Diaminopimelate
           Epimerase
          Length = 274

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV   GNG RC  RF+T +    +K  +  T +G +V     D  I V+MGE
Sbjct: 61  RIFNADGSEVSQXGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTA-----NKFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T A GS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQASGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


>gi|261392870|emb|CAX50451.1| diaminopimelate epimerase (DAP epimerase) [Neisseria meningitidis
           8013]
          Length = 283

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 142/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I A +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|67920563|ref|ZP_00514083.1| Diaminopimelate epimerase [Crocosphaera watsonii WH 8501]
 gi|67858047|gb|EAM53286.1| Diaminopimelate epimerase [Crocosphaera watsonii WH 8501]
          Length = 278

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 95/282 (33%), Positives = 137/282 (48%), Gaps = 11/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K +G+GN  +++D R          +A+           D ++      D + D  
Sbjct: 1   MEFTKYQGLGNDFILVDNRHSTTPSLSPEEAVKLCDRHFGIGADGVIFALPG-DENSDYT 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF----LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE Q CGNG+RC+ RF           KS+  +T+ GI++     +G + VD
Sbjct: 60  MRIFNSDGSEPQMCGNGIRCLARFLAKLEGIDTTEKSYRIQTLAGIIIPNLEAEGQVKVD 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L  K IP   +  K +                   VSMGNPH I FVE D+    
Sbjct: 120 MGTPFLLAKEIPTTLT--KAEEKVIDQSLEVGDQSWLVTCVSMGNPHCITFVE-DVAKIP 176

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L + G     H +F E  N     V   + L +R WERG G+T ACG+ ACASVVA    
Sbjct: 177 LETIGPKFEHHAVFPERTNTEFIEVVRRDYLKMRVWERGAGITLACGTGACASVVAGVLT 236

Query: 240 HKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLD 280
              +R  +V++ GG L IEW   +N ++MTG A++ + G +D
Sbjct: 237 GHCDRLCTVELPGGCLTIEWSKKDNRLYMTGPAEEVFTGVID 278


>gi|228963958|ref|NP_486088.2| diaminopimelate epimerase [Nostoc sp. PCC 7120]
 gi|22256738|sp|Q8YVD0|DAPF2_ANASP RecName: Full=Diaminopimelate epimerase 2; Short=DAP epimerase 2
          Length = 279

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 138/281 (49%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R      IT + A+           D ++     ++   D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRASKTPAITPEKAVEMCDRHFGIGADGVIFALPGEN-GTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM----KRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+  FL         + ++   T+ G++  +   DG I VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAAFLADLEGLSRNKDTYRIHTLAGVITPQLTPDGQIKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP        D    +              VSMGNPH I FVE D+    
Sbjct: 122 MGLPRLLAGEIPTTLGA--ADGKVINQPLEVEGQTWEVTCVSMGNPHCITFVE-DVAAIP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G     HP F +  N    +V S + L +R WERG G+T ACG+ ACAS+VA+   
Sbjct: 179 LEIIGPKFEHHPAFPQRTNTEFIQVVSRDYLKMRVWERGAGITLACGTGACASLVAAVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            +++R  +V++ GG L IEW + +  ++MTG A + + GKL
Sbjct: 239 GRSDRLATVELPGGPLEIEWSEVDQRIYMTGPADRVFTGKL 279


>gi|313668759|ref|YP_004049043.1| diaminopimelate epimerase [Neisseria lactamica ST-640]
 gi|313006221|emb|CBN87683.1| putative diaminopimelate epimerase [Neisseria lactamica 020-06]
          Length = 283

 Score =  231 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 145/284 (51%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID    +       I   +       FDQ++++   +   
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDAVSQNFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEG 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV  CGNG RC  RF+T +    +K    ET +G++  K + +G ++
Sbjct: 59  VDFRYRIFNADGSEVGQCGNGARCFARFVTDKGLTDKKEICVETAKGVIFPKLSDNGMVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVEC 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVRETGPLIEAHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGI 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 237 RLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|297537396|ref|YP_003673165.1| diaminopimelate epimerase [Methylotenera sp. 301]
 gi|297256743|gb|ADI28588.1| diaminopimelate epimerase [Methylotenera sp. 301]
          Length = 276

 Score =  231 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 134/280 (47%), Gaps = 12/280 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +VI+       +T++ I  L+       FDQ++L+   + A  D   
Sbjct: 5   LHFTKMQGAGNDFIVINGIDQPFQLTAEQIQTLAHRQFGIGFDQLLLVETSKVA--DFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC VRF        +   + ET  GI+  K   +G ++V+MG 
Sbjct: 63  RIFNADGSEVAQCGNGARCFVRFVVDQKLSNKHEISVETASGIITPKLENNGLVTVNMGA 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L    +P        +     +             VSMGNPHA+  V+ D+    + +
Sbjct: 123 PRLSPSEVPFIADA-AANSYVLEVADQQITI----SAVSMGNPHAVQIVD-DVEIAPVVA 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+ +  HP F E VN    ++     + LR +ERG G T ACG+ ACA+VVA   L + 
Sbjct: 177 LGSQIEVHPRFPERVNAGFMQIIDEHHIKLRVFERGSGETLACGTGACAAVVAGIQLGRL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V   GG L I W   N  V MTG A   + G ++I
Sbjct: 237 QSPVKVSARGGELHIAWQGGNSPVMMTGPAVAVFTGNIEI 276


>gi|148906926|gb|ABR16608.1| unknown [Picea sitchensis]
          Length = 375

 Score =  231 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 93/283 (32%), Positives = 132/283 (46%), Gaps = 13/283 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGC-HDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           + F K  G+GN  +++D R      I+ +    L         D ++      +   D  
Sbjct: 91  LHFVKYHGLGNDFILVDNRDSLEPKISPEQAIKLCDRNFGVGADGVIFAMPGVN-GTDYS 149

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK---RKSFTFETIRGILVAKENRDGSISVDM 120
           +RI N DGSE + CGNG+RC+  F+         +S+   T  G++V K   DG + VDM
Sbjct: 150 MRIFNSDGSEPEMCGNGIRCMACFVAELENSPRPQSYRIHTRAGLIVPKLLEDGKVMVDM 209

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAI-----FFVEDDL 175
           G+PIL    IP      +         PV+         VSMGNPH +          D+
Sbjct: 210 GQPILTAANIPTKLPKREDGAVVKAELPVDGKI-WIVTCVSMGNPHCVTFSRKDCEVLDV 268

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L   G L   H MF    N    ++ S   L +R WERG G T ACG+ ACA VVA
Sbjct: 269 NSLTLEHIGPLFEHHEMFPARTNTEFVQILSSSHLRMRVWERGAGATLACGAGACALVVA 328

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           +    ++ R   V + GG L IEW++ +NHV+MTG A+K + G
Sbjct: 329 AVLEGRSQRKCLVDLPGGPLEIEWNEKDNHVYMTGPAEKVFSG 371


>gi|302879882|ref|YP_003848446.1| diaminopimelate epimerase [Gallionella capsiferriformans ES-2]
 gi|302582671|gb|ADL56682.1| diaminopimelate epimerase [Gallionella capsiferriformans ES-2]
          Length = 276

 Score =  231 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T++ +  L+        DQI+L+    DAS D   
Sbjct: 3   LKFTKMHGAGNDFVVLDGVRQQISLTTEQLRLLADRHFGVGCDQILLVEKAHDASADFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+  +    +     ET  G++  +   DG + V+MG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVRFVHDQKLTNKAEIVVETHNGLIRPRLEADGRVVVNMGA 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ D   IP +               V         +VSMGNPHA+  V+ D+    +  
Sbjct: 123 PVFDAARIPFSG-----GTIEVMQPLVVADQTLMVSIVSMGNPHAVQVVD-DVERAAVEV 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G L+  H  F + VN    ++   + + LR +ERG G T +CG+ ACA+VV+       
Sbjct: 177 LGPLIEHHASFPKRVNAGFMQIMDRQHIRLRVYERGSGETLSCGTGACAAVVSGIRRGLL 236

Query: 243 NRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDI 281
           +  VSV   GG L I W  +   V MTG A   + G++++
Sbjct: 237 DSPVSVATHGGNLSIAWGGEETPVLMTGPAISVFSGEINL 276


>gi|241760323|ref|ZP_04758418.1| diaminopimelate epimerase [Neisseria flavescens SK114]
 gi|241319201|gb|EER55679.1| diaminopimelate epimerase [Neisseria flavescens SK114]
          Length = 283

 Score =  231 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 139/284 (48%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +V++      +  +  +   +       FDQ +++      +
Sbjct: 1   MKT--LKFTKMHGLGNDFMVVNAINQDFDPLAAPLAQWADRYRGVGFDQFLVVEKPSSDA 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DG EV+ CGNG RC  RF+  +    +     ET +GI+V K   +G ++
Sbjct: 59  VDFRYRIFNADGREVEQCGNGARCFARFVADKGLTDKTEILVETAKGIIVPKLLDNGLVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP        ++D      +  L       V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPRFMPSEIPFV-PAHGENKDALTHIVLVGLESVPVSCVNMGNPHAVILVD-DVET 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +  +G  +  H  F E VN+   +V    S+ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVEHWGGAIESHEQFPERVNVGFVQVEDELSVRLRVFERGVGETQACGTGACAAVVAGV 236

Query: 238 CLHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                     V V + GG L I W +   V MTG A+  +EG+L
Sbjct: 237 RNGLLKEGAPVRVTLPGGELFISWEECGDVQMTGPAETVFEGEL 280


>gi|326315548|ref|YP_004233220.1| diaminopimelate epimerase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323372384|gb|ADX44653.1| diaminopimelate epimerase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 297

 Score =  231 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 93/293 (31%), Positives = 135/293 (46%), Gaps = 17/293 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGRLGLTPAQYRYLADRHFGVGADQILTVRPSPADGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC  R++  +      T   +T+ G++  +   DG ++VDMG 
Sbjct: 63  VIHNADGGEVEQCGNGARCFARYVRDKGLTDRDTIRVQTLAGVIAPRLTEDGRVTVDMGR 122

Query: 123 PILDWKLIPLARSF-----------DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           P  D   +P   S              +D             + +  VVSMGNPHA+  V
Sbjct: 123 PRFDPAEVPFDASGLESTVRGAGQTWPLDLGAGAGAGAQEGDVVDVAVVSMGNPHAVQLV 182

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
           E D+    +A  G L+ +H  F + VN    ++     + LR +ERG G T ACG+ ACA
Sbjct: 183 E-DVDTAPVARTGPLIERHVRFPQRVNAGYLQIEDRSRVRLRVYERGAGETLACGTGACA 241

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
           +V A   L   +  V V+  GG L I W  +    VFMTG A   +EG++DI 
Sbjct: 242 AVAAGIRLGLLDTRVDVRTRGGLLTIAWSGDPSESVFMTGPATTVFEGQIDIP 294


>gi|170700793|ref|ZP_02891784.1| Diaminopimelate epimerase [Burkholderia ambifaria IOP40-10]
 gi|170134280|gb|EDT02617.1| Diaminopimelate epimerase [Burkholderia ambifaria IOP40-10]
          Length = 294

 Score =  231 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 88/293 (30%), Positives = 136/293 (46%), Gaps = 16/293 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFD-------KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            P+     +P   +         + +              R    VSMGNPHA+  V+ D
Sbjct: 123 APVFAPAQVPFDTAGPGASGLDGRAEGRDTLWPLDVGGATRWISAVSMGNPHAVQVVD-D 181

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +  Y +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V 
Sbjct: 182 VEAYPVLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVA 241

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
           A       +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 242 AGIRRGLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPAATVFEGEIDLTA 294


>gi|114328164|ref|YP_745321.1| diaminopimelate epimerase [Granulibacter bethesdensis CGDNIH1]
 gi|122326877|sp|Q0BS04|DAPF_GRABC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|114316338|gb|ABI62398.1| diaminopimelate epimerase [Granulibacter bethesdensis CGDNIH1]
          Length = 275

 Score =  231 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 107/282 (37%), Positives = 154/282 (54%), Gaps = 14/282 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDA 62
           ++DF KM G+GN  +V D R      ++     A++        DQ++++     A  DA
Sbjct: 2   LIDFIKMHGLGNDFVVFDARKGPSLALSGSQAAAIADRRTGVGCDQLIVLEPSTVA--DA 59

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           F+RI N DGSE  +CGN  RCV   L           ET+ G+L+A+ N +G I +DMG+
Sbjct: 60  FMRIYNPDGSESGACGNATRCVADLLHRDGIAAPC-METVAGLLLAEINGNG-ICIDMGQ 117

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L W+ +PLAR  D +        P+    L+ P   SMGNPHA FFV  DL   D+  
Sbjct: 118 PGLGWRDVPLAREMDTL------FLPLEAPGLKMPAACSMGNPHATFFV-ADLAELDIPV 170

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL +HP+F E  N+  A++ S   + LR WERG GLT ACG+ ACA++V +      
Sbjct: 171 TGPLLERHPLFPERANIGHAQMLSRSHIRLRVWERGAGLTLACGTGACATLVNAVRRGLA 230

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKT 283
            R   V++ GG LLI W + + HV MTG A   + G++ +++
Sbjct: 231 EREAVVELDGGQLLIHWREQDGHVLMTGPAATVFHGRIALES 272


>gi|307153995|ref|YP_003889379.1| diaminopimelate epimerase [Cyanothece sp. PCC 7822]
 gi|306984223|gb|ADN16104.1| diaminopimelate epimerase [Cyanothece sp. PCC 7822]
          Length = 281

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 87/279 (31%), Positives = 133/279 (47%), Gaps = 11/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R   D +     A+           D ++ +        D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRHSKDPLVSPEMAVQMCDRHFGIGADGVIFVLPGT-PQTDYQ 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKR----KSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ +F+          K++  +T+ G++  +   +  ++VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAQFIAQLEGTSESGKAYRIDTLAGVITPRLEEEEQVTVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP             +              VSMGNPH I FVE ++    
Sbjct: 122 MGPPQLQAAQIPTT--LVTATEKVINQPLSVGGKSWLVTCVSMGNPHCITFVE-NVDEIP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G     H  F +  N     V   + L +R WERG G+T ACG+ ACA+VVA    
Sbjct: 179 LEVIGPEFEHHAAFPQRTNTEFIEVVRPDYLKMRVWERGAGITLACGTGACATVVAGLLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           H+++R  +V++ GG L I W + + HV+MTG AK+ + G
Sbjct: 239 HRSDRRCTVELPGGCLRIYWSETDGHVYMTGPAKRVFSG 277


>gi|238028905|ref|YP_002913136.1| Diaminopimelate epimerase [Burkholderia glumae BGR1]
 gi|237878099|gb|ACR30432.1| Diaminopimelate epimerase [Burkholderia glumae BGR1]
          Length = 288

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 132/287 (45%), Gaps = 10/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D       +T + + AL+        DQ++L+        D   
Sbjct: 3   LPFTKMHGAGNDFVVLDGTAGDLGLTPERVRALADRHFGVGADQVLLVERPTLDGADFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC VRF+  +      T   +   G+L      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVRFVHDKGLTDKTTVRVQVSHGLLTLTLQENGEVVVDMGS 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P   +     R+              R   VVSMGNPHA+  V+ D+  + +
Sbjct: 123 PVFEPARVPFDAAGLDARREGADTLFPLEVGGTTRWISVVSMGNPHAVQVVD-DVETFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G L+  H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 AEEGPLVEHHARFPQRVNAGFLQIVSRREVKLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHD----NNHVFMTGEAKKEWEGKLDIKT 283
             +  V+V+  GG L I W         + M G A   +EG  ++  
Sbjct: 242 LLDSPVAVQTHGGVLTIAWDGMRDAAAPLSMAGPAVTVFEGVFELTA 288


>gi|325518791|gb|EGC98379.1| diaminopimelate epimerase [Burkholderia sp. TJI49]
          Length = 289

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 89/286 (31%), Positives = 134/286 (46%), Gaps = 11/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+  R    R+S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVNDRGLTDRRSVRVQVMKGLITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   +  +   +              R    VSMGNPHA+  V+ D   Y 
Sbjct: 123 APVFAPAQVPFDAAGLEGRAEGRDTLWPLDVGGRTRWITTVSMGNPHAVQVVD-DAEAYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
              +  V+V   GG L I W     +   + M G A   +EG++D+
Sbjct: 242 GLLDSPVTVHTHGGTLTISWDGARDETAALMMAGPATTVFEGEIDL 287


>gi|163757348|ref|ZP_02164437.1| diaminopimelate epimerase [Hoeflea phototrophica DFL-43]
 gi|162284850|gb|EDQ35132.1| diaminopimelate epimerase [Hoeflea phototrophica DFL-43]
          Length = 292

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 156/286 (54%), Positives = 196/286 (68%), Gaps = 1/286 (0%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           M+S+ V FAKM G+GN I+VIDMRG  D +TS+A  AL++ D T FDQIM IHD     V
Sbjct: 1   MEST-VPFAKMNGLGNDIVVIDMRGRSDAVTSEAAIALASGDRTGFDQIMAIHDIDLDGV 59

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           D  I I+N DGS  Q+CGNG RCVV+ L S   RKSFTF+T+ GIL A+E+ DG ISVDM
Sbjct: 60  DYRIDILNRDGSRSQACGNGTRCVVQALASETGRKSFTFKTLAGILTAEEHEDGLISVDM 119

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P   W  IPLA  F    R    IGP++   L +P  V++GNPHA+F+V+DD++ YDL
Sbjct: 120 GRPEFAWDKIPLAEEFHDTTRIELQIGPIDAPVLHSPSAVAIGNPHAVFWVKDDVWSYDL 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
             FG LL  HP+F E  N+SIARV    +LD+RTWERG GLT ACGSAACA+ V++    
Sbjct: 180 ERFGPLLENHPIFPERANISIARVIDDHTLDIRTWERGTGLTRACGSAACAAGVSAARTG 239

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
           +T R V+V + GG L IEW +NNHV MTG A+ E+ G++D  TG W
Sbjct: 240 RTGRTVTVNVPGGPLEIEWRENNHVIMTGPAEWEFSGRVDPLTGAW 285


>gi|300692857|ref|YP_003753852.1| diaminopimelate epimerase [Ralstonia solanacearum PSI07]
 gi|299079917|emb|CBJ52594.1| diaminopimelate epimerase [Ralstonia solanacearum PSI07]
          Length = 285

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 128/281 (45%), Gaps = 7/281 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G GN  +V+D      + T +   A++        DQ++L+       VD   RI N 
Sbjct: 1   MHGAGNDFVVLDGIETPIDFTPEQWRAIADRHFGVGADQLLLVERSTRPDVDFRYRIFNH 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG P+ + 
Sbjct: 61  DGGEVEHCGNGARCFVKFVTDRGLTDKRTIRVEVMHGIATLTMQPDGQVTVDMGAPVFEA 120

Query: 128 KLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
             +P          +          +        VSMGNPHA+  V+ D   + +   G 
Sbjct: 121 ARLPFVPDGLPTRVEGADTQHALQINGRTEWLSTVSMGNPHAVQVVD-DAEAFPVLEDGP 179

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+VVA       +  
Sbjct: 180 LIESHAVFPRRVNAGFMEIVDRHAIRLRVYERGAGETLACGTGACAAVVAGIRRGLLDSP 239

Query: 246 VSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTGK 285
           V V   GG L I W      V MTG A   +EG LD+   K
Sbjct: 240 VKVATHGGDLTIAWAGEGEPVLMTGPATTVFEGTLDLDALK 280


>gi|37528457|ref|NP_931802.1| diaminopimelate epimerase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81572247|sp|Q7MYN5|DAPF_PHOLL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|36787895|emb|CAE17012.1| diaminopimelate epimerase (DAP epimerase) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 274

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 85/280 (30%), Positives = 128/280 (45%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAI-NALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I           FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLADRHTGVGFDQLLIVEAPYDPDMDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +  + ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRLKGLINKRDIKVSTQSGRMVLSITNDDQVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   +P      +  R                 VVSMGNPH +  V  D+   ++  
Sbjct: 121 PEFEPHHVPF-----RALRAEKTYILRVAERTVLCGVVSMGNPHCVIQV-PDVETAEVDI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E  N+   ++ +   + LR +ERGVG T ACGS ACA+V         
Sbjct: 175 LGPALESHERFPERANIGFMQILNRGHIRLRVYERGVGETQACGSGACAAVAVGIQQQLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L I W      ++MTG A   ++G + +
Sbjct: 235 DNHVRVDLPGGSLFICWDGPGKPLYMTGPAMHVYDGTIHL 274


>gi|161526249|ref|YP_001581261.1| diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
 gi|160343678|gb|ABX16764.1| Diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
          Length = 387

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 137/288 (47%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T+  + AL+        DQ++L+        D  
Sbjct: 101 LSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALASRHFGIGADQLLLVEKPTVDGADFK 160

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 161 YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 220

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+   + +P   S      +              R    VSMGNPHA+  V+ D   Y 
Sbjct: 221 APVFAPEQVPFDASGLDGRSEGRDTLWPLEVGGRTRWISTVSMGNPHAVQVVD-DAEAYP 279

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 280 VLEEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAAGIRR 339

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     ++  + M G A   +EG++D+  
Sbjct: 340 GLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVFEGEIDLPA 387


>gi|16332245|ref|NP_442973.1| diaminopimelate epimerase [Synechocystis sp. PCC 6803]
 gi|2494041|sp|P74667|DAPF_SYNY3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|1653875|dbj|BAA18785.1| diaminopimelate epimerase [Synechocystis sp. PCC 6803]
          Length = 279

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 145/281 (51%), Gaps = 9/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F+K  G+GN  +++D R   +  +T D    L         D ++     Q    D  
Sbjct: 3   LSFSKYHGLGNDFILVDNRQSTEPCLTPDQAQQLCDRHFGIGADGVIFALPGQ-GGTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           +RI N DGSE + CGNG+RC+ +F      ++ K++   T+ G++  +   DG + VDMG
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAKFLADLEGVEEKTYRIHTLAGVITPQLLADGQVKVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP L  +LIP   +          +             VSMGNPH + FV+ D+   +L 
Sbjct: 122 EPQLLAELIPTTLA--PAGEKVVDLPLAVAGQTWAVTCVSMGNPHCLTFVD-DVDSLNLT 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L   HP FS+  N    +V   + L +R WERG G+T ACG+ ACA+VVA+    +
Sbjct: 179 EIGPLFEHHPQFSQRTNTEFIQVLGSDRLKMRVWERGAGITLACGTGACATVVAAVLTGR 238

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            +R  +V++ GG L IEW   +N ++MTG A++ + G+ +I
Sbjct: 239 GDRRCTVELPGGNLEIEWSAQDNRLYMTGPAQRVFSGQAEI 279


>gi|332527819|ref|ZP_08403857.1| diaminopimelate epimerase [Rubrivivax benzoatilyticus JA2]
 gi|332112214|gb|EGJ12190.1| diaminopimelate epimerase [Rubrivivax benzoatilyticus JA2]
          Length = 281

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 131/280 (46%), Gaps = 5/280 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D  G    ++ + I  L         DQI++I       VD   
Sbjct: 3   LRFTKMHGAGNDFVVLDATGAPLALSREQIRRLGDRRFGVGADQILVIERSTTPGVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI N  G EV+ CGNG RC VR++         T   ET+  +L      DG + VDM  
Sbjct: 63  RIFNNTGDEVEQCGNGSRCFVRYVVDHGLTDKTTIRVETVNNLLELSLAADGRVRVDMNR 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ D   +P   S                       V+SMGNPHA+  V D +    +A+
Sbjct: 123 PVFDLARVPFDASGLTPRLVNGFELWPLADAGVEVAVLSMGNPHAVMRVAD-VDAAPVAA 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  H  F   VN    +V S   + LR +ER  G T ACG+ ACA+VVA   L   
Sbjct: 182 VGPRVESHARFPRRVNAGFLQVLSRSEVKLRVYERDAGETLACGTGACAAVVAGIRLGWL 241

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +R V V   GG LLIEW D++  V MTG A   +EG++++
Sbjct: 242 DRRVEVHARGGDLLIEWPDDSASVLMTGPAVTVFEGEIEL 281


>gi|300721448|ref|YP_003710723.1| diaminopimelate epimerase [Xenorhabdus nematophila ATCC 19061]
 gi|297627940|emb|CBJ88486.1| diaminopimelate epimerase [Xenorhabdus nematophila ATCC 19061]
          Length = 280

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 134/280 (47%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+  +    FDQ++++    D  +D   
Sbjct: 7   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLADRNTGIGFDQLLVVEAPYDPDLDFHY 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  I V+MGE
Sbjct: 67  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIKVSTRSGQMVLSVTNDDQIRVNMGE 126

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      + ++                 VV+MGNPH +  VE D+   D+  
Sbjct: 127 PDFEPQRVPF-----RANKAEKTYIIRAVERTVLCGVVAMGNPHCVIQVE-DVNTADVEV 180

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L  H  F E VN+   ++ +   + LR +ERG G T ACGS ACA+V         
Sbjct: 181 LGPALENHERFPERVNVGFMQIMNRGHIRLRVFERGAGETRACGSGACAAVAVGIQQDLL 240

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  VSV + GG L I W      +FMTG A   ++G + +
Sbjct: 241 DNQVSVDLPGGSLQIRWDGPGKPLFMTGPATHVYDGMIHL 280


>gi|172039059|ref|YP_001805560.1| diaminopimelate epimerase [Cyanothece sp. ATCC 51142]
 gi|171700513|gb|ACB53494.1| diaminopimelate epimerase [Cyanothece sp. ATCC 51142]
          Length = 290

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 141/282 (50%), Gaps = 11/282 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           +++F K +G+GN  +++D R     +    +A+           D ++      D   D 
Sbjct: 12  IMEFTKYQGLGNDFILVDNRHSSTPLLSPDEAVKLCDRHFGIGADGVIFALPGDD-QSDY 70

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRF----LTSRMKRKSFTFETIRGILVAKENRDGSISV 118
            +RI N DGSE Q CGNG+RC+ RF           KS+  +T+ GI++ +   +G + V
Sbjct: 71  TMRIFNSDGSEPQMCGNGIRCLARFLAKLEGVETVGKSYRIQTLAGIIIPRLEEEGQVKV 130

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L  K IP   +  K +    +          +   VSMGNPH I FVE ++   
Sbjct: 131 DMGNPFLLAKEIPTTLT--KGEEKVINQFLEVGGQSWSVTCVSMGNPHCITFVE-NVATI 187

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L + G +   H +F E  N     V   + L +R WERG G+T ACG+ ACASVVA   
Sbjct: 188 PLETIGPMFEHHSVFPERTNTEFIEVVRSDYLKMRVWERGAGITLACGTGACASVVAGVL 247

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
               +R  +V++ GG L IEW + +N ++MTG A+  + G +
Sbjct: 248 TGNCDRLCTVELPGGCLTIEWSEQDNRLYMTGPAEAVFTGVI 289


>gi|253997887|ref|YP_003049950.1| diaminopimelate epimerase [Methylovorus sp. SIP3-4]
 gi|313199952|ref|YP_004038610.1| diaminopimelate epimerase [Methylovorus sp. MP688]
 gi|253984566|gb|ACT49423.1| diaminopimelate epimerase [Methylovorus sp. SIP3-4]
 gi|312439268|gb|ADQ83374.1| diaminopimelate epimerase [Methylovorus sp. MP688]
          Length = 277

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 88/283 (31%), Positives = 135/283 (47%), Gaps = 12/283 (4%)

Query: 5   MVD--FAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
           M+   F KM+GIGN  +VID      ++T D I A+S        DQ++++         
Sbjct: 1   MMKLEFTKMQGIGNDFVVIDAYSQPVSLTPDQIRAISDRHFGVGCDQLLIVEHATTPEAA 60

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC V+F+  +   +++    ET RG++  +   +G ++V+
Sbjct: 61  FRYRIFNADGGEVEQCGNGARCFVKFVHDQGLTQQREICVETARGLIYPRLEDNGEVTVN 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P      +P             +   + H  +      SMGNPHA+  V+ ++    
Sbjct: 121 MGPPSFLPADLPFEAE----TIQSLYPLQLAHETVEVAIA-SMGNPHAVQLVD-NVDTAP 174

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G  +  HP F + VN    ++     + LR +ERG G T ACG+ ACA+VV+   L
Sbjct: 175 VAEQGPQIESHPRFPKRVNAGFMQIVDPHHIRLRVFERGSGETLACGTGACAAVVSGIRL 234

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
                 V V   GG L I W   +  V+MTG A   + G + +
Sbjct: 235 GHLVSPVRVSTRGGELNIAWTGGDSPVWMTGPAATVFTGAIHL 277


>gi|332976391|gb|EGK13241.1| diaminopimelate epimerase [Desmospora sp. 8437]
          Length = 280

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 145/283 (51%), Gaps = 14/283 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           M+ F KM G+GN  +V+            A            D ++ +   +  + D  +
Sbjct: 1   MMRFTKMHGLGNDFIVVTADTWPQEAPELARRLCDRRFGVGADGLVFLLPSR--AGDVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGS----ISV 118
           RI+N DGSE + CGN +RCV ++   R+   +K    ET  G+   +   DGS    I V
Sbjct: 59  RILNADGSEAEQCGNAVRCVAKYYYERISGAKKEIIVETGAGLQSVRLETDGSQVESICV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PIL+   +P+A   +++      IG            VSMGNPHA+ FV+ D   +
Sbjct: 119 DMGRPILEADRVPVALEGERVVAHPVKIG----EESFRFTAVSMGNPHAVIFVD-DAAAF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            + ++G  L  HP+F    N+    V S   L++R WERGVG T ACG+ ACAS+VA+  
Sbjct: 174 PVETWGPRLETHPLFPNKTNVEFVTVHSPRELEMRVWERGVGPTLACGTGACASLVAAVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
               +R   V++ GG L IEW + ++ V+MTG A+  +EG+ +
Sbjct: 234 NGTADRRARVRLKGGDLEIEWREGDDRVYMTGPARTVFEGEWN 276


>gi|323182581|gb|EFZ67985.1| diaminopimelate epimerase [Escherichia coli 1357]
          Length = 269

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 128/275 (46%), Gaps = 10/275 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   RI N 
Sbjct: 1   MHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGEP  + 
Sbjct: 61  DGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGEPNFEP 120

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             +P      + ++                 VVSMGNPH +  V+ D+    + + G +L
Sbjct: 121 SAVPF-----RANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVD-DVDTAAVETLGPVL 174

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             H  F E  N+   +V   E + LR +ERG G T ACGS ACA+V            V 
Sbjct: 175 ESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLLAEEVR 234

Query: 248 VKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 VELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 269


>gi|94495526|ref|ZP_01302106.1| diaminopimelate epimerase [Sphingomonas sp. SKA58]
 gi|94424914|gb|EAT09935.1| diaminopimelate epimerase [Sphingomonas sp. SKA58]
          Length = 266

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 105/277 (37%), Positives = 149/277 (53%), Gaps = 16/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M  F+KM G+GN  +VID R     +T     A++        DQ+++I D  DA  D  
Sbjct: 1   MGRFSKMHGLGNDFVVIDARAAPVAMTEARARAIADRHAGIGCDQLIVIGDAPDA--DVS 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           ++I N DGSEV++CGN  RCV  F+   +     T  T  G+L A+    G  SVDMG P
Sbjct: 59  MQIFNADGSEVEACGNATRCVPLFIGHDV-----TIRTRAGLLDARLIDGG-ASVDMGAP 112

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             DW  IPLA + D +        P +   L  P  V++GNPH IFFV+ DL   D A  
Sbjct: 113 RFDWNAIPLAYAMDTL------TMPASWEDLPAPAAVNVGNPHVIFFVD-DLDAVDTARL 165

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G ++ + P+F + VN++ A+V     + L  WERG GLT ACG+ ACA+ VA+      +
Sbjct: 166 GPMIEQDPLFPQRVNVNFAQVVGENHIRLIVWERGAGLTRACGTGACATAVAAIRRKLAH 225

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             V+V + GG L+I+W     + MTG A   ++G+ D
Sbjct: 226 GPVTVTLPGGDLVIDWRPGGTIQMTGPATHVFDGEAD 262


>gi|125975578|ref|YP_001039488.1| diaminopimelate epimerase [Clostridium thermocellum ATCC 27405]
 gi|256005917|ref|ZP_05430862.1| diaminopimelate epimerase [Clostridium thermocellum DSM 2360]
 gi|281416590|ref|ZP_06247610.1| diaminopimelate epimerase [Clostridium thermocellum JW20]
 gi|254767097|sp|A3DK16|DAPF_CLOTH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|125715803|gb|ABN54295.1| diaminopimelate epimerase [Clostridium thermocellum ATCC 27405]
 gi|255990121|gb|EEU00258.1| diaminopimelate epimerase [Clostridium thermocellum DSM 2360]
 gi|281407992|gb|EFB38250.1| diaminopimelate epimerase [Clostridium thermocellum JW20]
 gi|316939697|gb|ADU73731.1| diaminopimelate epimerase [Clostridium thermocellum DSM 1313]
          Length = 280

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 97/284 (34%), Positives = 147/284 (51%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + ++      +N +  A            D ++LI   + A  D  +
Sbjct: 1   MRFTKMHGLGNDYIYVNCFEETVENPSEVAKKVSDRHFGIGSDGLVLIMPSERA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGN +RCV +++  R    +     ET+ GI V +          + V
Sbjct: 59  RMFNSDGSEAEMCGNAIRCVGKYVFDRGMTNKNVIRVETLAGIKVLELTVQDGKAKLVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL  + IP+    +    +   I             VSMGNPHA+ +V+ ++  +
Sbjct: 119 DMGEPILKPENIPVNSDKEIFRTEPVEIDGKEFK----VTCVSMGNPHAVSYVK-NVDIF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G  +  HP+F + +N     V    +L +R WERG G T ACG+ ACA +VAS  
Sbjct: 174 PLEKIGPKMEHHPLFPKRINAEFVEVIDRTTLKMRVWERGAGETLACGTGACAVLVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              + R  +VK+LGG L+IEW++ NNHV+MTG A K +EG++D+
Sbjct: 234 NGVSERKATVKLLGGDLIIEWNENNNHVYMTGPAVKVFEGEVDL 277


>gi|296136667|ref|YP_003643909.1| diaminopimelate epimerase [Thiomonas intermedia K12]
 gi|295796789|gb|ADG31579.1| diaminopimelate epimerase [Thiomonas intermedia K12]
          Length = 287

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 92/283 (32%), Positives = 135/283 (47%), Gaps = 7/283 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           V F KM G GN  +V+D       + +  +  L+        DQI+L+       VD   
Sbjct: 3   VAFTKMHGAGNDFVVLDATRSPLALNAAQLRLLADRHFGVGADQILLVEAAPSPEVDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V ++  +    ++    +T+ G++  +   DG ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVAYVHGKGLTAKRRIRVQTLSGLIEPELQPDGRVTVDMGA 122

Query: 123 PILDWKLIPLARS-FDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ D   +P           D +   P++         V+SMGNPHA+  V+ D+    +
Sbjct: 123 PVFDLPRVPFEAHGLRPRQVDGWEQWPLDLAGATAWVSVLSMGNPHAVQRVD-DVDTAPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  HP F   VN    ++   + + LR WERG G T ACG+ ACA+VVA     
Sbjct: 182 LRDGPLIEHHPRFPRRVNAGFMQIVDAQHIRLRVWERGAGETLACGTGACAAVVAGLRHG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
               AV V+  GG L I W      V MTG A   ++G +D+ 
Sbjct: 242 WLQGAVDVQTHGGELTISWAGAGQPVRMTGPAAFVFDGMIDLP 284


>gi|296313835|ref|ZP_06863776.1| diaminopimelate epimerase [Neisseria polysaccharea ATCC 43768]
 gi|296839564|gb|EFH23502.1| diaminopimelate epimerase [Neisseria polysaccharea ATCC 43768]
          Length = 283

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 146/284 (51%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID    +       I   +       FDQ++++   +   
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDAVSQNFTPEDVPIAEWADRFRGVGFDQLLVVGRSETEG 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV  CGNG RC  RF+  +    +K    ET +G++  K + +G ++
Sbjct: 59  VDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAKGVIFPKLSDNGMVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVITVD-DVEC 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G+L+  H  F E VN+   ++ S  ++ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVRETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQACGTGACAAVVAGI 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 237 RLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|187476670|ref|YP_784693.1| diaminopimelate epimerase [Bordetella avium 197N]
 gi|115421256|emb|CAJ47761.1| diaminopimelate epimerase [Bordetella avium 197N]
          Length = 298

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 88/285 (30%), Positives = 138/285 (48%), Gaps = 10/285 (3%)

Query: 5   MV-DFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDA 62
           M+ +F KM G GN  +V+D      ++T +   AL         DQI+L+        D 
Sbjct: 7   MIWNFTKMHGAGNDFVVLDGVRQTIDMTPERARALGDRHFGVGADQILLVEPATRPDADF 66

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV+ CGNG RC VRF+  +    +     E + G++V  E  D  ++V+M
Sbjct: 67  RYRIFNNDGSEVEHCGNGARCFVRFVHEQGLSSKNPLRAEIVSGLIVLDEGDDEQVTVEM 126

Query: 121 GEPILDWKLIPL---ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           G    D   +P      +  +  +D  ++ P+    +     V++ NPHA+  V  D+  
Sbjct: 127 GTTRFDPAALPFDVSGLAQRQQGQDTLYVLPLPGGEIELS-AVAISNPHAVQVV-ADVDQ 184

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             ++  G  +  HP F+  VN    ++    ++ LR +ERG G T ACG+ ACA+V A  
Sbjct: 185 APVSEVGAHIESHPRFARRVNAGFMQIQDRHNIRLRVYERGAGETLACGTGACAAVAAGI 244

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
                +  V V+  GG L I W+    + MTG A+  + G++DI 
Sbjct: 245 RRGLLDSPVRVQTRGGALTIAWNGEQ-LRMTGPAESVFSGQVDID 288


>gi|312797551|ref|YP_004030473.1| Diaminopimelate epimerase [Burkholderia rhizoxinica HKI 454]
 gi|312169326|emb|CBW76329.1| Diaminopimelate epimerase (EC 5.1.1.7) [Burkholderia rhizoxinica
           HKI 454]
          Length = 333

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 92/286 (32%), Positives = 131/286 (45%), Gaps = 10/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      + T   +  L+        DQ++L+       VD   
Sbjct: 44  LKFTKMHGAGNDFVVLDGVRNMISPTPALVRYLADRNFGVGADQLLLVERPTLDGVDFKY 103

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+      + ++   +   G++      +G + VDMG 
Sbjct: 104 RIFNCDGKEVEHCGNGARCFVKFVRDTGLSQARTIRVQVQHGVITLSVQDNGEVLVDMGA 163

Query: 123 PILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+L    +P   S      D D        H   +   VVSMGNPHA+  V+ D     +
Sbjct: 164 PVLAAPHVPFDTSGLTPARDGDDQLWPLDVHGSTQWISVVSMGNPHAVQIVD-DADAAPV 222

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++  H  F   VN    ++ S   + LR +ERG G T ACGS ACA+VV      
Sbjct: 223 NRDGPVIESHARFPNRVNAGFMQIVSRREIKLRVYERGAGETLACGSGACAAVVTGIRRG 282

Query: 241 KTNRAVSVKMLGGGLLIEWHD----NNHVFMTGEAKKEWEGKLDIK 282
             +  V V+  GG L I W      +  V M G A   +EGK+D+ 
Sbjct: 283 VLDSPVRVRTRGGTLTISWDGQRNSDASVMMAGPATTVFEGKIDVP 328


>gi|15676658|ref|NP_273802.1| diaminopimelate epimerase [Neisseria meningitidis MC58]
 gi|21362493|sp|Q9K060|DAPF_NEIMB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|7225990|gb|AAF41173.1| diaminopimelate epimerase [Neisseria meningitidis MC58]
          Length = 283

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 141/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I   +       FDQ++++   +   VD 
Sbjct: 2   NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDF 61

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 62  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 122 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 179

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 180 RETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 239

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 240 LLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGEL 280


>gi|147678135|ref|YP_001212350.1| diaminopimelate epimerase [Pelotomaculum thermopropionicum SI]
 gi|229813238|sp|A5D193|DAPF_PELTS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146274232|dbj|BAF59981.1| diaminopimelate epimerase [Pelotomaculum thermopropionicum SI]
          Length = 280

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 93/287 (32%), Positives = 143/287 (49%), Gaps = 16/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRG---CHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           + F K  G+GN  +++D        ++    A+           D ++L+     A  D 
Sbjct: 1   MHFTKAHGLGNDFILVDCFKEKVNPEDFPGLAVKMCDRHFGVGADGLVLLLPSPSA--DV 58

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILV----AKENRDGSI 116
            +RI N DGSE + CGN +RCV ++L  R   K+     ET+ G+++     +E R   +
Sbjct: 59  SMRIFNPDGSEAEMCGNAIRCVAKYLYERGMVKADRIRVETLAGVMIPELLVEEGRVRLV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEP L+   IP+     ++  +    G   +        VSMGNPH + FV+ DL 
Sbjct: 119 RVDMGEPRLERSEIPMEGPPGRVLGEPLETGGAVYRI----TAVSMGNPHCVIFVQ-DLD 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
                + G L+  HP F    N+   +V + E + +R WERG G T ACG+ ACA+VVA 
Sbjct: 174 AVPFQTAGPLIETHPAFPRRTNVEFIQVLTPEEIKMRVWERGAGETMACGTGACAAVVAG 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKT 283
                T R V+V +  G L IEW +  HV+M+G A++ + G+   +T
Sbjct: 234 VLNGYTGRRVTVHLKAGDLFIEWPEGKHVYMSGPAEEVFSGEYPYRT 280


>gi|115353182|ref|YP_775021.1| diaminopimelate epimerase [Burkholderia ambifaria AMMD]
 gi|122321974|sp|Q0BAY6|DAPF_BURCM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|115283170|gb|ABI88687.1| diaminopimelate epimerase [Burkholderia ambifaria AMMD]
          Length = 289

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 135/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   S      +              R    VSMGNPHA+  V+ D+  Y 
Sbjct: 123 APVFAPAQVPFDVSGLDGRAEGRDTLWPLDVGGATRWISAVSMGNPHAVQVVD-DVEAYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 242 GLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPAATVFEGEIDLTA 289


>gi|119483380|ref|ZP_01618794.1| diaminopimelate epimerase [Lyngbya sp. PCC 8106]
 gi|119458147|gb|EAW39269.1| diaminopimelate epimerase [Lyngbya sp. PCC 8106]
          Length = 284

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 92/286 (32%), Positives = 140/286 (48%), Gaps = 16/286 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K +G+GN  ++ID R   + +     A+     +     D ++        + D  
Sbjct: 3   IEFTKYQGLGNDFILIDNRHQSEPLITPEQAMQMCDRNFGIGADGVIFALPGTS-NTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRK----------SFTFETIRGILVAKENRD 113
           +RI N D SE Q CGNG+RC+ +F+     R           S+  +T+ G++  +   D
Sbjct: 62  MRIFNSDSSEPQMCGNGIRCLAKFIADLEHRDGKINQIPSSVSYKIDTLAGVITPEILAD 121

Query: 114 GSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           G + VDMG+P L    IP   +  K D    ++             VSMGNPH I FVE 
Sbjct: 122 GQVKVDMGQPRLLAVEIPTTLT--KADEKVVNVPLSVAEQSWKVTCVSMGNPHCITFVE- 178

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+    LA  G     HP F E  N    +V   + L +R WERG G T ACG+ ACA V
Sbjct: 179 DVAAIPLAEIGPQFEHHPAFPERTNTEFIQVIKPDYLKMRVWERGAGATLACGTGACAVV 238

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           VA       +R+V+V++ GG L+IEW  +  ++M+G A++ + G+ 
Sbjct: 239 VAGVLTGNCDRSVTVELPGGNLMIEWSASERLYMSGPAERVFTGQW 284


>gi|167579403|ref|ZP_02372277.1| diaminopimelate epimerase [Burkholderia thailandensis TXDOH]
          Length = 289

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 132/288 (45%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTDALVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+             E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTDKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D+  + 
Sbjct: 123 APVFEPARVPFDTSGLGGRREGADTLWPLPVNGATRWISVVSMGNPHAVQIVD-DVEAFP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  + + P F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLADGPAIERDPRFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +D+  
Sbjct: 242 GQLDSPVTVHTHGGTLTISWDGARDERAPLMMAGPATTVFEGVIDLPA 289


>gi|269468224|gb|EEZ79914.1| diaminopimelate epimerase [uncultured SUP05 cluster bacterium]
          Length = 270

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 144/280 (51%), Gaps = 13/280 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +V+D    + + +++ I AL+       FDQ+++I       VD  
Sbjct: 1   MINFTKMHGLGNDFMVVDNSAGNISFSAEQIRALAQRHFGIGFDQLLMIESTNTKDVDFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
             I N DGSEV+ CGNG RC  RF+  +    +   + ET  G++    N D S+ VDMG
Sbjct: 61  YVIYNSDGSEVEQCGNGARCFARFVREKGLSDKNPISVETKSGLISLFINDDHSVRVDMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP+ +   +PL    + +            +      V S GNPH +  V+ D+   D+ 
Sbjct: 121 EPVFNPSDVPLIAPEESL---------YYSIEGYEVGVFSTGNPHCVMIVD-DVEGVDVE 170

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           +    + +  +     N+   ++ S   ++LR +ERG G T ACGS ACA+V+    + +
Sbjct: 171 TIALRIQQSNLLPNQANIGFMQIISRNEINLRVYERGSGETLACGSGACAAVIHGVRIGQ 230

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            +  V+  + GG  LIE++   HVF++G A+  +EG +D+
Sbjct: 231 LDHKVTAHLRGGDALIEYNKGEHVFLSGPAQFVFEGWVDV 270


>gi|261855002|ref|YP_003262285.1| diaminopimelate epimerase [Halothiobacillus neapolitanus c2]
 gi|261835471|gb|ACX95238.1| diaminopimelate epimerase [Halothiobacillus neapolitanus c2]
          Length = 281

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 83/279 (29%), Positives = 130/279 (46%), Gaps = 10/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID       +  + I   +       FDQ++++   + A      
Sbjct: 3   IHFTKMHGLGNDFMVIDAINQAIELNPEQIRQWANRHFGIGFDQLLIVEPPKTADTLFTY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  R++  +     K     T  G +V   N  G ++VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFARYVYDKGLTTEKEIPVGTASGRIVLHINDSGDVTVDMGR 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+     IP     +              +       VSMGNPHA+  VE ++    ++ 
Sbjct: 123 PMFTPTNIPFITECEATSYPLTLDDGSEWVID----AVSMGNPHAVLEVE-NVDTAPVSH 177

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G ++  H  F   VN+   ++   + + LR +ERG G T ACG+ ACA+VV+    ++ 
Sbjct: 178 LGPMIEHHRQFPNRVNVGFMQIVDRQHIRLRVFERGSGETLACGTGACAAVVSGIRRNRL 237

Query: 243 NRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKL 279
           +    V + GG L + W     + V MTG A+  +EG++
Sbjct: 238 DSPCLVDVRGGRLSVAWTGKTQDSVLMTGPAQSVFEGQI 276


>gi|114330524|ref|YP_746746.1| diaminopimelate epimerase [Nitrosomonas eutropha C91]
 gi|122314470|sp|Q0AIP0|DAPF_NITEC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|114307538|gb|ABI58781.1| diaminopimelate epimerase [Nitrosomonas eutropha C91]
          Length = 278

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 89/283 (31%), Positives = 132/283 (46%), Gaps = 14/283 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNIT---SDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
           + F KM G+GN  +VI+      ++T      I  L+       FDQ++++   ++   D
Sbjct: 3   LQFTKMHGLGNDFIVINAINQPASLTFLDPATIRRLADRHFGIGFDQLLIVEQAREGG-D 61

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DG EV+ CGNG RC  RF    +   + +   ET RGI+      +G +SV+
Sbjct: 62  FRYRIFNADGGEVEQCGNGARCFARFVRDYNLTDKNTIRVETARGIITPTIENNGEVSVN 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P  +   IP   +                        VS+GNPHA+  +  D+    
Sbjct: 122 MGVPQFEPAEIPFQAAQRMPVYPLQI-----GDKTIEISAVSIGNPHAVQII-PDIDLAP 175

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  +  HP+F E VN    ++     + LR +ERG G T ACG+ ACA+VV     
Sbjct: 176 VTTEGPKIEAHPLFPERVNAGFMQIIDRAHIRLRVFERGTGETLACGTGACAAVVCGILR 235

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              +  V V M GG L I W   +  V+MTG A   +EG +D+
Sbjct: 236 GLLDTTVQVAMHGGNLQIRWDGKDKPVWMTGPAITVFEGTIDL 278


>gi|218442032|ref|YP_002380361.1| diaminopimelate epimerase [Cyanothece sp. PCC 7424]
 gi|226724206|sp|B7KH06|DAPF_CYAP7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|218174760|gb|ACK73493.1| Diaminopimelate epimerase [Cyanothece sp. PCC 7424]
          Length = 281

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 90/282 (31%), Positives = 133/282 (47%), Gaps = 11/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R   + +     A+           D ++ +        D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRHGSEPMVSPEMAVEMCDRHFGIGADGVIFVLPGTS-QTDYQ 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKR----KSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ +F+    K     KS+  +T+ G++  +      ++VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAQFIAELEKTTEVGKSYRIDTLGGLMTPRLEAQEQVTVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP                            VSMGNPH I FVE D+    
Sbjct: 122 MGLPRLLGSEIPTTLVSRT--EKVIDQPIEVAGQSWLVTCVSMGNPHCITFVE-DVKSIA 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L + G     H  F +  N     V   + L +R WERG G+T ACG+ ACASVVA    
Sbjct: 179 LETIGPQFEHHVAFPQRTNTEFIEVLRPDYLKMRVWERGAGITLACGTGACASVVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            K++R  +V++ GG L I W + + HV+MTG AK+ + G  +
Sbjct: 239 GKSDRRCTVELPGGCLSIYWSETDGHVYMTGPAKRVFTGVYE 280


>gi|85373610|ref|YP_457672.1| diaminopimelate epimerase [Erythrobacter litoralis HTCC2594]
 gi|122544848|sp|Q2NBR6|DAPF_ERYLH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|84786693|gb|ABC62875.1| diaminopimelate epimerase [Erythrobacter litoralis HTCC2594]
          Length = 269

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 100/277 (36%), Positives = 142/277 (51%), Gaps = 17/277 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI-TSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           V F KM G+GN  +++D R       T+    AL+        DQ++L+     A  D  
Sbjct: 3   VSFTKMHGLGNDFIMLDARAESLPPMTAATARALADRKTGIGCDQVILLEPSDSA--DFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DG EV++CGN  R V          +        G ++A     G   VDMG P
Sbjct: 61  MRIFNADGGEVEACGNASRAVALLHGEAANVE------TSGGVIAIAPASGGARVDMGVP 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             DW+ IPLA + D +        PV    L  P  V++GNPH +FFV+ D     L + 
Sbjct: 115 RFDWEAIPLAYAMDTLSL------PVGWGELEAPAAVNVGNPHVVFFVD-DADAVPLDTM 167

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  +   P+F E +N++IA +T  ++L L  WERGVGLT ACG+ ACA+ +A+     T 
Sbjct: 168 GPGIETDPLFPERINVNIASLTGDDALKLHVWERGVGLTRACGTGACATAIAAMRRGLTG 227

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           R V+V + GG L IEW  ++H+ MTG A + + G  D
Sbjct: 228 RKVAVTLPGGTLQIEWDADDHIIMTGPAAESFRGTFD 264


>gi|325140085|gb|EGC62614.1| diaminopimelate epimerase [Neisseria meningitidis CU385]
          Length = 301

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 141/281 (50%), Gaps = 7/281 (2%)

Query: 4   SMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDA 62
           + + F KM G+GN  +VID            I   +       FDQ++++   +   VD 
Sbjct: 20  NTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDF 79

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDM 120
             RI N DGSEV  CGNG RC  RF+  +    +K    ET  G++  K + +G ++V+M
Sbjct: 80  RYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNM 139

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+    +
Sbjct: 140 GKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVECAPV 197

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G+L+  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA   L 
Sbjct: 198 RETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLG 257

Query: 241 KTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 258 LLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGEL 298


>gi|240123026|ref|ZP_04735982.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID332]
 gi|240127732|ref|ZP_04740393.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-93-1035]
 gi|268681653|ref|ZP_06148515.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID332]
 gi|268686123|ref|ZP_06152985.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-93-1035]
 gi|268621937|gb|EEZ54337.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID332]
 gi|268626407|gb|EEZ58807.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-93-1035]
          Length = 283

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 144/284 (50%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID            I A +       FDQ++++   +   
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVGFDQLLVVGCSETEG 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV  CGNG RC  RF+  +    +K    ET +GI+  K + +G ++
Sbjct: 59  VDFRYRIFNADGSEVVQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVEC 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G+ +  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVRETGSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGI 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 237 RLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|167585127|ref|ZP_02377515.1| diaminopimelate epimerase [Burkholderia ubonensis Bu]
          Length = 289

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 137/288 (47%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSSALPPLTEAQVRALANRHFGVGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+  +    ++S   E ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVLDKRLTDKRSVRVEVMKGLITLTMQENGEVVVDMG 122

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   +    + +              R    VSMGNPHA+  V+ D   Y 
Sbjct: 123 APVFEPAQVPFETAGLAGRPEGRDTLWPLDVGGATRWISTVSMGNPHAVQVVD-DAERYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G L+ +H  F++ VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLAEGPLIERHARFAQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 242 GLLDSPVTVHTHGGTLTISWDGARDEAAPLMMAGPAATVFEGEIDLAA 289


>gi|152980602|ref|YP_001354891.1| diaminopimelate epimerase [Janthinobacterium sp. Marseille]
 gi|151280679|gb|ABR89089.1| diaminopimelate epimerase [Janthinobacterium sp. Marseille]
          Length = 276

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/277 (35%), Positives = 140/277 (50%), Gaps = 7/277 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G GN  +VID      N T      L+        DQ++++   Q A VD   RI N 
Sbjct: 1   MHGAGNDFVVIDAINQAINFTPAQWQYLADRRFGVGADQMLVVEKPQAAGVDFRYRIYNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG R  VRF+T +    +++   ET+ GI+  +   +G I+VDMG PIL+ 
Sbjct: 61  DGGEVEQCGNGARAFVRFVTDKKLTDKRAIKVETMSGIIEPRLEANGQITVDMGAPILNP 120

Query: 128 KLIPL-ARSFDKMDRDRFHIGPVNHLFLRNPF-VVSMGNPHAIFFVEDDLYHYDLASFGN 185
           + +P   R           + P++     N   VVSMGNPHA+  V  D+    +   G 
Sbjct: 121 EDVPFDTRDLLCKAEGEDTLWPLDIKGETNWISVVSMGNPHAVQVV-ADVEEAPVREDGV 179

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  HP F + VN    ++     + LR +ERG G T ACG+ ACA+VVA          
Sbjct: 180 LIEHHPRFPKRVNAGFMQILDQHHIKLRVFERGAGETLACGTGACAAVVAGIRRGLLVSP 239

Query: 246 VSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           V V+  GG L+I W   ++ V MTG A   +EG+++I
Sbjct: 240 VKVQTRGGELVIAWGGRDSPVMMTGPAVTVFEGEIEI 276


>gi|209542703|ref|YP_002274932.1| Diaminopimelate epimerase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530380|gb|ACI50317.1| Diaminopimelate epimerase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 279

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 141/285 (49%), Gaps = 18/285 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F KM G+GN  +V+D R     +T   I AL+        DQ +++        D  
Sbjct: 2   MTPFHKMHGLGNDFVVVDERAERYGLTPARIAALADRHRGIGCDQFVVLQPATRDGADVL 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +R  N DG+E  +CGN  RCV   L  +  R+    +T  G+L A+ +  G ++VDMG P
Sbjct: 62  VRFFNADGTEAGACGNASRCVAALLWRQEGRRETVLQTRAGLLPARVDDAGVVTVDMGRP 121

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            LDW+ +PLAR+ D +                +P   SMGNPHA FF++D L    + + 
Sbjct: 122 ALDWRDVPLARAADTLHL----------PLAGDPAAASMGNPHATFFLDDMLDLDPVVA- 170

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL   P+F E  N+  A V S   L LR WERG GLT ACGS ACA+VV +       
Sbjct: 171 GPLLEHDPLFPERANIGFAHVRSRTELRLRVWERGSGLTLACGSGACAAVVNAVRRGLVE 230

Query: 244 RAVSVKMLGGGLLIEWH------DNNHVFMTGEAKKEWEGKLDIK 282
           R  +V M GG L + W       +  HV MTG A   + G  D +
Sbjct: 231 RTCTVGMDGGALSVSWRAQDDPGEGGHVLMTGPATVSFVGTFDPE 275


>gi|162148089|ref|YP_001602550.1| diaminopimelate epimerase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786666|emb|CAP56249.1| putative diaminopimelate epimerase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 278

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 141/285 (49%), Gaps = 18/285 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F KM G+GN  +V+D R     +T   I AL+        DQ +++        D  
Sbjct: 1   MTPFHKMHGLGNDFVVVDERAERYGLTPARIAALADRHRGIGCDQFVVLQPATRDGADVL 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +R  N DG+E  +CGN  RCV   L  +  R+    +T  G+L A+ +  G ++VDMG P
Sbjct: 61  VRFFNADGTEAGACGNASRCVAALLWRQEGRRETVLQTRAGLLPARVDDAGVVTVDMGRP 120

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            LDW+ +PLAR+ D +                +P   SMGNPHA FF++D L    + + 
Sbjct: 121 ALDWRDVPLARAADTLHL----------PLAGDPAAASMGNPHATFFLDDMLDLDPVVA- 169

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL   P+F E  N+  A V S   L LR WERG GLT ACGS ACA+VV +       
Sbjct: 170 GPLLEHDPLFPERANIGFAHVRSRTELRLRVWERGSGLTLACGSGACAAVVNAVRRGLVE 229

Query: 244 RAVSVKMLGGGLLIEWH------DNNHVFMTGEAKKEWEGKLDIK 282
           R  +V M GG L + W       +  HV MTG A   + G  D +
Sbjct: 230 RTCTVGMDGGALSVSWRAQDDPGEGGHVLMTGPATVSFVGTFDPE 274


>gi|307294712|ref|ZP_07574554.1| diaminopimelate epimerase [Sphingobium chlorophenolicum L-1]
 gi|306879186|gb|EFN10404.1| diaminopimelate epimerase [Sphingobium chlorophenolicum L-1]
          Length = 266

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 104/277 (37%), Positives = 148/277 (53%), Gaps = 16/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M  F+KM G+GN  +VID R    ++T     A++        DQ++LI +   A  D  
Sbjct: 1   MGRFSKMHGLGNDFVVIDARETALDMTEARAMAIADRHAGIGCDQLILIGNSDRA--DVS 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSEV++CGN  RCV  F       +    ET  G+L AK    G  SVDMG+P
Sbjct: 59  MRIFNSDGSEVEACGNATRCVPLF-----IGRDVLIETKAGLLDAKAVDGG-ASVDMGQP 112

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L+W  IPL+ + D +        PV+   L  P  V++GNPH IFFV+ DL   +    
Sbjct: 113 RLEWDAIPLSYAMDTL------TMPVSWEDLPAPVAVNVGNPHVIFFVD-DLDGVNFDRL 165

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+   P+F   VN++ A++     + L  WERG GLT ACG+ ACA+ VA+      +
Sbjct: 166 GPLIEHDPLFPARVNVNFAQMVGDNHIRLIVWERGAGLTRACGTGACATAVAAVRRKLVS 225

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              +V + GG L+I+W    H+ MTG A   ++G+ D
Sbjct: 226 GPTTVSLPGGDLVIDWTPGGHIMMTGPATHVFDGEAD 262


>gi|319791648|ref|YP_004153288.1| diaminopimelate epimerase [Variovorax paradoxus EPS]
 gi|315594111|gb|ADU35177.1| diaminopimelate epimerase [Variovorax paradoxus EPS]
          Length = 300

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 138/287 (48%), Gaps = 11/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +++     L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETRGTLGLSAAQYRFLADRHFGVGADQILTVRPSPAEGIDFQY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC +RF+       +     +T+ G++  +   DG ++VDMG 
Sbjct: 63  VIHNADGGEVEQCGNGARCFMRFVKEHKLTDKTQVRVQTLAGVIEPRMGADGRVTVDMGA 122

Query: 123 PILDWKLIPL------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           PI +   +P       A+     ++    +G      + +  V+SMGNPHA+  V+ ++ 
Sbjct: 123 PIFEAARVPFDTAGLDAQPDGSWEKWHLALGTRAGSPIVSVAVLSMGNPHAVQVVD-NVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G  +  HP F + VN    +V     + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 182 TAPVAEQGPQIEHHPRFPQRVNAGFMQVVDRSHIKLRVFERGAGETLACGTGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
             L      V V+  GG L IEW  +   V MTG A   +EG +D+ 
Sbjct: 242 IRLGLLESRVDVQTHGGILTIEWQGEGQPVLMTGPATTVFEGDIDVP 288


>gi|240115186|ref|ZP_04729248.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID18]
 gi|260440996|ref|ZP_05794812.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI2]
 gi|268600866|ref|ZP_06135033.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID18]
 gi|291044324|ref|ZP_06570033.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI2]
 gi|268584997|gb|EEZ49673.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID18]
 gi|291011218|gb|EFE03214.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI2]
          Length = 283

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 144/284 (50%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID            I A +       FDQ++++   +   
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVGFDQLLVVGCSETEG 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV  CGNG RC  RF+  +    +K    ET +GI+  K + +G ++
Sbjct: 59  VDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPKFMPSEIPFVPESGEGD-DACIYGVYLESGIQPVSCVNMGNPHAVIVVD-DVEC 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G+ +  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVRETGSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGI 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 237 RLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|59800783|ref|YP_207495.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA 1090]
 gi|194098069|ref|YP_002001117.1| diaminopimelate epimerase [Neisseria gonorrhoeae NCCP11945]
 gi|239998527|ref|ZP_04718451.1| diaminopimelate epimerase [Neisseria gonorrhoeae 35/02]
 gi|240013652|ref|ZP_04720565.1| diaminopimelate epimerase [Neisseria gonorrhoeae DGI18]
 gi|240016091|ref|ZP_04722631.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA6140]
 gi|240080233|ref|ZP_04724776.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA19]
 gi|240112446|ref|ZP_04726936.1| diaminopimelate epimerase [Neisseria gonorrhoeae MS11]
 gi|240117470|ref|ZP_04731532.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID1]
 gi|240120722|ref|ZP_04733684.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID24-1]
 gi|240125278|ref|ZP_04738164.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-92-679]
 gi|254493249|ref|ZP_05106420.1| diaminopimelate epimerase [Neisseria gonorrhoeae 1291]
 gi|268594387|ref|ZP_06128554.1| diaminopimelate epimerase [Neisseria gonorrhoeae 35/02]
 gi|268596384|ref|ZP_06130551.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA19]
 gi|268598514|ref|ZP_06132681.1| diaminopimelate epimerase [Neisseria gonorrhoeae MS11]
 gi|268603172|ref|ZP_06137339.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID1]
 gi|268683880|ref|ZP_06150742.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-92-679]
 gi|293399514|ref|ZP_06643667.1| diaminopimelate epimerase [Neisseria gonorrhoeae F62]
 gi|59717678|gb|AAW89083.1| putative diaminopimelate epimerase [Neisseria gonorrhoeae FA 1090]
 gi|193933359|gb|ACF29183.1| DapF [Neisseria gonorrhoeae NCCP11945]
 gi|226512289|gb|EEH61634.1| diaminopimelate epimerase [Neisseria gonorrhoeae 1291]
 gi|268547776|gb|EEZ43194.1| diaminopimelate epimerase [Neisseria gonorrhoeae 35/02]
 gi|268550172|gb|EEZ45191.1| diaminopimelate epimerase [Neisseria gonorrhoeae FA19]
 gi|268582645|gb|EEZ47321.1| diaminopimelate epimerase [Neisseria gonorrhoeae MS11]
 gi|268587303|gb|EEZ51979.1| diaminopimelate epimerase [Neisseria gonorrhoeae PID1]
 gi|268624164|gb|EEZ56564.1| diaminopimelate epimerase [Neisseria gonorrhoeae SK-92-679]
 gi|291610083|gb|EFF39205.1| diaminopimelate epimerase [Neisseria gonorrhoeae F62]
 gi|317163802|gb|ADV07343.1| diaminopimelate epimerase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 283

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 144/284 (50%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID            I A +       FDQ++++   +   
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVGFDQLLVVGCSETEG 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV  CGNG RC  RF+  +    +K    ET +GI+  K + +G ++
Sbjct: 59  VDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAKGIIFPKLSDNGMVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVEC 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G+ +  H  F E VN+   +V    ++ LR +ERGVG T ACG+ ACA+VVA  
Sbjct: 177 APVRETGSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGI 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +  + V V + GG L IEW     V MTG A+  +EG+L
Sbjct: 237 RLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGEL 280


>gi|189349037|ref|YP_001944665.1| diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
 gi|221215805|ref|ZP_03588764.1| diaminopimelate epimerase [Burkholderia multivorans CGD1]
 gi|189333059|dbj|BAG42129.1| diaminopimelate epimerase [Burkholderia multivorans ATCC 17616]
 gi|221164341|gb|EED96828.1| diaminopimelate epimerase [Burkholderia multivorans CGD1]
          Length = 289

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 137/288 (47%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T+  + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALASRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+   + +P   S      +              R    VSMGNPHA+  V+ D   Y 
Sbjct: 123 APVFAPEQVPFDASGLDGRSEGRDTLWPLEVGGRTRWISTVSMGNPHAVQVVD-DAEAYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLEEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     ++  + M G A   +EG++D+  
Sbjct: 242 GLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVFEGEIDLPA 289


>gi|284050332|ref|ZP_06380542.1| diaminopimelate epimerase [Arthrospira platensis str. Paraca]
          Length = 286

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 92/287 (32%), Positives = 138/287 (48%), Gaps = 11/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R   + I     A+           D ++      D + D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRHQSEPICTQKQAVQMCDRHFGIGADGVIFALPG-DGASDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS----FTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ +F+     +      +   T  G++  +   DG + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAKFIAELEGKTGTAIAYKINTAAGVICPQLLTDGQVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP   S + +      +         +   VSMGNPH I FV+ D+    
Sbjct: 122 MGLPRLLAAEIPTTLSENSLKV--IDVPLQVAGQPWSVTCVSMGNPHCITFVD-DVASVP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G L   HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA    
Sbjct: 179 LTEIGPLFEHHPAFPERTNTEFIEVVRPDYVKMRVWERGAGITLACGTGACASVVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGK 285
            + +R V+V++ GG L IEW   +  ++MTG A+  ++G+L     +
Sbjct: 239 QRCDRQVTVELPGGCLQIEWSATDQRLYMTGPAQAVFQGQLTFPINE 285


>gi|158335501|ref|YP_001516673.1| diaminopimelate epimerase [Acaryochloris marina MBIC11017]
 gi|189082824|sp|B0C312|DAPF_ACAM1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|158305742|gb|ABW27359.1| diaminopimelate epimerase [Acaryochloris marina MBIC11017]
          Length = 283

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 92/285 (32%), Positives = 134/285 (47%), Gaps = 16/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDA-INALSTDDNTHFDQIMLIHDFQDASVDAF 63
           V+F K +G+GN  ++ID R      +T D  +     +     D ++     +    D  
Sbjct: 3   VEFTKYQGLGNDFILIDNRHQAQPCLTPDQAVQMCDRNFGIGGDGVIFALPPE-GDTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFT-----FETIRGILVAKENRDGSISV 118
           +RI N DGSE + CGNG+RC+ RFL     +   T       T+ G +      DG + V
Sbjct: 62  MRIYNSDGSEPEMCGNGIRCLARFLAHLEGKPLQTDITYRIHTLAGTITPSLQADGLVKV 121

Query: 119 DMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMG P L  + IP  L    D +      +   +         VSMGNPH I FV+ DL 
Sbjct: 122 DMGPPFLVPQEIPTTLGEGTDPVVNQPLEVAGQSWP----VTCVSMGNPHCITFVD-DLE 176

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             D  + G     HP+F + +N    +V   + L +  WERG G T ACG+ ACA +VA 
Sbjct: 177 AIDFQTLGPQFEHHPVFPQRINTEFIQVIRPDYLKMLVWERGAGPTLACGTGACAVLVAG 236

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
               K+    ++++ GG L I W  +   VFMTG A+K + G  +
Sbjct: 237 VLTGKSQSQATIELPGGPLQIRWAGEGQSVFMTGPAEKVFTGIYE 281


>gi|167561113|ref|ZP_02354029.1| diaminopimelate epimerase [Burkholderia oklahomensis EO147]
          Length = 293

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 133/287 (46%), Gaps = 11/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPALTDAQVRALADRHFGIGADQLLLVEKPTVEGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+             E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDNGLTDKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S  +  R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLEGRREGADTLWPLDVNGATRWISVVSMGNPHAVQIVD-DAEAFP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + +HP F++ VN    +  S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLVDGPAIERHPRFAQRVNAGFMQRVSRREVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIK 282
            + +  V+V   GG L I W     +N  + M G A   +EG +D+ 
Sbjct: 242 GQLDSPVTVHTHGGTLTISWDGARDENAPLLMAGPATTVFEGVIDLS 288


>gi|126440065|ref|YP_001057250.1| diaminopimelate epimerase [Burkholderia pseudomallei 668]
 gi|166224251|sp|A3N4H9|DAPF_BURP6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|126219558|gb|ABN83064.1| diaminopimelate epimerase [Burkholderia pseudomallei 668]
          Length = 289

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 133/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+       + S   E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVVSMGNPHAVQIVD-DAEAFA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + + P F + VN    +V S   ++LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VRVDGPAIERDPRFPQRVNAGFMQVVSRHEVNLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 242 GRLDSPVTVHTHGGTLTISWNGARDERAPLMMAGPATTVFEGVIELPA 289


>gi|332969969|gb|EGK08969.1| diaminopimelate epimerase [Kingella kingae ATCC 23330]
          Length = 282

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 140/281 (49%), Gaps = 7/281 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID         ++ I   +       FDQ++++   Q   VD   
Sbjct: 4   LKFSKMHGLGNDFMVIDAINQTFEPRAEQIAQWANRYTGIGFDQLLVVEKAQSDDVDFRY 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSF--TFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+T +          ET RGI+  + N DG ++V+MG+
Sbjct: 64  RIFNADGGEVEQCGNGARCFVKFVTEQGLTDKPEIVVETARGIIKPRLNDDGLVTVNMGQ 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      +P      +   D+     VN +      +VSMGNPHA+  +  D+    + +
Sbjct: 124 PRFAPDDVPFVLRSGEKADDK-TFIVVNGIDSAEMSLVSMGNPHAV-MLVGDVATAPVEN 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           +GN L  H  F   VN+   ++   + + LR +ERG G T ACG+ ACA+VV+   L   
Sbjct: 182 WGNALQNHARFPARVNVGFMQIVDAQHIKLRVFERGSGETQACGTGACAAVVSGVRLSLL 241

Query: 243 --NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
                + V + GG L I W D   V MTG A   + G++ +
Sbjct: 242 TAGEPIRVSLPGGDLYISWQDGGDVMMTGPAVTVFTGEIAV 282


>gi|126740999|ref|ZP_01756682.1| diaminopimelate epimerase [Roseobacter sp. SK209-2-6]
 gi|126717925|gb|EBA14644.1| diaminopimelate epimerase [Roseobacter sp. SK209-2-6]
          Length = 284

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 95/286 (33%), Positives = 142/286 (49%), Gaps = 17/286 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQ-DASVDAF 63
           + F KM G+GN  +V+D R    ++T      ++       FDQ+ LI   + ++  DA 
Sbjct: 12  LPFMKMHGLGNDFVVVDARHLKLDVTPALAKGIAHRRFGIGFDQLTLIESPKANSPADAH 71

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +   N DGS   +CGN  RCV R L +   +      T RG L+A ++ DG  SV+MG+P
Sbjct: 72  LLFYNADGSTSAACGNATRCVARHLMAESGKSELHLTTDRGDLLAHDSGDGLTSVNMGQP 131

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W  +PLA   D ++                P    MGNPH  FFVE +     L  F
Sbjct: 132 QLLWDQVPLAEEVDTLEL----------PIEGGPTATGMGNPHCTFFVE-NADLIPLEEF 180

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G     HP++ E  N+ +A +   + + +R WERGVG+T A GS++CA+ VA+     T 
Sbjct: 181 GPRYEHHPLYPERTNVQVAHIVGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTG 240

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
           R V V + GG L I+W ++  V+MTG       G     T ++++ 
Sbjct: 241 RKVQVDLDGGTLWIDWREDG-VWMTGPTMHVSSGSF---TREFLES 282


>gi|299533135|ref|ZP_07046520.1| diaminopimelate epimerase [Comamonas testosteroni S44]
 gi|298718912|gb|EFI59884.1| diaminopimelate epimerase [Comamonas testosteroni S44]
          Length = 296

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 89/294 (30%), Positives = 136/294 (46%), Gaps = 13/294 (4%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M   M + F KM+G GN  +V+D       +++     L+        DQI+ +      
Sbjct: 1   MCGIMQIRFTKMQGAGNDFVVLDETQARLGLSTAQYRYLANRHFGVGADQILTVRPAPAE 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI 116
            VD    I N DG EV+ CGNG RC  R++  +    +     +T+ G++  + + +G +
Sbjct: 61  GVDFEYVIHNADGGEVEQCGNGARCFARYVHDKGLTDKSVIRVQTLSGVIAPEIHGNGRV 120

Query: 117 SVDMGEPILDWKLIPLARS------FDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           +VDMG P LD   +P               +    +             VSMGNPHA+  
Sbjct: 121 TVDMGAPQLDPAKVPFTTDGLQAETLGSTQKWPLTLDTPLQPATVWIAAVSMGNPHAVQL 180

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V+ D+    +   G L+  H  F + VN    ++ +   + LR +ERG G T ACG+ AC
Sbjct: 181 VD-DVDAALVGLHGPLIENHARFPQRVNAGFMQILNRGEVRLRVYERGAGETLACGTGAC 239

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
           A+VVA       ++ V V   GG L IEW     + V MTG A+  +EG++DI 
Sbjct: 240 AAVVAGIGWGLLDQRVDVHTRGGLLTIEWTGGAHDRVRMTGPAEFVFEGQIDIP 293


>gi|238022271|ref|ZP_04602697.1| hypothetical protein GCWU000324_02178 [Kingella oralis ATCC 51147]
 gi|237866885|gb|EEP67927.1| hypothetical protein GCWU000324_02178 [Kingella oralis ATCC 51147]
          Length = 314

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 99/282 (35%), Positives = 137/282 (48%), Gaps = 9/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID         S  I A +       FDQ++L+   Q  + D   
Sbjct: 32  LKFSKMHGLGNDFMVIDGINQVFTPNSAHIAAWANRHFGIGFDQLLLVERAQTPAADFRY 91

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI N DG EVQ CGNG RC  +F+  +          ET  GI+  +   +G ++VDMG 
Sbjct: 92  RIFNADGGEVQQCGNGARCFAKFVYDKGLTDKTHIAVETAAGIIKPQIQPNGLVTVDMGA 151

Query: 123 PILDWKLIPLARSFDKMDRD---RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           P +    IP     D  +        I   N        +VSMGNPHA+  V+ D     
Sbjct: 152 PRVLPDDIPFRLPADGSETAGALTHQIVWDNRQPAIAVSLVSMGNPHAVLRVD-DTKTAP 210

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +A  G  L +HP F E VN+   ++     + LR +ERG G T ACG+ ACA+VVA    
Sbjct: 211 VAEIGAALQQHPQFPERVNVGFMQLLDPTHIALRVFERGAGETLACGTGACAAVVAGMRQ 270

Query: 240 HKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                   V V + GG L ++WH  +HV MTGEA   ++G+L
Sbjct: 271 GWLAAGETVQVSLRGGDLFVQWHSGSHVMMTGEAVWVFDGEL 312


>gi|264680264|ref|YP_003280174.1| diaminopimelate epimerase [Comamonas testosteroni CNB-2]
 gi|262210780|gb|ACY34878.1| diaminopimelate epimerase [Comamonas testosteroni CNB-2]
          Length = 296

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 89/294 (30%), Positives = 136/294 (46%), Gaps = 13/294 (4%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M   M + F KM+G GN  +V+D       +++     L+        DQI+ +      
Sbjct: 1   MCGIMQIRFTKMQGAGNDFVVLDETQARLGLSTAQYRYLANRHFGVGADQILTVRPAPAE 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI 116
            VD    I N DG EV+ CGNG RC  R++  +    +     +T+ G++  + + +G +
Sbjct: 61  GVDFEYVIHNADGGEVEQCGNGARCFARYVHDKGLTDKSVIRVQTLSGVIAPEIHGNGRV 120

Query: 117 SVDMGEPILDWKLIPLARS------FDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           +VDMG P LD   +P               +    +             VSMGNPHA+  
Sbjct: 121 TVDMGAPQLDPAKVPFTNDGLQAETLGSTQKWPLTLDTPLQPATVWIAAVSMGNPHAVQL 180

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V+ D+    +   G L+  H  F + VN    ++ +   + LR +ERG G T ACG+ AC
Sbjct: 181 VD-DVDAALVGLHGPLIENHARFPQRVNAGFMQILNRSEVRLRVYERGAGETLACGTGAC 239

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
           A+VVA       ++ V V   GG L IEW     + V MTG A+  +EG++DI 
Sbjct: 240 AAVVAGIGWGLLDQRVDVHTRGGLLTIEWTGGAHDRVRMTGPAEFVFEGQIDIP 293


>gi|294012736|ref|YP_003546196.1| diaminopimelate epimerase [Sphingobium japonicum UT26S]
 gi|292676066|dbj|BAI97584.1| diaminopimelate epimerase [Sphingobium japonicum UT26S]
          Length = 266

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 104/277 (37%), Positives = 149/277 (53%), Gaps = 16/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M  F+KM G+GN  +VID R    ++T     A++        DQ++LI +   A  D  
Sbjct: 1   MGRFSKMHGLGNDFVVIDARESTLDMTEARAMAIADRHAGIGCDQLILIGNSDRA--DVS 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSEV++CGN  RCV  F+      +    ET  G+L AK    G  SVDMG+P
Sbjct: 59  MRIFNSDGSEVEACGNATRCVPLFV-----GRDVLIETKAGLLDAKAVDGG-ASVDMGQP 112

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L+W  IPLA + D +        PV+   L  P  V++GNPH IFF++ DL   +    
Sbjct: 113 RLEWDAIPLAYAMDTL------TMPVSWEDLPAPVAVNVGNPHVIFFLD-DLDGVNFDRL 165

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+   P+F   VN++ A++     + L  WERG GLT ACG+ ACA+ VA+      +
Sbjct: 166 GPLIEHDPLFPARVNVNFAQIAGNNHIRLVVWERGAGLTRACGTGACATAVAAVRRKLAS 225

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              +V + GG L+I+W    H+ MTG A   ++G+ D
Sbjct: 226 GPTTVSLPGGDLVIDWTPGGHIMMTGPATHVFDGEAD 262


>gi|315497312|ref|YP_004086116.1| diaminopimelate epimerase [Asticcacaulis excentricus CB 48]
 gi|315415324|gb|ADU11965.1| diaminopimelate epimerase [Asticcacaulis excentricus CB 48]
          Length = 280

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 153/280 (54%), Gaps = 10/280 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIR 65
            F KM G+GN  +V+D R      ++  + A         FDQ++ I     AS DAF+R
Sbjct: 4   PFLKMNGLGNDFVVVDARQTPFRPSAAQVKAWGDRASGIGFDQLIAIEGA--ASGDAFMR 61

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD----GSISVDMG 121
           + N DG  V++CGN +RCV  +L           +T+ G   AK        G +SVDMG
Sbjct: 62  VWNSDGGPVETCGNALRCVGWYLDRDAPGNDLHIDTLGGATAAKVLERDAKTGMVSVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L W  IPL+   +    +   +GP++      P  VSMGNPH +FFVE D+   D+ 
Sbjct: 122 APRLAWTQIPLSEEMNTERLE-LQVGPIDAPLYHTPCAVSMGNPHVVFFVE-DVAAVDVE 179

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G+L+  HP+F EGVN+  A+V    ++ +R WERG G+T ACG+ ACA++VA      
Sbjct: 180 RTGSLIENHPLFPEGVNVEFAQVIDRNTIRMRVWERGAGITKACGTGACATLVACARRGL 239

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
           ++R  +V M GG L I W   ++HV MTG  + E+EG+L+
Sbjct: 240 SDRHATVIMDGGPLHILWRQADDHVIMTGPVEVEFEGQLN 279


>gi|291567988|dbj|BAI90260.1| diaminopimelate epimerase [Arthrospira platensis NIES-39]
          Length = 295

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 140/285 (49%), Gaps = 12/285 (4%)

Query: 3   SSM-VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDAS 59
           S M ++F K  G+GN  ++ID R   + I     A+           D ++      D +
Sbjct: 7   SVMAIEFTKYHGLGNDFILIDNRHQSEPICTQKQAVQMCDRHFGIGADGVIFALPG-DGA 65

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS----FTFETIRGILVAKENRDGS 115
            D  +RI N DGSE + CGNG+RC+ +F+     +      +   T  G++  +   DG 
Sbjct: 66  SDYTMRIFNSDGSEPEMCGNGIRCLAKFIAELEGKTGTAIAYKINTAAGVICPQLLTDGQ 125

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMG P L    IP   S + +      +         +   VSMGNPH I FV+ D+
Sbjct: 126 VKVDMGLPRLLAAEIPTTLSENSLKV--IDVPLQVAGQPWSVTCVSMGNPHCITFVD-DV 182

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
               L   G L   HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA
Sbjct: 183 ASVPLTEIGPLFEHHPAFPERTNTEFIEVVRPDYVKMRVWERGAGITLACGTGACASVVA 242

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
                + +R V+V++ GG L IEW   +  ++MTG A++ ++G+L
Sbjct: 243 GVLTQRCDRQVTVELPGGCLQIEWSATDQRLYMTGPAQRVFQGQL 287


>gi|59713091|ref|YP_205867.1| diaminopimelate epimerase [Vibrio fischeri ES114]
 gi|75431420|sp|Q5E1W7|DAPF_VIBF1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|59481192|gb|AAW86979.1| diaminopimelate epimerase [Vibrio fischeri ES114]
          Length = 276

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 96/279 (34%), Positives = 139/279 (49%), Gaps = 10/279 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCLTQNIFFSPDLIRRLADRHRGIGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +    + S +  T +G ++ K   D  I+V+MGEP
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKTSISVSTKKGKMILKVEDDDQITVNMGEP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
           + +   IP          ++ ++  V+   L +   VSMGNPH    V DD+  YD+  +
Sbjct: 124 VFEPNKIPFKA----TQAEKTYLLRVDDKTLFSG-AVSMGNPHC-VTVVDDVDAYDVDKY 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+  H  F E VN    ++ S   + LR +ERG G T ACGS AC +V          
Sbjct: 178 GQLVESHERFPERVNAGFMQIISPNEVKLRVYERGAGETQACGSGACGAVAVGIMQELLG 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             V V + GG L I W      +FMTG A   ++G+L I
Sbjct: 238 EEVKVSLPGGDLHIVWQGPGKPLFMTGPATHVYDGQLSI 276


>gi|121997990|ref|YP_001002777.1| diaminopimelate epimerase [Halorhodospira halophila SL1]
 gi|166224261|sp|A1WWB3|DAPF_HALHL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|121589395|gb|ABM61975.1| diaminopimelate epimerase [Halorhodospira halophila SL1]
          Length = 287

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 93/284 (32%), Positives = 139/284 (48%), Gaps = 10/284 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KME +GN  +V+D      ++T + I  L+        DQ+++       + D   
Sbjct: 1   MRFTKMEALGNDFVVLDGIRQRLHLTPETIRTLADRRRGVGCDQLLIAEPPAHIAADVRY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG+EV+ CGNG+RC+ RFL             ET   I  A+   DG +SVDMG 
Sbjct: 61  RIFNADGTEVEHCGNGVRCLARFLVDEGLAAPGVLRIETDGRITEAEPRDDGQVSVDMGP 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L+   IP      +             +       VSMGNPHA+  V+ D+    +A 
Sbjct: 121 PELEPARIPFQAPVRQEAYRLATSRGEQTIG-----AVSMGNPHAVLRVD-DMTGAPVAE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  + +HP F   VN+    V + + + LR +ERGVG T ACG+ ACA+VVA       
Sbjct: 175 LGPEIERHPRFPRRVNVGFMEVCTRDRIRLRVFERGVGETPACGTGACAAVVAGRLRDWL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKTGK 285
           +  V+V++ GG L+I W      V+MTG A+  + G++++    
Sbjct: 235 DAPVTVELTGGVLVIHWLGPGRSVWMTGPARTVFRGEIELPASA 278


>gi|83719190|ref|YP_440730.1| diaminopimelate epimerase [Burkholderia thailandensis E264]
 gi|257140621|ref|ZP_05588883.1| diaminopimelate epimerase [Burkholderia thailandensis E264]
 gi|123538287|sp|Q2T269|DAPF_BURTA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|83653015|gb|ABC37078.1| diaminopimelate epimerase [Burkholderia thailandensis E264]
          Length = 289

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 131/288 (45%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTDALVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+             E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTDKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDTSGLDGRREGADTLWPLPVNGATRWISVVSMGNPHAVQIVD-DAEAFP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  + + P F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLADGPAIERDPRFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +D+  
Sbjct: 242 GQLDSPVTVHTHGGTLTISWDGARDERAPLMMAGPATTVFEGVIDLPA 289


>gi|85060324|ref|YP_456026.1| diaminopimelate epimerase [Sodalis glossinidius str. 'morsitans']
 gi|123518670|sp|Q2NQF4|DAPF_SODGM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|84780844|dbj|BAE75621.1| diaminopimelate epimerase [Sodalis glossinidius str. 'morsitans']
          Length = 274

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 136/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  LS       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPEMIRRLSDRHCGVGFDQLLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF  + +   ++     T  G +V     D S+ V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVRMKNLTNKRDIHVSTQTGRMVLTVTEDDSVRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D + +    +        + +       L    VVSMGNPH +  V+  + +  +A+
Sbjct: 121 PNFDPQQVLFRAA---RVEKTYIMRAAEQTVLCG--VVSMGNPHCVIAVD-SVDNAPVAT 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V +   + LR +ERG G T ACGS ACA+V       + 
Sbjct: 175 LGPVLESHERFPERANIGFMQVLNRGHIRLRVYERGAGETQACGSGACAAVAVGISQGQL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
              V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 AEQVQVELTGGRLAISWRGPGHPLYMTGPATHIYDGFIHL 274


>gi|126730998|ref|ZP_01746807.1| diaminopimelate epimerase [Sagittula stellata E-37]
 gi|126708714|gb|EBA07771.1| diaminopimelate epimerase [Sagittula stellata E-37]
          Length = 279

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 99/287 (34%), Positives = 146/287 (50%), Gaps = 18/287 (6%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASV 60
           +++ + F KM G+GN  +VID R     +T +    L+       FDQ+ LI      + 
Sbjct: 8   RATGLPFMKMHGLGNDFVVIDARARSVQVTPELAMRLADRHMGVGFDQLALIEPG--GNA 65

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DA +  +N DGS   +CGN  RC+ R L +   +      T  G L A +  +G  SV+M
Sbjct: 66  DAHLVFLNSDGSTSAACGNATRCIARHLMTETGKDRLVLTTDHGALQAVDTGNGMTSVNM 125

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P+LDW+ IPLA   D +                +P   SMGNPH  FFV  D    DL
Sbjct: 126 GPPVLDWQNIPLASEVDTLHL----------PIDGDPVATSMGNPHCTFFV-ADAEAVDL 174

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
             FG  +  HP++ +  N+ +A +   + L +R WERG GLT A GS++CA+ VA+    
Sbjct: 175 TDFGPRIEHHPLYPQRTNVQVATLIGPDHLRMRVWERGAGLTLASGSSSCATAVAAARRG 234

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWI 287
            T RAV + + GG L ++W ++  V+MTG     + G L   T +W+
Sbjct: 235 LTGRAVHIDLDGGTLHVDWREDG-VWMTGPTSHVFTGTL---TAEWL 277


>gi|296114904|ref|ZP_06833552.1| diaminopimelate epimerase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978610|gb|EFG85340.1| diaminopimelate epimerase [Gluconacetobacter hansenii ATCC 23769]
          Length = 274

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 142/286 (49%), Gaps = 18/286 (6%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++S   F KM G+GN  +++D R    ++T   I ALS        DQ +++       
Sbjct: 1   MKTS---FYKMHGLGNDFVIMDERASRLDLTPARIAALSDRQRGIGCDQFVVLRPACRDG 57

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
            D F+R  N DG+E  +CGN  RCV   +       +   +T  G+L  +   DG I+VD
Sbjct: 58  ADVFVRFFNADGTESGACGNASRCVAALIGDERGTMAPVLQTRAGLLPTRIAGDGVITVD 117

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHA-IFFVEDDLYHY 178
           MG P LDW+ IPL R  D +    +           +P   SMGNPHA +F    D    
Sbjct: 118 MGPPALDWRDIPLVREVDTLHLPLW----------GDPAAASMGNPHATVFLDVGDTTDP 167

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G  +   P+F E  N+  A+V + + + LR WERG GLT ACGS ACA+VV +  
Sbjct: 168 RVR--GPAMECDPLFPERANIGFAQVRARDDMRLRVWERGAGLTLACGSGACAAVVNAVR 225

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKT 283
                R   V+M GG L + W + + HV M+G A   +EG + + T
Sbjct: 226 RGLVGRTCVVEMDGGVLSVTWRESDGHVLMSGPAVMSFEGTVALDT 271


>gi|206558908|ref|YP_002229668.1| diaminopimelate epimerase [Burkholderia cenocepacia J2315]
 gi|198034945|emb|CAR50817.1| diaminopimelate epimerase [Burkholderia cenocepacia J2315]
          Length = 309

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 135/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTDAQVRALANRHFGIGADQLLLVEKPTVDGADFK 82

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 83  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMG 142

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   +     ++              R    VSMGNPHA+  V+ D   Y 
Sbjct: 143 APVFAPAQVPFDAAGLDGRQEGRDTLWPLDVGGATRWISTVSMGNPHAVQVVD-DAEAYP 201

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 202 VLEEGPLIERHARFPQRVNAGFMQIVSRREVKLRVYERGAGETLACGTGACAAVAAGIRR 261

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 262 GLLDSPVTVHTHGGTLTIGWDGARDEAAALMMAGPATTVFEGEIDLNA 309


>gi|168703359|ref|ZP_02735636.1| diaminopimelate epimerase [Gemmata obscuriglobus UQM 2246]
          Length = 280

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 86/283 (30%), Positives = 131/283 (46%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL--STDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G+GN  + +D           A+             D ++LI   + A  DA 
Sbjct: 1   MQFTKMHGLGNDYVYVDCVRQKPPADPAALARAVSDRHFGIGSDGLILICPSEKA--DAR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKEN------RDGSIS 117
           +R+ N DGSE + CGNG+RCV +F+  R        +   G  V   +      +   + 
Sbjct: 59  MRMFNADGSESEMCGNGVRCVAKFVHDRGIATKPRLKIETGRGVLTLDLEVRAGKAERVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MGEPIL+   IP           +                VSMGNPHA+ + + D+  
Sbjct: 119 VNMGEPILESAKIPTTLPGAPPVNAKLVCAA---PTPWEVTCVSMGNPHAVIYCD-DVAK 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            +L   G  L   P F   +N+   +V S   + +RTWERG G+T ACG+ AC+  VA  
Sbjct: 175 VELEQVGPKLEHAPEFPRRINVHFVQVHSPNEVTMRTWERGSGVTLACGTGACSVCVAGV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             H+T R +   + GG L +EW + ++ V+MTG A + + G+ 
Sbjct: 235 LTHRTGRKLLAHLPGGDLELEWSETDNCVYMTGPATEVFTGEW 277


>gi|126734339|ref|ZP_01750086.1| Diaminopimelate epimerase [Roseobacter sp. CCS2]
 gi|126717205|gb|EBA14069.1| Diaminopimelate epimerase [Roseobacter sp. CCS2]
          Length = 281

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 98/281 (34%), Positives = 147/281 (52%), Gaps = 15/281 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
           SS + F KM G+GN  +V+D RG    +      A++       FDQ+ ++   +    D
Sbjct: 15  SSFLPFMKMHGLGNDFVVVDERGITPRVDKAVAVAIADRHRGVGFDQLAVM--SETPDAD 72

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
             +   N DGS+  +CGN  RC+ R +  +    + T +T RGIL AK+  +G  SV+MG
Sbjct: 73  VRLVFWNSDGSQAGACGNATRCIARHVMDQTGAAALTLKTERGILQAKDAGNGLTSVNMG 132

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P LDW+ +PLA + D ++                P    MGNPH  FFV  D    DLA
Sbjct: 133 QPQLDWQHVPLAHAMDTLEL----------PIKGAPTATGMGNPHCTFFV-YDAEAIDLA 181

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  L  HP++ E  N+  A +     L +R WERGVG+T A GS++CA+ VA+     
Sbjct: 182 TKGAELEHHPLYPERTNVQFASLIGPNHLRMRVWERGVGITLASGSSSCATAVAAARRGL 241

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
           T+R V++ + GG L I W D+  V+MTG     ++G+  + 
Sbjct: 242 TDRDVTIDLDGGTLQISWRDDG-VWMTGPTAHVFDGQWRLS 281


>gi|120609493|ref|YP_969171.1| diaminopimelate epimerase [Acidovorax citrulli AAC00-1]
 gi|166224234|sp|A1TKA9|DAPF_ACIAC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|120587957|gb|ABM31397.1| diaminopimelate epimerase [Acidovorax citrulli AAC00-1]
          Length = 292

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 133/288 (46%), Gaps = 12/288 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGRLGLTPAQYRYLADRHFGVGADQILTVRPSPAEGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC  R++  +      T   +T+ G++  +   DG ++VDMG 
Sbjct: 63  VIHNADGGEVEQCGNGARCFARYVRDKGLTDRDTIRVQTLAGVIAPRLTPDGRVTVDMGR 122

Query: 123 PILDWKLIPLARSF------DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P  D   +P   S                +G      + +  VVSMGNPHA+  V  D+ 
Sbjct: 123 PRFDPAEVPFDASGLAPAARGAGQTWPLALGAGADAQVVDVAVVSMGNPHAVQLVG-DVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  H  F + VN    ++     + LR +ERG G T ACG+ ACA+V A 
Sbjct: 182 AAPVAHTGPLIEGHARFPQRVNAGYLQIEDRARVRLRVYERGAGETLACGTGACAAVAAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
             L   +  V V+  GG L I W  +    VFMTG A   +EG++DI 
Sbjct: 242 IRLGLLDARVDVRTRGGLLTIAWSGDPSESVFMTGPATTVFEGQIDIP 289


>gi|167835021|ref|ZP_02461904.1| diaminopimelate epimerase [Burkholderia thailandensis MSMB43]
          Length = 289

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 134/289 (46%), Gaps = 13/289 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+  R          E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDRGLTDEASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPL---ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
            P+ +   +P         +   D     PVN    R   VVSMGNPHA+  V+ D    
Sbjct: 123 APVFEPARVPFDASGLEGRREGADTLWPLPVNG-ATRWISVVSMGNPHAVQIVD-DAKAA 180

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            + + G  + +HP F + VN    ++ S   ++LR +ERG G T ACG+ ACA+V A   
Sbjct: 181 PVLADGPAIERHPRFPQRVNAGFMQIVSRHEVNLRVYERGAGETLACGTGACAAVAAGIR 240

Query: 239 LHKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
             + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 241 RGQLDSPVTVHTHGGTLTISWDGARDERAPLKMAGPATTVFEGVIELPA 289


>gi|221065121|ref|ZP_03541226.1| Diaminopimelate epimerase [Comamonas testosteroni KF-1]
 gi|220710144|gb|EED65512.1| Diaminopimelate epimerase [Comamonas testosteroni KF-1]
          Length = 296

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 90/294 (30%), Positives = 138/294 (46%), Gaps = 13/294 (4%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M   M + F KM+G GN  +V+D       +++     L+        DQI+ +      
Sbjct: 1   MCGIMQIRFTKMQGAGNDFVVLDETQARLGLSAAQYRYLANRHFGVGADQILTVRPAPSE 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSI 116
            VD    I N DG EV+ CGNG RC  R++  R    +     +T+ G++  + + +G +
Sbjct: 61  GVDFEYVIHNADGGEVEQCGNGARCFARYVHDRGLTDKSVIRVQTLSGVIAPEIHANGRV 120

Query: 117 SVDMGEPILDWKLIPLARS------FDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF 170
           +VDMG P LD   +P +             +    +             VSMGNPHA+  
Sbjct: 121 TVDMGAPQLDPVKVPFSTEGLQAETLGSAQKWPLTLDTPVQPATVWIAPVSMGNPHAVQL 180

Query: 171 VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
           V+ D+    +   G L+  H  F + VN    ++ +   ++LR +ERG G T ACG+ AC
Sbjct: 181 VD-DVNAAAVEVHGPLIESHVRFPQRVNAGFMQIVNRGEVNLRVYERGAGETLACGTGAC 239

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           A+VVA       ++ V V   GG L IEW     + V MTG A+  +EG++DI 
Sbjct: 240 AAVVAGIGWGLLDQRVDVHTRGGLLTIEWAGAAQDRVRMTGPAEFVFEGQIDIP 293


>gi|296113697|ref|YP_003627635.1| diaminopimelate epimerase [Moraxella catarrhalis RH4]
 gi|295921391|gb|ADG61742.1| diaminopimelate epimerase [Moraxella catarrhalis RH4]
 gi|326562437|gb|EGE12756.1| diaminopimelate epimerase [Moraxella catarrhalis 7169]
 gi|326562806|gb|EGE13101.1| diaminopimelate epimerase [Moraxella catarrhalis 46P47B1]
 gi|326563473|gb|EGE13736.1| diaminopimelate epimerase [Moraxella catarrhalis 103P14B1]
 gi|326569145|gb|EGE19207.1| diaminopimelate epimerase [Moraxella catarrhalis BC1]
 gi|326570631|gb|EGE20667.1| diaminopimelate epimerase [Moraxella catarrhalis BC7]
 gi|326571338|gb|EGE21355.1| diaminopimelate epimerase [Moraxella catarrhalis BC8]
 gi|326572967|gb|EGE22946.1| diaminopimelate epimerase [Moraxella catarrhalis CO72]
 gi|326573783|gb|EGE23740.1| diaminopimelate epimerase [Moraxella catarrhalis 101P30B1]
 gi|326574795|gb|EGE24729.1| diaminopimelate epimerase [Moraxella catarrhalis O35E]
          Length = 299

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 95/299 (31%), Positives = 142/299 (47%), Gaps = 13/299 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+       FDQ++++       +D  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRMTLTPELIRLLADRRIGVGFDQLLIVEPPSRPDIDFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC   F+ +R    ++    ET  GI++   NR G + VDMG
Sbjct: 62  YRIFNADGSEVSQCGNGARCFASFVQARKLSFKQRLRVETSSGIIILSTNRYGWVQVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP            + +           +V ++GNPHAI  V+D +   D+ 
Sbjct: 122 KPKFEPDQIPFTPKTITKVGRAYRLDVDGIPV--QLYVANIGNPHAIIKVDD-VLDADVD 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  H  F E VN++  +V +   + +R +ERGVG T ACG+ ACASV        
Sbjct: 179 RLGKLIESHEAFPERVNVNFVQVINQRHVRIRVYERGVGETQACGTGACASVATGIREGW 238

Query: 242 TNRAVSVK--MLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI-----KTGKWIKKNEDD 293
            +  V ++  + GG L I W D   + MTG     +EG           G  +  N DD
Sbjct: 239 LDEGVDIRAQLYGGSLAIRWQDGYSLIMTGPTAFVYEGVFSPDGLAASAGIKLDPNADD 297


>gi|167568331|ref|ZP_02361205.1| diaminopimelate epimerase [Burkholderia oklahomensis C6786]
          Length = 293

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 134/287 (46%), Gaps = 11/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPALTDAQVRALADRHFGIGADQLLLVEKPTVEGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+             E   G+++     +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDNGLTDKASVRVEVKHGVIMLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S  +  R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLEGRREGADTLWPLDVNGATRWISVVSMGNPHAVQIVD-DAEAFP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + +HP F++ VN    +  S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLVDGPAIERHPRFAQRVNAGFMQRVSRREVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIK 282
            + +  V+V   GG L I W     +N  + M G A   +EG +D+ 
Sbjct: 242 GQLDSPVTVHTHGGTLTISWDGARDENAPLLMAGPATTVFEGVIDLS 288


>gi|254188135|ref|ZP_04894647.1| diaminopimelate epimerase [Burkholderia pseudomallei Pasteur 52237]
 gi|157935815|gb|EDO91485.1| diaminopimelate epimerase [Burkholderia pseudomallei Pasteur 52237]
          Length = 289

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 133/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+       + S   E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVREHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVVSMGNPHAVQIVD-DAEAFA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + + P F + VN    ++ S   ++LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 242 GRLDSPVTVHTHGGTLTISWNGACDERAPLMMAGPATTVFEGVIELPA 289


>gi|148261481|ref|YP_001235608.1| diaminopimelate epimerase [Acidiphilium cryptum JF-5]
 gi|166224235|sp|A5G1F7|DAPF_ACICJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146403162|gb|ABQ31689.1| diaminopimelate epimerase [Acidiphilium cryptum JF-5]
          Length = 277

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 103/275 (37%), Positives = 139/275 (50%), Gaps = 10/275 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIR 65
            F KM G GN  +V+D R    ++   A   +         DQI+LI   +D    AF+R
Sbjct: 6   PFLKMHGAGNDFVVLDARAHPLDLAPAAAARIADRHRGVGCDQIILIE--RDDGAAAFMR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I+N DGSE  +CGN  RCV   L      +  T  T  G+L A+      + VDMG P L
Sbjct: 64  ILNADGSESGACGNATRCVAALLAGETGARRLTIRTNAGLLPAEIKGPTLVEVDMGAPKL 123

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W+ IPLA   D +              ++NP   SMGNPHA FFV+ DL H  + + G 
Sbjct: 124 GWEDIPLAEPADTLSLRLAL------GPVQNPAACSMGNPHATFFVD-DLTHLQIETIGP 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            L    +F E  N+  AR+ + + + LR WERG GLT ACGS ACA++V +       R 
Sbjct: 177 KLEHARLFPERANIGFARIDAPDRIRLRVWERGAGLTLACGSGACAALVNAHRRGLAARR 236

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             ++M GG L + W D+ HV M G     +EG+LD
Sbjct: 237 AEIEMDGGTLTLTWRDDGHVLMEGPVALVFEGELD 271


>gi|220931996|ref|YP_002508904.1| Diaminopimelate epimerase [Halothermothrix orenii H 168]
 gi|254767107|sp|B8CX90|DAPF_HALOH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219993306|gb|ACL69909.1| Diaminopimelate epimerase [Halothermothrix orenii H 168]
          Length = 284

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 90/286 (31%), Positives = 141/286 (49%), Gaps = 11/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  ++++     D + +  A        +   D ++++   +    D  +
Sbjct: 3   LSFTKMHGTGNDFIMVNGSNYPDLDFSKLARQLCRRHFSIGADGLIIVLPPESVEHDFRM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGS----ISV 118
           RI N DGSE + CGNG+RC   +    +   R     ET+ GI+  +          I V
Sbjct: 63  RIFNADGSEAEMCGNGIRCFAHYLRENNLTTRDVLKIETLAGIITPEIVSYNGDKSLIKV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG P    + IP+    +      F +   N     N   VSMGNPH I FVE D+   
Sbjct: 123 NMGRPHFKSEEIPVNIEDELDYVKNFPLKIGNKKLNIN--CVSMGNPHTIIFVE-DVNQI 179

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            ++++G  +  +P+F +  N+   ++ S + + +R WERG G+T ACG+ ACASVVA   
Sbjct: 180 PVSTWGQEIEHNPLFPQKTNVEFIQIQSEDEIIMRVWERGSGITLACGTGACASVVAGIK 239

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
                  V+V + GG L IEW + + VFMTG A+  + GK+ I+ G
Sbjct: 240 NGLLKNMVTVHLPGGDLNIEWQEQD-VFMTGPAESVYTGKIVIQEG 284


>gi|330993222|ref|ZP_08317159.1| Diaminopimelate epimerase [Gluconacetobacter sp. SXCC-1]
 gi|329759773|gb|EGG76280.1| Diaminopimelate epimerase [Gluconacetobacter sp. SXCC-1]
          Length = 274

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 104/280 (37%), Positives = 135/280 (48%), Gaps = 13/280 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M  F KM G+GN  +V+D R    ++T   I AL         DQ + +        D F
Sbjct: 2   MTGFLKMHGLGNDFVVVDERTHRHDLTPARIAALCDRHTGIGCDQFVTLRPACAEGADVF 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +R  N DGSE  +CGN  RCV   +     R     +T  G+L A   R G ++VDMG P
Sbjct: 62  VRFFNADGSESGACGNASRCVADLVARESGRAQVGLQTRAGVLSATLVRPGVVTVDMGVP 121

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              W  +PLA + D +                +P  VSMGNPHA FF+       D    
Sbjct: 122 AQGWADVPLAEAMDTLHL----------PMAGDPAAVSMGNPHATFFLPA-PDGMDPCVA 170

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L  HP+F +  N+  A VTS  S+ LR WERG GLT ACGS ACA+VV +      +
Sbjct: 171 GPELEHHPLFPQRANIGFAHVTSRGSMRLRVWERGSGLTRACGSGACAAVVNAVRRGLVD 230

Query: 244 RAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
           R  +V+M GG L I W  D+ HV MTG A   + G    +
Sbjct: 231 RTCTVEMDGGKLEITWRGDDGHVLMTGPATTSFTGTFSPE 270


>gi|290477112|ref|YP_003470025.1| diaminopimelate epimerase [Xenorhabdus bovienii SS-2004]
 gi|289176458|emb|CBJ83267.1| diaminopimelate epimerase [Xenorhabdus bovienii SS-2004]
          Length = 274

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 130/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLADRRTGVGFDQLLIVEAPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++     T  G +V     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIKVSTQTGRMVLSITNDDQVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P      +  +                 VVSMGNPH +  VE D+   ++  
Sbjct: 121 PDFEPQHVPF-----RAIKAEKTYIIRAIERTVLCGVVSMGNPHCVIQVE-DVDTAEVEI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   ++ +   + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLENHDRFPERANIGFMQIMNRSHIRLRVFERGAGETRACGSGACAAVAVGIQQDLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L I W      ++M G A   +EG + +
Sbjct: 235 NSQVRVDLPGGFLQICWDGPGKPLYMIGPATHVYEGTIHL 274


>gi|53717852|ref|YP_106838.1| diaminopimelate epimerase [Burkholderia pseudomallei K96243]
 gi|167813715|ref|ZP_02445395.1| diaminopimelate epimerase [Burkholderia pseudomallei 91]
 gi|217424960|ref|ZP_03456456.1| diaminopimelate epimerase [Burkholderia pseudomallei 576]
 gi|81608156|sp|Q63YH7|DAPF_BURPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|52208266|emb|CAH34197.1| diaminopimelate epimerase [Burkholderia pseudomallei K96243]
 gi|217391980|gb|EEC32006.1| diaminopimelate epimerase [Burkholderia pseudomallei 576]
          Length = 289

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 132/288 (45%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+       + S   E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVVSMGNPHAVQIVD-DAEAFA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  +   P F + VN    ++ S   ++LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VRVDGPAIECDPRFPQRVNAGFMQIVSRHEVNLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 242 GRLDSPVTVHTHGGTLTISWNGACDERAPLMMAGPATTVFEGVIELPA 289


>gi|170078250|ref|YP_001734888.1| diaminopimelate epimerase [Synechococcus sp. PCC 7002]
 gi|229813250|sp|B1XP39|DAPF_SYNP2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169885919|gb|ACA99632.1| diaminopimelate epimerase [Synechococcus sp. PCC 7002]
          Length = 281

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 93/283 (32%), Positives = 138/283 (48%), Gaps = 11/283 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K +G+GN  +++D R     +     AI           D ++     Q A  D  
Sbjct: 3   LEFTKYQGLGNDFILLDNRQQTTPLVTPEQAIQLCDRHFGIGADGVIFALPGQ-AGADYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTS----RMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ RF+          K+++  T+ G++  +   D  + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLARFIDHLEGGNAPGKTYSIHTLAGMIRPRLETDALVRVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MGEPIL    IP        +    +              VSMGNPH I FVE D+    
Sbjct: 122 MGEPILTATDIPTTLK--DSNGQAVNQPLEVAGKTWMVTCVSMGNPHCITFVE-DVAAIA 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G     HP F + +N     V   + + +R WERG G+T ACG+ ACASVVA    
Sbjct: 179 LEVIGKDFEHHPAFPQRINTEFIEVVRPDYIKMRVWERGAGITLACGTGACASVVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              +R  +V++ GG L IEW   +NH++MTG A   ++G++ +
Sbjct: 239 GHCDRLCTVELPGGCLQIEWSAADNHIYMTGPAAISFQGQVTL 281


>gi|53724459|ref|YP_104734.1| diaminopimelate epimerase [Burkholderia mallei ATCC 23344]
 gi|67639322|ref|ZP_00438192.1| diaminopimelate epimerase [Burkholderia mallei GB8 horse 4]
 gi|121598944|ref|YP_994216.1| diaminopimelate epimerase [Burkholderia mallei SAVP1]
 gi|124385583|ref|YP_001028131.1| diaminopimelate epimerase [Burkholderia mallei NCTC 10229]
 gi|126450841|ref|YP_001082942.1| diaminopimelate epimerase [Burkholderia mallei NCTC 10247]
 gi|126453808|ref|YP_001064492.1| diaminopimelate epimerase [Burkholderia pseudomallei 1106a]
 gi|134283596|ref|ZP_01770295.1| diaminopimelate epimerase [Burkholderia pseudomallei 305]
 gi|167003307|ref|ZP_02269095.1| diaminopimelate epimerase [Burkholderia mallei PRL-20]
 gi|167717573|ref|ZP_02400809.1| diaminopimelate epimerase [Burkholderia pseudomallei DM98]
 gi|167736616|ref|ZP_02409390.1| diaminopimelate epimerase [Burkholderia pseudomallei 14]
 gi|167822230|ref|ZP_02453701.1| diaminopimelate epimerase [Burkholderia pseudomallei 9]
 gi|167843824|ref|ZP_02469332.1| diaminopimelate epimerase [Burkholderia pseudomallei B7210]
 gi|167892323|ref|ZP_02479725.1| diaminopimelate epimerase [Burkholderia pseudomallei 7894]
 gi|167900819|ref|ZP_02488024.1| diaminopimelate epimerase [Burkholderia pseudomallei NCTC 13177]
 gi|167909039|ref|ZP_02496130.1| diaminopimelate epimerase [Burkholderia pseudomallei 112]
 gi|167917079|ref|ZP_02504170.1| diaminopimelate epimerase [Burkholderia pseudomallei BCC215]
 gi|226199848|ref|ZP_03795399.1| diaminopimelate epimerase [Burkholderia pseudomallei Pakistan 9]
 gi|237810387|ref|YP_002894838.1| diaminopimelate epimerase [Burkholderia pseudomallei MSHR346]
 gi|242314725|ref|ZP_04813741.1| diaminopimelate epimerase [Burkholderia pseudomallei 1106b]
 gi|254175103|ref|ZP_04881764.1| diaminopimelate epimerase [Burkholderia mallei ATCC 10399]
 gi|254196886|ref|ZP_04903310.1| diaminopimelate epimerase [Burkholderia pseudomallei S13]
 gi|254201833|ref|ZP_04908197.1| diaminopimelate epimerase [Burkholderia mallei FMH]
 gi|254207163|ref|ZP_04913514.1| diaminopimelate epimerase [Burkholderia mallei JHU]
 gi|254258338|ref|ZP_04949392.1| diaminopimelate epimerase [Burkholderia pseudomallei 1710a]
 gi|254359669|ref|ZP_04975940.1| diaminopimelate epimerase [Burkholderia mallei 2002721280]
 gi|81603782|sp|Q62EZ3|DAPF_BURMA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166224247|sp|A3MRQ6|DAPF_BURM7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166224248|sp|A2S862|DAPF_BURM9 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166224249|sp|A1V7L3|DAPF_BURMS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166224250|sp|A3NQ71|DAPF_BURP0 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|52427882|gb|AAU48475.1| diaminopimelate epimerase [Burkholderia mallei ATCC 23344]
 gi|121227754|gb|ABM50272.1| diaminopimelate epimerase [Burkholderia mallei SAVP1]
 gi|124293603|gb|ABN02872.1| diaminopimelate epimerase [Burkholderia mallei NCTC 10229]
 gi|126227450|gb|ABN90990.1| diaminopimelate epimerase [Burkholderia pseudomallei 1106a]
 gi|126243711|gb|ABO06804.1| diaminopimelate epimerase [Burkholderia mallei NCTC 10247]
 gi|134245005|gb|EBA45100.1| diaminopimelate epimerase [Burkholderia pseudomallei 305]
 gi|147747727|gb|EDK54803.1| diaminopimelate epimerase [Burkholderia mallei FMH]
 gi|147752705|gb|EDK59771.1| diaminopimelate epimerase [Burkholderia mallei JHU]
 gi|148028883|gb|EDK86815.1| diaminopimelate epimerase [Burkholderia mallei 2002721280]
 gi|160696148|gb|EDP86118.1| diaminopimelate epimerase [Burkholderia mallei ATCC 10399]
 gi|169653629|gb|EDS86322.1| diaminopimelate epimerase [Burkholderia pseudomallei S13]
 gi|225928199|gb|EEH24235.1| diaminopimelate epimerase [Burkholderia pseudomallei Pakistan 9]
 gi|237502670|gb|ACQ94988.1| diaminopimelate epimerase [Burkholderia pseudomallei MSHR346]
 gi|238519858|gb|EEP83324.1| diaminopimelate epimerase [Burkholderia mallei GB8 horse 4]
 gi|242137964|gb|EES24366.1| diaminopimelate epimerase [Burkholderia pseudomallei 1106b]
 gi|243061117|gb|EES43303.1| diaminopimelate epimerase [Burkholderia mallei PRL-20]
 gi|254217027|gb|EET06411.1| diaminopimelate epimerase [Burkholderia pseudomallei 1710a]
          Length = 289

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 133/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+       + S   E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVVSMGNPHAVQIVD-DAEAFA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + + P F + VN    ++ S   ++LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 242 GRLDSPVTVHTHGGTLTISWNGACDERAPLMMAGPATTVFEGVIELPA 289


>gi|326563211|gb|EGE13479.1| diaminopimelate epimerase [Moraxella catarrhalis 12P80B1]
          Length = 299

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 95/299 (31%), Positives = 142/299 (47%), Gaps = 13/299 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+      +T + I  L+       FDQ++++       +D  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRMTLTPELIRLLADRRIGVGFDQLLIVEPPSRPDIDFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV  CGNG RC   F+ +R    ++    ET  GI++   NR G + VDMG
Sbjct: 62  YRIFNADGSEVSQCGNGARCFASFVQARKLSFKQRLRVETSSGIIILSTNRYGWVQVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP            + +           +V ++GNPHAI  V+D +   D+ 
Sbjct: 122 KPKFEPDQIPFTPKTITKVGRAYRLDVDGIPV--QLYVANIGNPHAIIKVDD-VLDADVD 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  H  F E VN++  +V +   + +R +ERGVG T ACG+ ACASV        
Sbjct: 179 RLGKLIESHEAFPERVNVNFVQVINQRHVRIRVYERGVGETQACGTGACASVATGIREGW 238

Query: 242 TNRAVSVK--MLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI-----KTGKWIKKNEDD 293
            +  V ++  + GG L I W D   + MTG     +EG           G  +  N DD
Sbjct: 239 LDEGVDIRAQLYGGSLAIRWQDGYSLIMTGPTAFVYEGVFSPDGLAASAGIKLDPNADD 297


>gi|77968649|gb|ABB10029.1| diaminopimelate epimerase [Burkholderia sp. 383]
          Length = 309

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 134/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+       VD  
Sbjct: 23  LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGVDFK 82

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 83  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 142

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   +    + +              R    V+MGNPHA+  V+ D   Y 
Sbjct: 143 APVFTPAQVPFDAAGLDGRTEGHDTLWPLDVGGATRWISTVTMGNPHAVQVVD-DAEAYP 201

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+  H  F E VN    +V S   + LR +ER  G T ACG+ ACA+V A    
Sbjct: 202 VLEEGPLIEHHARFPERVNAGFMQVVSRSEVKLRVYERAAGETLACGTGACAAVAAGIRR 261

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 262 GLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPATTVFEGEIDLPA 309


>gi|317486309|ref|ZP_07945141.1| diaminopimelate epimerase [Bilophila wadsworthia 3_1_6]
 gi|316922479|gb|EFV43733.1| diaminopimelate epimerase [Bilophila wadsworthia 3_1_6]
          Length = 280

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 137/283 (48%), Gaps = 14/283 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS-VDAF 63
           + F KM+  GN  + +D      +        +S        D ++LI    D    D  
Sbjct: 1   MRFTKMQAAGNDYVYMDTLKAPISSPEALARRISDRHFGVGSDGLILICPPSDPGEADFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDG----SIS 117
           +R+ N DGSE + CGNG+RCV    +      ++    ET+ G+L  + +  G    +++
Sbjct: 61  MRMFNADGSEAEMCGNGIRCVGKYVYDNGHTDKEQVRIETLAGVLTLRLHVSGEKVETVT 120

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEP L  K IP++   +        +       + N   VSMGNPHA+ F+   + +
Sbjct: 121 VDMGEPRLAPKDIPVSGPGEDFINRPLRVQGR----VWNVTAVSMGNPHAVVFMHG-IDN 175

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            DL+  G     HP+F    N     V     L +R WERG G T ACG+ ACASVVA+ 
Sbjct: 176 LDLSGIGPQFEHHPLFPRRTNTEFVEVVGRHHLKMRVWERGAGETLACGTGACASVVAAV 235

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
               T R V +K+LGG L IEW +  NHVFMTG A   + G+ 
Sbjct: 236 LTGNTERKVRMKLLGGELDIEWDEATNHVFMTGGAVTVFTGEW 278


>gi|332711586|ref|ZP_08431517.1| diaminopimelate epimerase [Lyngbya majuscula 3L]
 gi|332349564|gb|EGJ29173.1| diaminopimelate epimerase [Lyngbya majuscula 3L]
          Length = 281

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN--ITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R        +  A+     +     D ++     Q+   D  
Sbjct: 1   MEFTKYHGLGNDFILIDNRDDPKPRITSEQALQLCDRNFGIGADGVIFALPGQE-GTDYT 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFT---FETIRGILVAKENRDGSISVDM 120
           +RI N DGSE + CGNG+RC+ +FL         T     T+ G+++ +   DG + VDM
Sbjct: 60  MRIFNSDGSEPEMCGNGIRCLAKFLADLEGANHKTHYRIHTLAGVIIPELKDDGKVRVDM 119

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L    IP   +    D+   +        L     VSMGNPH I FVE D     L
Sbjct: 120 GMPQLSAAQIPTVLAE--ADQKVINTPIEIADKLWEVTCVSMGNPHCITFVE-DADAIPL 176

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G L   H +F +  N    +V   + L +R WERG G T ACG+ ACASVVA     
Sbjct: 177 ETIGPLFEHHSVFPQRTNTEFIQVVRPDYLKMRVWERGAGATLACGTGACASVVAGVLTQ 236

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           K++R  +V++ GG L IEW + +  V+MTG A++ + GKL
Sbjct: 237 KSDRICTVELPGGCLDIEWSETDQRVYMTGPAEQVFSGKL 276


>gi|83595884|gb|ABC25246.1| diaminopimelate epimerase [uncultured marine bacterium Ant4D3]
          Length = 276

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 145/281 (51%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ FAKM G+GN  +V+D+     +++++ I  L   +    FDQ++L+   Q   VD  
Sbjct: 2   LLRFAKMHGLGNDFMVVDLISQRVHLSAEQIRCLGDRNTGVGFDQLLLVETPQSPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+  +    ++    +T  G +  K  +D  + VDMG
Sbjct: 62  YRIFNSDGTEVEHCGNGARCFARFVHDQRLTGKRDIAVQTSNGRMGLKMLKDHWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           EP+L   L+P      +    R      ++       VVSMGNPHA+  V+ D+    + 
Sbjct: 122 EPVLLPSLVPFDAPA-QAPSYRLEHNGQSYTIG----VVSMGNPHAVIVVD-DVASAPVV 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L +HP F    N+   ++ +  ++ LR +ERGVG T ACG+ ACA+VVA      
Sbjct: 176 ELGTKLEQHPRFPNKANIGFMQIINRNTIKLRVFERGVGETKACGTGACAAVVAGQQQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
               V+ ++ GG L I+W     H+ M G     +EG++ +
Sbjct: 236 LGTNVTAQLTGGDLTIDWQGPGHHLLMNGPTTHVYEGQIKL 276


>gi|254182206|ref|ZP_04888803.1| diaminopimelate epimerase [Burkholderia pseudomallei 1655]
 gi|184212744|gb|EDU09787.1| diaminopimelate epimerase [Burkholderia pseudomallei 1655]
          Length = 289

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 133/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDDADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+       + S   E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVVSMGNPHAVQIVD-DAEAFA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + + P F + VN    ++ S   ++LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 242 GRLDSPVTVHTHGGTLTISWNGACDERAPLMMAGPATTVFEGVIELPA 289


>gi|161702953|ref|YP_370673.2| diaminopimelate epimerase [Burkholderia sp. 383]
          Length = 289

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 134/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+       VD  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGVDFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+     +P   +    + +              R    V+MGNPHA+  V+ D   Y 
Sbjct: 123 APVFTPAQVPFDAAGLDGRTEGHDTLWPLDVGGATRWISTVTMGNPHAVQVVD-DAEAYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+  H  F E VN    +V S   + LR +ER  G T ACG+ ACA+V A    
Sbjct: 182 VLEEGPLIEHHARFPERVNAGFMQVVSRSEVKLRVYERAAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 242 GLLDSPVTVHTHGGTLTISWDGARDEAAALMMAGPATTVFEGEIDLPA 289


>gi|302381573|ref|YP_003817396.1| diaminopimelate epimerase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192201|gb|ADK99772.1| diaminopimelate epimerase [Brevundimonas subvibrioides ATCC 15264]
          Length = 277

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 107/281 (38%), Positives = 156/281 (55%), Gaps = 7/281 (2%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDAS 59
           MQ+S   F KM G GN  +V++         +D + AL+       FDQ++ I     A 
Sbjct: 1   MQAST-PFVKMNGAGNDFVVVNALETPFTPDADRVRALADRRTGEGFDQLIAIEPSDRA- 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
            DAF+R+ N DG  V++CGN +RCV   L       S T +T+ G  +A+      ++VD
Sbjct: 59  -DAFMRVWNADGGVVETCGNALRCVGWMLMQANGTDSATIDTLGGPAIARRAGPERVTVD 117

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P LDW+ IPLA + D    +   IGP++   +  P  VSMGNPH +FF +  L    
Sbjct: 118 MGAPRLDWREIPLAEAMDTRGIE-LQIGPIDDPVMHTPGAVSMGNPHVVFFTDR-LDDVF 175

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G+++  HP+F +GVN+  A V + + + LR WERG GLT ACG+ ACA++VA+   
Sbjct: 176 VTGAGSMIEHHPLFPQGVNVGFAHVLAPDRIRLRVWERGAGLTRACGTGACAALVAASRR 235

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
             T R+ +V + GG L I+W +   HV MTG  + E  G+L
Sbjct: 236 GLTGRSATVVVDGGELDIDWDETTGHVLMTGPVEIERTGRL 276


>gi|260219996|emb|CBA27092.1| Diaminopimelate epimerase [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 302

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 91/292 (31%), Positives = 136/292 (46%), Gaps = 12/292 (4%)

Query: 3   SSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASV 60
             M + F KM+G GN  +V+D       +T      L         DQI+ +       +
Sbjct: 12  ERMRIQFTKMQGAGNDFVVLDETKGRLGLTPAHYRFLGDRHFGVGADQILTVRPSPAEGI 71

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISV 118
           D    I N DG+EV+ CGNG RC  RF+  +    +     +T++G++      DG ++V
Sbjct: 72  DFEYVIHNADGNEVEQCGNGSRCFARFVRDQGLTGKDRIRVKTMKGVIEPLLTPDGRVTV 131

Query: 119 DMGEPILDWKLIPLA------RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVE 172
           DMG P+ +   IP        ++                        VSMGNPHA+  V 
Sbjct: 132 DMGAPVFNPADIPFDDSGLSLQAMGSWGNWPLAPVESAQAAPLLVATVSMGNPHAVTLV- 190

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
            D+    +A+ G  +  +P F++GVN+   +V S   + LR +ERGVG T ACG+ ACA+
Sbjct: 191 ADVDAAPVATLGPQVQANPRFTQGVNVGFLQVVSRSQVRLRVYERGVGETLACGTGACAA 250

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKT 283
           VVA   L   +  V V+  GG L I W      VFMTG A   + G++++  
Sbjct: 251 VVAGIRLGLLDARVDVQTRGGMLTIAWEGMGASVFMTGPATTVFRGEIELPE 302


>gi|94676850|ref|YP_588594.1| diaminopimelate epimerase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|167012033|sp|Q1LTX0|DAPF_BAUCH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|94220000|gb|ABF14159.1| diaminopimelate epimerase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 274

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 86/279 (30%), Positives = 138/279 (49%), Gaps = 10/279 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D+   +  ++   I  L+       FDQ++ +    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDVVTQNVYLSPTKIRFLANRHSGVGFDQLLFVEPPYDPEIDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC+  F+  +    ++     T    +V     +  + V+MG 
Sbjct: 61  RIFNADGSEVTQCGNGARCLAHFVRMKKLTNKREIYISTQTSRMVLTIIENNMVRVNMGV 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP      ++++        N++F     +VS+GNPH I  V +++    ++ 
Sbjct: 121 PKFELPQIPF--DMHQIEKKEILYLAKNYIF---GGIVSIGNPHCIMIV-NNVDSAQVSI 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  FSE  N+   +V + E + LR +ERGVG T ACGS ACA+V     L   
Sbjct: 175 IGPILEIHKYFSERTNVGFMQVINREQVLLRVYERGVGETQACGSGACAAVAIGIRLGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
              V V + GG L+I W      ++MTG A   ++G ++
Sbjct: 235 AEQVQVALPGGKLVIYWRGPGQSLYMTGPAVHIYDGFIN 273


>gi|296133317|ref|YP_003640564.1| diaminopimelate epimerase [Thermincola sp. JR]
 gi|296031895|gb|ADG82663.1| diaminopimelate epimerase [Thermincola potens JR]
          Length = 277

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 139/281 (49%), Gaps = 15/281 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD--NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G+GN  ++I+    ++  N    A+   +       D ++ I   + A  D  
Sbjct: 1   MQFTKMHGLGNDFILIEDFDKNNLANGAELAVRLCNRKTGIGADGLVFILPSETA--DIQ 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGS----IS 117
           +RI N DGSE + CGN +RC  R+L      K  T   ET+ GI + +   + +    + 
Sbjct: 59  MRIFNPDGSEPEMCGNAIRCFARYLYDHGIVKKQTIRVETLAGIRIPRIIENPAGEALVE 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEP L+   IP+     K+  +   +    +    N   VSMGNPH + FV+ +   
Sbjct: 119 VDMGEPELERGRIPMLGGPGKVVAEPLPVNGSTY----NVTCVSMGNPHCVIFVD-NAED 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           Y +A+ G  +  H  F    N+   +V +   + +R WERG G+T ACG+ ACAS VA+ 
Sbjct: 174 YPVAAIGPRVETHTAFPNKTNVEFVQVLNENEVRMRVWERGAGITMACGTGACASAVAAH 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
               T R V V + GG L I W  +NHV+M G A   ++G 
Sbjct: 234 LNGFTGREVIVHLDGGDLFIRWAQDNHVYMMGPAAYVFKGT 274


>gi|156972657|ref|YP_001443564.1| diaminopimelate epimerase [Vibrio harveyi ATCC BAA-1116]
 gi|166225762|sp|A7N0W0|DAPF_VIBHB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|156524251|gb|ABU69337.1| hypothetical protein VIBHAR_00309 [Vibrio harveyi ATCC BAA-1116]
          Length = 276

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNRYSISVSTKKGKMILDVEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRAGDKTLFCG-AVSMGNPHV-VTVVDDVDTAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V +   + LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNRNHIRLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG A   ++G+L
Sbjct: 238 ENVKVSLPGGDLRISWQGPGKPLFMTGPATHVFDGQL 274


>gi|221201914|ref|ZP_03574951.1| diaminopimelate epimerase [Burkholderia multivorans CGD2M]
 gi|221207580|ref|ZP_03580588.1| diaminopimelate epimerase [Burkholderia multivorans CGD2]
 gi|221172426|gb|EEE04865.1| diaminopimelate epimerase [Burkholderia multivorans CGD2]
 gi|221178334|gb|EEE10744.1| diaminopimelate epimerase [Burkholderia multivorans CGD2M]
          Length = 289

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 141/288 (48%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T+  + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALASRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPL-ARSFDKMDRDRFHIGPVNHLF-LRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+   + +P  A   D     R  + P+      R    VSMGNPHA+  V+ D   Y 
Sbjct: 123 APVFAPEQVPFDASGLDGRTEGRDTLWPLEIGGRTRWISTVSMGNPHAVQVVD-DAEAYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLDEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     ++  + M G A   +EG++D+  
Sbjct: 242 GLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVFEGEIDLPA 289


>gi|261400446|ref|ZP_05986571.1| diaminopimelate epimerase [Neisseria lactamica ATCC 23970]
 gi|269209897|gb|EEZ76352.1| diaminopimelate epimerase [Neisseria lactamica ATCC 23970]
          Length = 283

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 96/284 (33%), Positives = 142/284 (50%), Gaps = 9/284 (3%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           M++  + F KM G+GN  +VID            I   +       FDQ++++   +   
Sbjct: 1   MKT--LKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEG 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           VD   RI N DGSEV+ CGNG RC  RF+T +    +K    ET +G++  K + +G ++
Sbjct: 59  VDFRYRIFNADGSEVEQCGNGARCFARFVTDKGLTDKKEICVETAKGVIFPKLSDNGMVT 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P      IP      + D D    G      ++    V+MGNPHA+  V+ D+  
Sbjct: 119 VNMGKPKFMPSEIPFVPESGEGD-DACIYGVHLESGIQPVSCVNMGNPHAVIVVD-DVEC 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G L+  H  F E VN+   +V     + LR +ERGVG T ACG+ ACA+V A  
Sbjct: 177 APVRETGPLIEAHRQFPERVNVGFMQVVGRTEIRLRVFERGVGETQACGTGACAAVAAGI 236

Query: 238 CLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            L   +  + +   + GG L IEW     V MTG A+  +EG+L
Sbjct: 237 RLGLLDEGKTIEAVLPGGTLYIEWVRGGDVMMTGPAETVFEGEL 280


>gi|330818644|ref|YP_004362349.1| Diaminopimelate epimerase [Burkholderia gladioli BSR3]
 gi|327371037|gb|AEA62393.1| Diaminopimelate epimerase [Burkholderia gladioli BSR3]
          Length = 288

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 86/286 (30%), Positives = 136/286 (47%), Gaps = 10/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T + + AL+        DQ++L+       VD   
Sbjct: 3   LPFTKMQGAGNDFVVLDGTAGDLGLTPERVRALADRHFGIGADQLLLVERPSLDGVDFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI NCDG EV+ CGNG RC V+F+  +      T   +   G++      +G + VDMG 
Sbjct: 63  RIFNCDGGEVEHCGNGARCFVKFVRDKGLTDKTTVRVQVKHGVITLSMQDNGEVVVDMGS 122

Query: 123 PILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P   +    + D          +   R   VVSMGNPHA+  V+ D   + +
Sbjct: 123 PVFEPARVPFDVAGLAGRRDGADTVYPLEVNGATRWISVVSMGNPHAVQLVD-DAEAFAV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G ++ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A     
Sbjct: 182 LEDGPVIERHARFPQRVNAGFLQIVSRREVKLRVYERGAGETLACGTGACAAVAAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNN----HVFMTGEAKKEWEGKLDIK 282
             +  V+V+  GG L I W         ++M G A   ++G +++ 
Sbjct: 242 LLDSPVAVQTHGGTLTIHWDGARDQAAPLYMAGPAVTVFDGAIELA 287


>gi|149186852|ref|ZP_01865162.1| diaminopimelate epimerase [Erythrobacter sp. SD-21]
 gi|148829519|gb|EDL47960.1| diaminopimelate epimerase [Erythrobacter sp. SD-21]
          Length = 273

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 138/283 (48%), Gaps = 18/283 (6%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDD-NTHFDQIMLIHDFQD 57
           M+ +M V F KM G+GN  +V+D R      +      A++        DQ++L+     
Sbjct: 1   MRGTMRVPFIKMHGLGNDFVVLDARETALPVLDKGRAAAIADRHEGIGCDQLILLEPS-- 58

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSIS 117
            S D  +RI N DGSEV +CGN  R V        + +        G L++    DG   
Sbjct: 59  GSADFRMRIFNHDGSEVGACGNATRAVALLHGVEARIE------TAGGLLSASPSDGGAR 112

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P  DW  IPLA   D +        PV    L NP  V++GNPH IFFVE D   
Sbjct: 113 VDMGTPRFDWDAIPLAYPMDTL------SMPVGWEMLENPGAVNVGNPHVIFFVE-DTNA 165

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L   G  + K P+F E VN+++A + S   + LR WERG GLT ACG+ ACA+ V + 
Sbjct: 166 VPLDRIGPEIEKDPLFPERVNVNVATIESRSRIRLRVWERGAGLTRACGTGACATAVRAM 225

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
                +  V+V + GG L I W     + MTG A + + G  +
Sbjct: 226 RRKLVDSPVTVALPGGELEIAWEPGGTIQMTGPATEAFRGSFE 268


>gi|209693749|ref|YP_002261677.1| diaminopimelate epimerase [Aliivibrio salmonicida LFI1238]
 gi|229807485|sp|B6EP85|DAPF_ALISL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|208007700|emb|CAQ77811.1| diaminopimelate epimerase [Aliivibrio salmonicida LFI1238]
          Length = 276

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 95/279 (34%), Positives = 133/279 (47%), Gaps = 10/279 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCLTQNIFFSPDLIRRLADRNRGIGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DG+EV+ CGNG RC  RF+  +      T    T +G +  K   D  I+V+MGEP
Sbjct: 64  IFNSDGTEVEQCGNGARCFARFVRMKGLTNRTTILVSTKKGKMSLKVEDDDQITVNMGEP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ ++       L     VSMGNPH    V DD+ +YD+  +
Sbjct: 124 QFEPNKIPFKA----TQAEKTYLLRAEDKTLFCG-AVSMGNPHC-VTVVDDVDNYDVDKY 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L+  H  F E VN     + S   + LR +ERG G T ACGS ACA+V          
Sbjct: 178 GPLVEGHERFPERVNAGFMEIVSPSEIKLRVYERGAGETQACGSGACAAVAVGIMQELLE 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             V V + GG L I W      +FMTG A   ++G+L I
Sbjct: 238 EDVKVSLPGGDLRIVWQGPGKPLFMTGPATHVYDGQLSI 276


>gi|326404965|ref|YP_004285047.1| diaminopimelate epimerase [Acidiphilium multivorum AIU301]
 gi|325051827|dbj|BAJ82165.1| diaminopimelate epimerase [Acidiphilium multivorum AIU301]
          Length = 277

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 102/275 (37%), Positives = 137/275 (49%), Gaps = 10/275 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIR 65
            F KM G GN  +V+D R    ++   A   +         DQI+LI    D    AF+R
Sbjct: 6   PFLKMHGAGNDFVVLDARAHPLDLAPAAAARIADRHRGVGCDQIILIEP--DDGAAAFMR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I+N DGSE  +CGN  RCV   L      +     T  G+L A+      + VDMG P L
Sbjct: 64  ILNADGSESGACGNATRCVAALLAGETGARRLAIRTNAGLLPAEIKGPTLVEVDMGAPKL 123

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
            W+ IPLA   D +              ++NP   SMGNPHA FFV+ DL H  + + G 
Sbjct: 124 GWEDIPLAEPADTLSLRLAL------GPVQNPAACSMGNPHATFFVD-DLTHLQIETIGP 176

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            L    +F E  N+  AR+ + + + LR WERG GLT ACGS ACA++V +       R 
Sbjct: 177 KLEHARLFPERANIGFARIDAPDRIRLRVWERGAGLTLACGSGACAALVNAHRRGLAARR 236

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             ++M GG L + W D+ HV M G     +EG+LD
Sbjct: 237 AEIEMDGGTLTLTWRDDGHVLMEGPVALVFEGELD 271


>gi|134096113|ref|YP_001101188.1| diaminopimelate epimerase [Herminiimonas arsenicoxydans]
          Length = 276

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 134/277 (48%), Gaps = 7/277 (2%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G GN  +VID      + T      L+        DQ++++   Q A VD   RI N 
Sbjct: 1   MHGAGNDFVVIDAINQSIHFTPAQWQHLADRRFGVGADQMLVVEKPQAAGVDFRYRIYNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG R  V+F+T +    +++   ET+ G++  +   +G I+VDMG PIL  
Sbjct: 61  DGGEVEQCGNGARAFVKFVTDKKLTDKQAIRVETMSGVIEPRLEANGQITVDMGAPILTP 120

Query: 128 KLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           + +P   S      +                  V+SMGNPHA+  V  D  H  +   G 
Sbjct: 121 EDVPFDVSGLLCKAEGADTLWPLDIKGETHWISVLSMGNPHAVQVV-ADADHAPVREDGV 179

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  HP F + VN    ++     + LR +ERG G T ACG+ ACA+VV+          
Sbjct: 180 LIEHHPRFPKRVNAGFMQIIDPHQIKLRVFERGAGETLACGTGACAAVVSGIRRGLLASP 239

Query: 246 VSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           + V+  GG L I W  +N  V +TG A   +EG++++
Sbjct: 240 IKVQTRGGELSIAWAGDNSPVLLTGPAVTVFEGEIEL 276


>gi|183220003|ref|YP_001837999.1| diaminopimelate epimerase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|167778425|gb|ABZ96723.1| Diaminopimelate epimerase (DAP epimerase) [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 286

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 97/284 (34%), Positives = 144/284 (50%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           ++F KMEGIGN  + ID       ++ + I  LS        D ++ I +         +
Sbjct: 9   INFTKMEGIGNDYVYIDATKNDIRLSPEQIQKLSDRNFGIGGDGVIFIRNSNSGE--FQM 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA-----KENRDGSIS 117
            + N DGS  + CGNG+RCV +F+      K +  T ET +G+L          +   ++
Sbjct: 67  DMYNSDGSSSEMCGNGVRCVGKFVYDHGLTKNQKPTIETGKGVLTLDLKTGTNGKVEMVT 126

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL   L+P+    D+   ++            +   VSMGNPH + +V+ D   
Sbjct: 127 VDMGEPILKPSLVPIVWKGDEPVINQVIE---VQGKQYHFTAVSMGNPHCVIYVD-DADD 182

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++  HP F   VN+    +   + L  RTWERG G T ACG+ ACA  VAS 
Sbjct: 183 FPVREIGPIIENHPFFPRRVNVEFVSIKGKDHLYQRTWERGTGETLACGTGACAVTVASI 242

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              KT R+V + + GG L IEW +N  VFMTG AK+ + G+++I
Sbjct: 243 LNGKTGRSVRIDLRGGTLHIEWQENGSVFMTGPAKEVFSGEVEI 286


>gi|330826619|ref|YP_004389922.1| diaminopimelate epimerase [Alicycliphilus denitrificans K601]
 gi|329311991|gb|AEB86406.1| Diaminopimelate epimerase [Alicycliphilus denitrificans K601]
          Length = 292

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 92/289 (31%), Positives = 134/289 (46%), Gaps = 12/289 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETRERLGLTPAQYRFLADRHFGVGADQILTVRPSPAEGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG +VQ CGNG RC  R++  +    +     +T+ G++  +   DG ++VDMG 
Sbjct: 63  LIHNADGGQVQQCGNGARCFARYVRDKGLTAKDRIRVQTMAGVIAPELTADGRVTVDMGR 122

Query: 123 PILDWKLIPLAR------SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P+LD   +P             + +    +             VSMGNPHA+  V+ D+ 
Sbjct: 123 PVLDPARLPFDTAGLVPVPQGSVKKWPLALDGQAPQATVMIVAVSMGNPHAVQLVD-DVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F + VN    +V     + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 182 SAPVARTGPLIEGHPRFPQRVNAGYLQVVGRTEVRLRVYERGAGETLACGTGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIKT 283
             L   +  V V   GG L I W     + VFMTG A   +EG++DI  
Sbjct: 242 IGLGLLDARVDVHTRGGLLTIAWAGGLQDPVFMTGPATTVFEGQIDIPE 290


>gi|153835736|ref|ZP_01988403.1| diaminopimelate epimerase [Vibrio harveyi HY01]
 gi|148867605|gb|EDL66907.1| diaminopimelate epimerase [Vibrio harveyi HY01]
          Length = 276

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILDVEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRAGDKTLFCG-AVSMGNPHV-VTVVDDVDTAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V +   + LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNRNHIRLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG A   ++G+L
Sbjct: 238 ENVKVSLPGGDLRISWQGPGKPLFMTGPATHVFDGQL 274


>gi|89902213|ref|YP_524684.1| diaminopimelate epimerase [Rhodoferax ferrireducens T118]
 gi|122478434|sp|Q21SV0|DAPF_RHOFD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|89346950|gb|ABD71153.1| diaminopimelate epimerase [Rhodoferax ferrireducens T118]
          Length = 291

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 87/287 (30%), Positives = 134/287 (46%), Gaps = 11/287 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +++     L+        DQI+ +       +D   
Sbjct: 3   IPFTKMQGAGNDFVVLDETQGRFGLSTAHYRLLADRHFGVGADQILTVRPSPAPGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG+EV+ CGNG RC  RF+  +    + +   +T  G++  + N DG ++V+MG 
Sbjct: 63  LIHNADGAEVEQCGNGARCFARFVRDQGLTAKDAIRVQTRGGVIEPQLNPDGRVTVNMGA 122

Query: 123 PILDWKLIPLARSF------DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P+ +   IP   +           +    +    H       VVSMGNPHA+  V+ D+ 
Sbjct: 123 PVFELAEIPFDATGLQPQTSGLWKKWPLALVDSGHATTVYVAVVSMGNPHAVQVVD-DVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G L+  H  F + VN    ++     + LR +ERG G T ACGS ACA+VVA 
Sbjct: 182 TAPVRLQGPLIEHHASFPKRVNAGFMQIVDRSHIRLRVYERGTGETLACGSGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
             L   +  V V+  GG L I W      V MTG A   + G++++ 
Sbjct: 242 IRLGLLDDTVHVQTHGGTLTISWAGAAAPVLMTGPATPVFHGEINLP 288


>gi|307104456|gb|EFN52710.1| hypothetical protein CHLNCDRAFT_36797 [Chlorella variabilis]
          Length = 303

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 92/287 (32%), Positives = 138/287 (48%), Gaps = 13/287 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           V FAK +G+GN  +++D R   + +     A+     +     D ++     ++   D  
Sbjct: 19  VKFAKYQGLGNDFILVDNRHQLEPVVTPEQAVKLCDRNFGIGGDGVIFALPSEN-GTDYS 77

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS---FTFETIRGILVAKENRDGSISVDM 120
           +RI N DGSE + CGNG+RC+ RF+    + +        T+ G++      DG + VDM
Sbjct: 78  MRIFNSDGSEPEMCGNGIRCLARFVAGDPRARGAGAQLVHTLAGLIQPALLPDGQVCVDM 137

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-----L 175
           GEPIL    +P      + +        V+         VSMGNPHAI F   D     +
Sbjct: 138 GEPILRGPDVPTTLQPTQGEAVVQQKLAVDGKE-WLMTCVSMGNPHAITFGLADGSSIKV 196

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              DL   G     +P+F    N     V S   + +  WERG G T ACG+ ACA+VVA
Sbjct: 197 DSIDLPGIGPKFEHNPVFPARTNTEFVEVLSRSHVRMVVWERGAGATLACGTGACATVVA 256

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                 T+R+  V + GG L IEW + +NH++MTG A+  + G +D+
Sbjct: 257 GVLEGHTDRSCQVDLPGGPLHIEWRESDNHIYMTGPAELVFAGSVDV 303


>gi|302392607|ref|YP_003828427.1| diaminopimelate epimerase [Acetohalobium arabaticum DSM 5501]
 gi|302204684|gb|ADL13362.1| diaminopimelate epimerase [Acetohalobium arabaticum DSM 5501]
          Length = 279

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 90/282 (31%), Positives = 148/282 (52%), Gaps = 13/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  ++++       +    A            D ++LI   +    D  +
Sbjct: 1   MEFTKMHGLGNDFVMVNGFNEDIADPNQLAEAICDRHFGVGADGLVLILPSKQEEADFRM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGIL----VAKENRDGSISV 118
           RI N DGSE + CGN +RC  ++L  R   ++     ET+ GI+    + ++++  ++ V
Sbjct: 61  RIFNPDGSEPEMCGNAIRCFGKYLYDRDLTEKTKIRVETLAGIIVPELIIEKDQVEAVQV 120

Query: 119 DMGEPILDWKLIPLAR-SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           DMG+P L    IP+   + DK+ +++  +    +        VSMGNPH + FV+ D   
Sbjct: 121 DMGQPGLGSTDIPITGVNKDKVIKEKLEVENEEYEI----TAVSMGNPHTVIFVD-DADD 175

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G  + +HP F E  N+    V +   + +R WERG G+T ACG+ AC S VAS 
Sbjct: 176 FPVTEVGPKIEEHPRFPEKTNVEFIEVMNRSEIKMRVWERGAGVTLACGTGACGSTVASI 235

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
               TN+ V V +LGG L IEW +++HV+MTG A++ + G+ 
Sbjct: 236 LNDYTNQKVEVHLLGGDLTIEWTEDSHVYMTGPAEEVFVGEW 277


>gi|150402091|ref|YP_001329385.1| diaminopimelate epimerase [Methanococcus maripaludis C7]
 gi|254767113|sp|A6VFK8|DAPF_METM7 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|150033121|gb|ABR65234.1| Diaminopimelate epimerase [Methanococcus maripaludis C7]
          Length = 277

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 95/284 (33%), Positives = 142/284 (50%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + +D         ++    +S        D ++LI   + A  D  +
Sbjct: 1   MKFTKMHGLGNDYIYVDATSQKIENPNEISRFVSDRHFGIGSDGLVLILPSEIA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGN +RCV +F+  +        T ET+ GI V +   +      + V
Sbjct: 59  RMFNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTVENDKVVLVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL  + IP+      +  +             N   VSMGNPHAI ++E ++  +
Sbjct: 119 DMGEPILKAETIPVLSEKHPVIDEEITAKDY----CYNFTCVSMGNPHAITYIE-NVSEF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G L   H  F    N+    +    ++ +R WERG G T ACG+ ACA +VAS  
Sbjct: 174 PLEKIGPLFEFHEKFPRKTNVEFVELIDDSTIKMRVWERGAGETLACGTGACAVLVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                R  +VK+LGG L IEW++ +NH++MTG A   +EG++DI
Sbjct: 234 KGYVGRKATVKLLGGDLTIEWNESDNHIYMTGPATTVFEGEIDI 277


>gi|302389582|ref|YP_003825403.1| diaminopimelate epimerase [Thermosediminibacter oceani DSM 16646]
 gi|302200210|gb|ADL07780.1| diaminopimelate epimerase [Thermosediminibacter oceani DSM 16646]
          Length = 283

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 95/286 (33%), Positives = 141/286 (49%), Gaps = 13/286 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V++       I       +         D I+L+        D  +
Sbjct: 4   MKFTKMHGLGNDFIVVNGFKEDVRIIFKKAEKICDRHVGIGADGILLVLPSDK--CDLKM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRG----ILVAKENRDGSISV 118
           RIIN DGSE   CGNG+RC  R+  SR    + S T ET+ G     ++ K++R  S+ V
Sbjct: 62  RIINSDGSEADMCGNGIRCFARYAFSRGLVNKTSITVETLAGVIKPEIIIKDDRIESVRV 121

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG   L  K IP+A +    + +   +       +     VSMGNPH + FV+ D+  +
Sbjct: 122 DMGCYSLQKKDIPVAGN---PNEEAVDLEISVDDRVFKFTGVSMGNPHCVIFVD-DVESF 177

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +  FG ++ +HP+F +  N+        + L +R WERG GLT ACG+ ACAS VA+  
Sbjct: 178 PVERFGPVIERHPLFPKKTNVEFVEFKGQDRLKMRVWERGAGLTMACGTGACASAVAAYK 237

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
                  V+V + GG L IE   N  V+MTG A + + G +D+   
Sbjct: 238 KGIVGPKVTVSLPGGDLFIEIEKNGRVYMTGPAVEVFSGYIDLSAL 283


>gi|189910124|ref|YP_001961679.1| diaminopimelate epimerase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|226724214|sp|B0SC36|DAPF_LEPBA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167774800|gb|ABZ93101.1| Diaminopimelate epimerase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
          Length = 280

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 97/284 (34%), Positives = 144/284 (50%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           ++F KMEGIGN  + ID       ++ + I  LS        D ++ I +         +
Sbjct: 3   INFTKMEGIGNDYVYIDATKNDIRLSPEQIQKLSDRNFGIGGDGVIFIRNSNSGE--FQM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA-----KENRDGSIS 117
            + N DGS  + CGNG+RCV +F+      K +  T ET +G+L          +   ++
Sbjct: 61  DMYNSDGSSSEMCGNGVRCVGKFVYDHGLTKNQKPTIETGKGVLTLDLKTGTNGKVEMVT 120

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL   L+P+    D+   ++            +   VSMGNPH + +V+ D   
Sbjct: 121 VDMGEPILKPSLVPIVWKGDEPVINQVIE---VQGKQYHFTAVSMGNPHCVIYVD-DADD 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G ++  HP F   VN+    +   + L  RTWERG G T ACG+ ACA  VAS 
Sbjct: 177 FPVREIGPIIENHPFFPRRVNVEFVSIKGKDHLYQRTWERGTGETLACGTGACAVTVASI 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              KT R+V + + GG L IEW +N  VFMTG AK+ + G+++I
Sbjct: 237 LNGKTGRSVRIDLRGGTLHIEWQENGSVFMTGPAKEVFSGEVEI 280


>gi|319764398|ref|YP_004128335.1| diaminopimelate epimerase [Alicycliphilus denitrificans BC]
 gi|317118959|gb|ADV01448.1| diaminopimelate epimerase [Alicycliphilus denitrificans BC]
          Length = 292

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 92/289 (31%), Positives = 134/289 (46%), Gaps = 12/289 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETRERLGLTPAQYRFLADRHFGVGADQILTVRPSPAEGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG +VQ CGNG RC  R++  +    +     +T+ G++  +   DG ++VDMG 
Sbjct: 63  LIHNADGGQVQQCGNGARCFARYVRDKGLTAKDRIRVQTMAGVIAPELTADGRVTVDMGR 122

Query: 123 PILDWKLIPLAR------SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P+LD   +P             + +    +             VSMGNPHA+  V+ D+ 
Sbjct: 123 PVLDPARLPFDTAGLVPVPQGSVKKWPLALDGKAPQATVMIVAVSMGNPHAVQLVD-DVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F + VN    +V     + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 182 SAPVARTGPLIEGHPRFPQRVNAGYLQVVGRTEVRLRVYERGAGETLACGTGACAAVVAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIKT 283
             L   +  V V   GG L I W     + VFMTG A   +EG++DI  
Sbjct: 242 IGLGLLDARVDVHTRGGLLTIAWAGGLQDPVFMTGPATTVFEGQIDIPE 290


>gi|282898651|ref|ZP_06306639.1| Diaminopimelate epimerase [Cylindrospermopsis raciborskii CS-505]
 gi|281196519|gb|EFA71428.1| Diaminopimelate epimerase [Cylindrospermopsis raciborskii CS-505]
          Length = 279

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 138/281 (49%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMR-GCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R      IT + AI           D ++     Q    D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRCDLTPLITPEMAIRMCDRHFGIGADGVIFALPGQK-GTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMK----RKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+  FLT        +  +   T+ G++  +   DG + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAAFLTELEGISRSKDYYLIHTLAGVIRPQLTDDGQVRVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L  + IP   +          +   N     +   VSMGNPH I FVE D+    
Sbjct: 122 MGSPRLLAQEIPTTLAPGNSKIINLPLEIGN--QTWHITCVSMGNPHCITFVE-DVASIP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G     HP+F +  N    +V +   L +R WERG G+T ACG+ ACAS+VA    
Sbjct: 179 LEIIGPEFEHHPVFPQRTNTEFIQVVNPHHLKMRVWERGAGITLACGTGACASLVAGVLN 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +  +R   +++ GG L IEW + +  ++MTG A++ + GK+
Sbjct: 239 NLCDRMAIIELPGGNLEIEWSETDQRIYMTGPAERVFTGKM 279


>gi|209526281|ref|ZP_03274810.1| Diaminopimelate epimerase [Arthrospira maxima CS-328]
 gi|209493210|gb|EDZ93536.1| Diaminopimelate epimerase [Arthrospira maxima CS-328]
          Length = 287

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 139/281 (49%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R   + I     A+           D ++      D + D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRHQSEPICTQRQAVQMCDRHFGIGADGVIFALPG-DGASDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS----FTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ +F+T    +      +   T  G++  +   DG + VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAKFITELEGKTGTAIAYKINTAAGVICPELLTDGQVKVD 121

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P L    IP   S +  +     +       + +   VSMGNPH I FV+ D+    
Sbjct: 122 MGLPRLLAAEIPTTLSEN--NLKVIDVPLEVAGQVLSVTCVSMGNPHCITFVD-DVASVP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L   G L   HP F E  N     V   + + +R WERG G+T ACG+ ACASVVA    
Sbjct: 179 LTEIGPLFEHHPAFPERTNTEFIEVVRPDYVKMRVWERGAGITLACGTGACASVVAGVLT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            + +R V+V++ GG L IEW   +  ++MTG A+  ++G+L
Sbjct: 239 QRCDRQVTVELPGGCLQIEWSATDQRLYMTGPAQAVFQGQL 279


>gi|269961536|ref|ZP_06175899.1| diaminopimelate epimerase [Vibrio harveyi 1DA3]
 gi|269833765|gb|EEZ87861.1| diaminopimelate epimerase [Vibrio harveyi 1DA3]
          Length = 276

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPESDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILDVEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRAGDKTLFCG-AVSMGNPHV-VTVVDDVDTAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V +   + LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNRNHIRLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG A   ++G+L
Sbjct: 238 ENVKVSLPGGDLRISWQGPGKPLFMTGPATHVFDGQL 274


>gi|260767553|ref|ZP_05876489.1| diaminopimelate epimerase [Vibrio furnissii CIP 102972]
 gi|260617453|gb|EEX42636.1| diaminopimelate epimerase [Vibrio furnissii CIP 102972]
 gi|315178746|gb|ADT85660.1| diaminopimelate epimerase [Vibrio furnissii NCTC 11218]
          Length = 276

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  ++       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSPELIRRMADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V     D  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMVLIVEDDDQITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I  V    L     VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPSKIPF----RAKQAEKTYIMRVEEQTLFCG-AVSMGNPHV-VTVVDDVTTANVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V +   ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVLNRNEVNLRVYERGAGETQACGSGACGAVAVGVVQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V+V + GG L I W      ++MTG A   ++G+L
Sbjct: 238 DTVTVHLPGGDLEISWQGPGKPLYMTGPATHVFDGQL 274


>gi|260431874|ref|ZP_05785845.1| diaminopimelate epimerase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415702|gb|EEX08961.1| diaminopimelate epimerase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 277

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 139/281 (49%), Gaps = 16/281 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +++D R     IT      +        FDQ+ +I + +    DA +
Sbjct: 9   LPFMKMHGLGNDFVIVDARAHPVQITPALARGIGHRQFGVGFDQLAVIVNGES---DAHL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL     +   T  T  G L A++  DG  SV+MG P 
Sbjct: 66  VFYNADGSISATCGNATRCIARFLMQESGKSELTLSTSHGTLQARDAGDGLTSVNMGHPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA   D ++                P    MGNPH  FFVE D     L  FG
Sbjct: 126 LDWADIPLAEEVDTLEL----------PIEGGPVATGMGNPHCTFFVE-DAEAIPLEEFG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  N+ +A++   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 ARYEHHPLYPQRTNVQVAQIIGPDHIRMRVWERGVGITLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGK 285
            V +++ GG + I+W ++  V+MTG     + G L  +  +
Sbjct: 235 KVQIELDGGTIWIDWREDG-VWMTGPTCHVFSGTLTPEFLE 274


>gi|296120458|ref|YP_003628236.1| diaminopimelate epimerase [Planctomyces limnophilus DSM 3776]
 gi|296012798|gb|ADG66037.1| diaminopimelate epimerase [Planctomyces limnophilus DSM 3776]
          Length = 280

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 89/283 (31%), Positives = 128/283 (45%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNIT-SDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           + F KM GIGN  + +++      +   D    +S        D ++LI   +    DA 
Sbjct: 1   MRFTKMHGIGNDYVYVNLFAEKLPLAAPDLARIVSNRYKGIGGDGLILIGPSERG--DAR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD-------GSI 116
           +++ N DGSE + CGNG+RCV +++      K        G  V               +
Sbjct: 59  MQMFNADGSESEMCGNGVRCVAKYVYDHGIAKKPELRIETGRGVLTLQMFAGSSGKAERV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            V+MG PIL    IP A   D        +G        +   VSMGNPH + FV+ +L 
Sbjct: 119 RVNMGTPILKSADIPTALPGDPPVNQPLVVGDK----TISVTCVSMGNPHCVTFVD-ELT 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +   G  +  H  F   VN   A+V S   + LR WERG G T ACG+ ACA++VA 
Sbjct: 174 DAWVLGLGPQVEVHAAFPRRVNAEFAQVLSRTEIQLRVWERGSGETQACGTGACATLVAG 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
               +T+    + + GG L IEW D   VFMTG A + + G+ 
Sbjct: 234 VLSGRTDHQALIHLPGGDLEIEWPDEKEVFMTGPATEVFTGEW 276


>gi|159906120|ref|YP_001549782.1| diaminopimelate epimerase [Methanococcus maripaludis C6]
 gi|254767112|sp|A9AB27|DAPF_METM6 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|159887613|gb|ABX02550.1| Diaminopimelate epimerase [Methanococcus maripaludis C6]
          Length = 277

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 94/284 (33%), Positives = 141/284 (49%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + +D         ++    +S        D ++LI     A  D  +
Sbjct: 1   MKFTKMHGLGNDYIYVDAISQKIENPNEISRFVSDRHFGIGSDGLVLILPSDLA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGN +RCV +F+  +        T ET+ GI V +   +      + V
Sbjct: 59  RMFNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTIENDKVVLVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL  + IP+      +  +             N   VS+GNPHAI ++E ++  +
Sbjct: 119 DMGEPILKAETIPVLSEKHPVIDEEITAKDY----CYNFTCVSIGNPHAITYIE-NVEEF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G L   H  F    N+    +    ++ +R WERG G T ACG+ ACA +VAS  
Sbjct: 174 PLEKIGPLFEIHEKFPRKTNVEFVELIDDSTVKMRVWERGAGETLACGTGACAVLVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                R  +VK+LGG L IEW++ +NH++MTG A   +EG++DI
Sbjct: 234 KGYVGRKATVKLLGGDLTIEWNESDNHIYMTGPATTVFEGEIDI 277


>gi|91786956|ref|YP_547908.1| diaminopimelate epimerase [Polaromonas sp. JS666]
 gi|91696181|gb|ABE43010.1| diaminopimelate epimerase [Polaromonas sp. JS666]
          Length = 299

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 90/300 (30%), Positives = 144/300 (48%), Gaps = 17/300 (5%)

Query: 1   MQSS-----MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHD 54
           M+S+     ++ F KM+G GN  +++D      N+++     L+        DQI+ +  
Sbjct: 1   MRSADNGAMLIRFTKMQGAGNDFVMLDETRGRLNLSTAQYRFLADRHFGVGADQILSVRP 60

Query: 55  FQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENR 112
                +D    I N DG EV+ CGNG RC VRF+  +    + +   +T+ G++  +   
Sbjct: 61  SPGEGIDFEYVIHNADGGEVEQCGNGARCFVRFVREQGLTSKDAVRVKTLSGVIEPRMQA 120

Query: 113 DGSISVDMGEPILDWKLIPL------ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPH 166
           DG ++VDMG P+ +   IP       A+     ++    +         +  V+SMGNPH
Sbjct: 121 DGRVTVDMGAPVFELARIPFDAAGLTAQPAGSWEKWPLTLEDKALSATVSIAVLSMGNPH 180

Query: 167 AIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACG 226
           A+  V+ D+    +   G L+  H  F + VN    +V S   + LR +ERG G T ACG
Sbjct: 181 AVQLVD-DVDTAPVLETGPLIEHHMRFPKRVNAGFMQVVSRSRIRLRVYERGAGETLACG 239

Query: 227 SAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIKTG 284
           + ACA+VVA       +  V V+  GG L IEW    +  V MTG A   +E ++++   
Sbjct: 240 TGACAAVVAGIRWGLLDARVDVQTRGGQLTIEWAGGFDAPVMMTGPATTVFESEIEVPEL 299


>gi|311109401|ref|YP_003982254.1| diaminopimelate epimerase [Achromobacter xylosoxidans A8]
 gi|310764090|gb|ADP19539.1| diaminopimelate epimerase [Achromobacter xylosoxidans A8]
          Length = 303

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 89/290 (30%), Positives = 131/290 (45%), Gaps = 12/290 (4%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIR 65
           +F KM G GN  +V+D      ++T +   AL         DQI+L+        D   R
Sbjct: 10  NFTKMHGAGNDFVVLDGVRQTIDMTPERARALGDRHFGIGADQILLVERATRPDADFRYR 69

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC VRF+  +    R     E   GILV  +  D  ++VDMG  
Sbjct: 70  IFNSDGSEVEHCGNGARCFVRFVHEQGLSDRNPLRAEIATGILVLDQGDDEQVTVDMGST 129

Query: 124 ILDWKLIPLARSF-------DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
             +   +P   +             +     P           V++ NPHA+  V+ D+ 
Sbjct: 130 RFEPSALPFDTAGLASRVQGQDTLWELELDAPAGLPRTVALSAVAISNPHAVQVVD-DVD 188

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F   VN    ++    ++ LR +ERG G T ACG+ ACA+V A 
Sbjct: 189 TAPVAILGPLIETHPRFPRRVNAGFMQIVDRNNIRLRVFERGAGETLACGTGACAAVAAG 248

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
                 +  V V+  GG L + W+    + MTG A+  + G++DI    +
Sbjct: 249 IRRGLLDSPVRVQARGGVLTVAWNGEQ-LRMTGPAESVFTGQVDIDKLVF 297


>gi|167617503|ref|ZP_02386134.1| diaminopimelate epimerase [Burkholderia thailandensis Bt4]
          Length = 289

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 130/288 (45%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSRALPPLTDALVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+             E   G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTDKASVRVEVKHGVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDTSGLDGRREGADTLWPLPVNGATRWISVVSMGNPHAVQIVD-DAEAFP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G  + + P F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLADGPAIERDPRFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V V   GG L I W     +   + M G A   +EG +D+  
Sbjct: 242 GQLDSPVIVHTHGGTLTISWDGARDERAPLMMAGPATTVFEGVIDLPA 289


>gi|110835193|ref|YP_694052.1| diaminopimelate epimerase [Alcanivorax borkumensis SK2]
 gi|122959296|sp|Q0VM18|DAPF_ALCBS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|110648304|emb|CAL17780.1| diaminopimelate epimerase [Alcanivorax borkumensis SK2]
          Length = 281

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 89/285 (31%), Positives = 131/285 (45%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-----ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           + F KM G+GN  +VID            + +D I  L+       FDQ++++   Q   
Sbjct: 3   LRFTKMHGLGNDFMVIDGIRQSLPETGLPLPADEIRRLADRKFGVGFDQMLIVQPAQ-GD 61

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
            D   RI+N DGSEV  CGNG RC  RF+  +    +KS   ET  G +      D  I+
Sbjct: 62  ADFRYRILNADGSEVSQCGNGARCFARFVREQGLTDKKSIRVETAAGQMTLSVTDDDQIT 121

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG P      IP+    +  +         +     +   V +GNPH    VE ++  
Sbjct: 122 VDMGAPRWAPDAIPMTAKAEADNYFLV-----SGTQAWDVGAVGLGNPHCTLLVE-NVDT 175

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             + + G LL  H  F E  N+   ++ S   + LR +ERG G T ACGS ACA+VV   
Sbjct: 176 APVDTVGPLLESHEQFPERANVGFMQIVSRNEIRLRVYERGAGETLACGSGACAAVVIGQ 235

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
                +  V+V + GG L + +     + MTG A   ++G ++I 
Sbjct: 236 RRDWLDDTVTVHLPGGTLHVCYDGQGGIQMTGPASHVYDGAIEIA 280


>gi|159045768|ref|YP_001534562.1| diaminopimelate epimerase [Dinoroseobacter shibae DFL 12]
 gi|157913528|gb|ABV94961.1| diaminopimelate epimerase [Dinoroseobacter shibae DFL 12]
          Length = 282

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 90/278 (32%), Positives = 139/278 (50%), Gaps = 15/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R     ++   + AL+       FDQ+ +I        DA +
Sbjct: 12  LPFFKMHGLGNDFVVIDARAAPRPVSDRLVAALADRHRGVGFDQLAVIAPA--PEADAHL 69

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R +       +    T RG+L+A++  DG   V+MG+P 
Sbjct: 70  TFYNADGSTSAACGNATRCIARMILDETGATALRLSTDRGLLLAEDAGDGLTRVNMGQPQ 129

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             W  +PLA + D ++                P    MGNPH  FFV  D     L +FG
Sbjct: 130 TLWSEVPLAEAMDTLEL----------PIEGTPTATGMGNPHCTFFV-ADAEAIPLDTFG 178

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  N+ +A++   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 179 PRYEHHPLYPQRTNVQVAQIVGPDHIRMRVWERGVGVTLASGSSSCATGVAAARRGLTGR 238

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              + + GG L I+W ++  V+MTG     +EG+L  +
Sbjct: 239 KTRIDLDGGTLWIDWREDG-VWMTGPNMTVFEGRLTPQ 275


>gi|71064780|ref|YP_263507.1| diaminopimelate epimerase [Psychrobacter arcticus 273-4]
 gi|123649755|sp|Q4FV85|DAPF_PSYA2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71037765|gb|AAZ18073.1| diaminopimelate epimerase [Psychrobacter arcticus 273-4]
          Length = 295

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 140/280 (50%), Gaps = 8/280 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+     ++T D +  L        FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLDLTKDLVQLLGDRHLGIGFDQLLVVEPPMRPDVDFS 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+ +R    ++    ET  GI+    +  G + VDMG
Sbjct: 62  YRIFNTDGTEVEQCGNGARCFARFVQARKLSFKQRLRVETASGIISLTTDHYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP         ++ +H+           +V +MGNPHA+  V+ D+   D+ 
Sbjct: 122 KPKFEPSEIPFTPRATTKIQNAYHLDVNGTPV--QLYVANMGNPHAVIKVD-DVLDADVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S G  +  HP F E VN+   +V +   + LR +ERGVG T ACG+ ACA+V        
Sbjct: 179 SLGRAIESHPAFPERVNVGFMQVMNQRHIRLRVYERGVGETQACGTGACAAVAIGIREGW 238

Query: 242 TN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +    V  ++ GG ++I+W     V MTG     +EG  
Sbjct: 239 LDEGEDVRAQLYGGSMVIKWQPGYSVMMTGPTAFVYEGVF 278


>gi|45358480|ref|NP_988037.1| diaminopimelate epimerase [Methanococcus maripaludis S2]
 gi|74554659|sp|Q6LYS1|DAPF_METMP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|44921238|emb|CAF30473.1| Diaminopimelate epimerase [Methanococcus maripaludis S2]
          Length = 277

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 93/284 (32%), Positives = 139/284 (48%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + +D         ++    +S        D ++LI     A  D  +
Sbjct: 1   MKFTKMHGLGNDYIYVDAISQKIENPNEISKFVSDRHFGIGSDGLVLILPSDVA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGN +RCV +F+  +        T ET+ GI V +   +      + V
Sbjct: 59  RMFNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTIENGKVVLVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL  + IP+      +  +             N   VSMGNPHAI ++E ++  +
Sbjct: 119 DMGEPILKAEEIPVLSEKHPVIDEEITAKDY----CYNFTCVSMGNPHAITYIE-NVDEF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G L   H  F    N+    +    ++ +R WERG G T ACG+ ACA + AS  
Sbjct: 174 PLEKIGPLFEIHEKFPRKTNVEFVELIDKNTVKMRVWERGAGETLACGTGACAVLTASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                R  +VK+LGG L IEW++ + H++MTG A   +EG++DI
Sbjct: 234 KGYVGRKATVKLLGGDLTIEWNEFDKHIYMTGPATTVFEGEIDI 277


>gi|260574289|ref|ZP_05842294.1| diaminopimelate epimerase [Rhodobacter sp. SW2]
 gi|259023755|gb|EEW27046.1| diaminopimelate epimerase [Rhodobacter sp. SW2]
          Length = 279

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 100/272 (36%), Positives = 135/272 (49%), Gaps = 15/272 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID RG     T     AL        FDQ+  I D   A  D  +
Sbjct: 10  LAFMKMHGLGNDFVVIDSRGRGAVTTPALARALGDRHRGVGFDQLAEIRDS--AEADFAL 67

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RCV  F+     + + T  T RG L A    DG +SV+MG P 
Sbjct: 68  DFWNSDGSRAGACGNATRCVAEFVMRGSGKAAVTLTTTRGHLQAVRRADGLVSVNMGAPQ 127

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  +PLAR  D +                +P  V MGNPH +FFV  +    ++A  G
Sbjct: 128 LDWAEVPLARPADTLHL----------PISGDPVAVGMGNPHCVFFVG-NAETVNVADLG 176

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L    P+F +  N+  A +T  + L +R WERG G+T ACGS ACA+ VA+     T R
Sbjct: 177 ALFETDPLFPQKTNVEFATLTGPDRLRMRVWERGAGITLACGSGACATAVAAHRRGLTGR 236

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWE 276
            V++ + GG L I+W  +  V+MTG     ++
Sbjct: 237 KVTLDLDGGALEIDWRSDG-VWMTGPTAHVFD 267


>gi|254295753|ref|ZP_04963210.1| diaminopimelate epimerase [Burkholderia pseudomallei 406e]
 gi|157806090|gb|EDO83260.1| diaminopimelate epimerase [Burkholderia pseudomallei 406e]
          Length = 289

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 87/288 (30%), Positives = 132/288 (45%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDM-RGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++L+        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+       + S   E    ++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHSVITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S     R+          +   R   VVSMGNPHA+  V+ D   + 
Sbjct: 123 APVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVVSMGNPHAVQIVD-DAEAFA 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + + P F + VN    ++ S   ++LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            + +  V+V   GG L I W     +   + M G A   +EG +++  
Sbjct: 242 GRLDSPVTVHTHGGTLTISWNGACDERAPLMMAGPATTVFEGVIELPA 289


>gi|296532249|ref|ZP_06894993.1| diaminopimelate epimerase [Roseomonas cervicalis ATCC 49957]
 gi|296267419|gb|EFH13300.1| diaminopimelate epimerase [Roseomonas cervicalis ATCC 49957]
          Length = 276

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 103/281 (36%), Positives = 140/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D R     ++   I ALS        DQ + +   + A  D F
Sbjct: 1   MIPFRKMHGLGNDFIVVDARPAPLPLSPTRIAALSDRHRGIGCDQFITLERPE-AGADVF 59

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DGSE ++CGN  RCV   L +   R      T+RG L  +    G+I  DMG P
Sbjct: 60  MRIHNPDGSEAEACGNATRCVAWLLMAETGRDHVVVRTVRGDLPCERLAGGTIRADMGPP 119

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L W+ +PLA + D          P++   + +P   SMGNPHA FFVE  L   D  + 
Sbjct: 120 SLAWQEVPLAEAMDTT------HLPIDLGAVADPAACSMGNPHATFFVET-LEGLDWQAL 172

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G L   HP+  +  N+  A V S E + L  WERG G T ACGS ACA++V +       
Sbjct: 173 GPLAEHHPLLPQRANIGFAEVVSPEHIRLAIWERGAGPTLACGSGACATLVNAHRRGLAG 232

Query: 244 RAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIKT 283
           R   + + GG L +EW   +NHV M G     + G+ D  T
Sbjct: 233 RRARIDLPGGPLELEWRLSDNHVLMGGPVATAFLGQFDPDT 273


>gi|37678271|ref|NP_932880.1| diaminopimelate epimerase [Vibrio vulnificus YJ016]
 gi|161501834|ref|NP_760075.2| diaminopimelate epimerase [Vibrio vulnificus CMCP6]
 gi|320154949|ref|YP_004187328.1| diaminopimelate epimerase [Vibrio vulnificus MO6-24/O]
 gi|29839314|sp|Q8DD81|DAPF_VIBVU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|56748740|sp|Q7MQC1|DAPF_VIBVY RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|37197010|dbj|BAC92851.1| diaminopimelate epimerase [Vibrio vulnificus YJ016]
 gi|319930261|gb|ADV85125.1| diaminopimelate epimerase [Vibrio vulnificus MO6-24/O]
 gi|319999166|gb|AAO09602.2| diaminopimelate epimerase [Vibrio vulnificus CMCP6]
          Length = 276

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 91/277 (32%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVYFSQELIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     D  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMILDVEEDDQITVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I  V    L     VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPF----RAKQKEKTYIMRVGEKTLFCG-AVSMGNPHV-VTVVDDVDSAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V + E + LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNREQIRLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V+V + GG L I W      ++MTG A   ++G+L
Sbjct: 238 ENVTVSLPGGDLHIHWQGPGKPLYMTGPATHVFDGQL 274


>gi|134297259|ref|YP_001120994.1| diaminopimelate epimerase [Burkholderia vietnamiensis G4]
 gi|166224252|sp|A4JIQ6|DAPF_BURVG RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|134140416|gb|ABO56159.1| diaminopimelate epimerase [Burkholderia vietnamiensis G4]
          Length = 289

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 89/286 (31%), Positives = 138/286 (48%), Gaps = 11/286 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++++        D  
Sbjct: 3   LSFTKMHGAGNDFVVLDGYSHTLPPLTDVQVRALADRHFGIGADQLLVVEKPTVDGADFK 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F+T R    ++S   + ++G++      +G + VDMG
Sbjct: 63  YRIFNCDGGEVEHCGNGARCFVKFVTDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 122

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +P   S    + D +            R    VSMGNPHA+  V+ D   Y 
Sbjct: 123 APVFEPAQVPFDASGLDGRTDGNDTLWPLDVGGATRWVSTVSMGNPHAVQVVD-DAEAYP 181

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           + + G L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A    
Sbjct: 182 VLAEGPLIERHARFPKRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRR 241

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDI 281
              +  V+V   GG L I W     +   + M G A   +EG++++
Sbjct: 242 GLLDTPVTVHTHGGTLTISWDGAHDERAALTMAGPATTVFEGEIEL 287


>gi|197303586|ref|ZP_03168624.1| hypothetical protein RUMLAC_02314 [Ruminococcus lactaris ATCC
           29176]
 gi|197297320|gb|EDY31882.1| hypothetical protein RUMLAC_02314 [Ruminococcus lactaris ATCC
           29176]
          Length = 281

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 91/288 (31%), Positives = 145/288 (50%), Gaps = 16/288 (5%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDAS 59
           M+  M  F KM+G+GN  + ++       + ++ A+           D ++LI+  + A 
Sbjct: 1   MEKKM-KFTKMQGLGNDYVYVNCFKEKIEDPSALAVRISDRHFGVGSDGLILINPSKVA- 58

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA----KENRD 113
            D  + + N DGS  + CGNG+RCV +++       +++ + ET+ GI       +  + 
Sbjct: 59  -DCEMEMYNADGSRGEMCGNGIRCVGKYMYDYGLTDKEAISVETLAGIKYLQFFIENGKV 117

Query: 114 GSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
             + VDMG PIL    IP+    ++   +   +    +        +SMGNPHAI +V+ 
Sbjct: 118 AKVKVDMGSPILTPAEIPVVAEGERAVDEPIVVDGTEYRM----TCISMGNPHAIVYVD- 172

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+ +  +   G L  KH  F   VN    +V    ++++R WERG G T ACG+ ACA+ 
Sbjct: 173 DVKNLPIEKIGPLFEKHERFPNRVNTEFVKVLDRNTVEMRVWERGSGETLACGTGACATA 232

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
           VA      T   V+VK+LGG L IEW  + N VFMTG AK  ++G  +
Sbjct: 233 VACILNGLTEEKVTVKLLGGDLEIEWDREKNKVFMTGPAKVVFDGVWE 280


>gi|84514984|ref|ZP_01002347.1| diaminopimelate epimerase [Loktanella vestfoldensis SKA53]
 gi|84511143|gb|EAQ07597.1| diaminopimelate epimerase [Loktanella vestfoldensis SKA53]
          Length = 281

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 145/280 (51%), Gaps = 15/280 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVD 61
            + + F KM G+GN  +V+D RG    +T+  + A++       FDQ+ +I        D
Sbjct: 16  QTFLPFRKMHGLGNDFVVVDERGTTPRVTAALVQAIADRHRGVGFDQLAVI--SDTPDAD 73

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
             +   N DGS   +CGN  RC+ R +  +  +++ T  T RG L A +   G  SV+MG
Sbjct: 74  LHLTFWNSDGSTAATCGNATRCIARLVMDQTGQRNLTITTDRGTLQAVDTGGGLTSVNMG 133

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P LDW  IPLA   D +                +P    MGNPH  FFV+ D    DLA
Sbjct: 134 QPQLDWHEIPLAEQIDTLQL----------PIDGSPTATGMGNPHCTFFVD-DAEAVDLA 182

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+  HP+F +  N+  A +   + L +R WERGVG+T A GS++CA+ VA+     
Sbjct: 183 MRGALIEHHPLFPQRTNVQFASLIGPDHLRMRVWERGVGVTLASGSSSCATAVAAARRGL 242

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           T R V++ + GG L I+W D+  ++MTG     ++G+  +
Sbjct: 243 TGRKVTITLDGGDLAIDWRDDG-IWMTGATAYVFDGQWRL 281


>gi|323500160|ref|ZP_08105105.1| diaminopimelate epimerase [Vibrio sinaloensis DSM 21326]
 gi|323314789|gb|EGA67855.1| diaminopimelate epimerase [Vibrio sinaloensis DSM 21326]
          Length = 276

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V     D  ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMVLNIEEDDQVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I   +   L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPNKIPFKAK----QTEKTYILRADEKTLFCG-AVSMGNPHV-VTVVDDVNTTDVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVLSPKEVNLRVYERGAGETQACGSGACGAVAVGVVQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG A   ++G+L
Sbjct: 238 ENVVVHLPGGDLKIRWQGPGKPLFMTGPATHVFDGQL 274


>gi|323495293|ref|ZP_08100374.1| diaminopimelate epimerase [Vibrio brasiliensis LMG 20546]
 gi|323310470|gb|EGA63653.1| diaminopimelate epimerase [Vibrio brasiliensis LMG 20546]
          Length = 276

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 92/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V     D  ++V+MGEP
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMVLNIEEDDQVTVNMGEP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I   +   L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPGKIPFKAK----QTEKTYILRADDKTLFCG-AVSMGNPHV-VTVVDDVTTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V   + ++LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVRRDEVNLRVYERGAGETQACGSGACGAVAVGIVQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      ++MTG A   ++G+L
Sbjct: 238 EKVKVNLPGGSLQISWQGPGKPLYMTGPATHVFDGQL 274


>gi|269964930|ref|ZP_06179100.1| diaminopimelate epimerase [Vibrio alginolyticus 40B]
 gi|269830406|gb|EEZ84630.1| diaminopimelate epimerase [Vibrio alginolyticus 40B]
          Length = 276

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILNIEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP      + ++        N LF      VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPFKAK--QKEKTYIMRAGDNTLFCG---AVSMGNPHV-VTVVDDVDTAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + + LR +ERG G T ACGS ACA+V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDHIRLRVYERGAGETQACGSGACAAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG     ++G+L
Sbjct: 238 ENVKVSLPGGELRIAWQGPGKPLFMTGPTTHVFDGQL 274


>gi|291551103|emb|CBL27365.1| diaminopimelate epimerase [Ruminococcus torques L2-14]
          Length = 276

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 88/283 (31%), Positives = 136/283 (48%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  + ++      ++ ++ AI           D ++LI   + A  D  +
Sbjct: 1   MKFTKMQGIGNDYVYVNCFEEKVEDPSALAIQVSDRHFGIGSDGLILICPSEVA--DCEM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILV----AKENRDGSISV 118
            + N DGS  + CGNG+RCV +++       +   T ET+ GI       +  +   + V
Sbjct: 59  AMYNADGSRGEMCGNGVRCVGKYMYDYGLTDKTEITVETLAGIKTLQLFVENGKVAKVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PIL    IP+    DK   +   +    +        VSMGNPHA+ +V+ D+ + 
Sbjct: 119 DMGSPILTPAEIPVVAEGDKAVDEPILVDGKEYHM----TCVSMGNPHAVVYVD-DVNNL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G     H  F   VN    +V    ++ +R WERG   T ACG+ ACA  V+   
Sbjct: 174 PIEEIGPKFESHERFPRRVNTEFVKVLDRHTVQMRVWERGSAETLACGTGACAVAVSCIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
              T   V+VK+LGG L I+W  + N V+MTG A   ++G+L 
Sbjct: 234 NGLTEDEVTVKLLGGDLEIQWDQEKNTVYMTGPATVVFDGELK 276


>gi|294142608|ref|YP_003558586.1| diaminopimelate epimerase [Shewanella violacea DSS12]
 gi|293329077|dbj|BAJ03808.1| diaminopimelate epimerase [Shewanella violacea DSS12]
          Length = 280

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 91/279 (32%), Positives = 140/279 (50%), Gaps = 5/279 (1%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIKRLANRHFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC  RF+ ++    ++     T  G L  +  RDG+++V+MG
Sbjct: 61  YRIFNADGGEVEQCGNGARCFARFVRNKGLTNKQKIKVSTSNGKLTLRLERDGNVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PIL+   IP      +           + +       VS+GNPH +  VE D+   D+ 
Sbjct: 121 IPILEPSKIPFNAKRAEKTYLLQTDTAESKMQTFLCGAVSLGNPHCVLDVE-DVQATDVE 179

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL +H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+ V      K
Sbjct: 180 GIGALLTQHERFPKGVNVGFMQVINSGHIKLRVYERGAAETLACGTGACAAAVVGQLQGK 239

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
            +  V V + GG L I W      ++MTG A+  ++G++
Sbjct: 240 LDNRVRVDLPGGTLTINWEGEGKPLWMTGPAEHVYDGQI 278


>gi|119475310|ref|ZP_01615663.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2143]
 gi|119451513|gb|EAW32746.1| diaminopimelate epimerase [marine gamma proteobacterium HTCC2143]
          Length = 276

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 142/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM+G+GN  +V+D+     N+ ++ +  L+        DQ++++       VD  
Sbjct: 2   LLRFTKMQGLGNDFVVLDLVTQRFNLQAEHVRKLADRHFGIGCDQLLVVETPMQPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  +F+  +    +     ET  GI+      D  I V+MG
Sbjct: 62  YRIYNGDGNEVEQCGNGARCFAKFVRDKKLTGKNKIRVETNSGIIELSVMEDRQIRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P+L+   IP   S                    +   VS+GNPHAI  VE D+    ++
Sbjct: 122 KPLLEPADIPFTASKRANTYTLLVDD-----EEVSISAVSVGNPHAIITVE-DIDTAPVS 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F + VN+   +V S + ++LR +ERG G T ACGS ACA++V+      
Sbjct: 176 ILGPAIECHTDFPQRVNVGFMQVVSRKEINLRVFERGAGETLACGSGACAAMVSGQLQGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            ++ ++  + GG L +EWH   H V MTG A   +EG++ +
Sbjct: 236 LDQQITANLSGGSLTLEWHGEGHPVMMTGPASNVFEGQITL 276


>gi|300864689|ref|ZP_07109546.1| Diaminopimelate epimerase [Oscillatoria sp. PCC 6506]
 gi|300337350|emb|CBN54694.1| Diaminopimelate epimerase [Oscillatoria sp. PCC 6506]
          Length = 278

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAIN--ALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++F K  G+GN  ++ID R   + I +                D ++     Q+   D  
Sbjct: 3   IEFTKYHGLGNDFILIDNRHQSEPILTLQQAEELCDRHFGIGGDGVIFALPGQN-GTDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFT---FETIRGILVAKENRDGSISVDM 120
           +RI N DGSE + CGNG+RC+ +F+       + T    +T+ G++  +   DG + VDM
Sbjct: 62  MRIYNSDGSEAEMCGNGIRCLAKFIADLEGVNAKTQYRIDTLAGVMTPELLADGQVKVDM 121

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L    IP     +  DR    +             VSMGNPH I FVE D+    L
Sbjct: 122 GIPRLLAAEIPTT--LESPDRKVVELPLEVAGQSWLVTCVSMGNPHCITFVE-DVSAIAL 178

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
            + G L   H +F +  N    ++   + + +R WERG G+T ACG+ ACASVVA     
Sbjct: 179 ETIGPLFEHHAVFPQRTNTEFIQIIRRDYVKMRVWERGAGVTLACGTGACASVVAGVLAG 238

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           K +R  +V++ GG L IEW   +  ++MTG A + + GK+
Sbjct: 239 KCDRIAAVELPGGILQIEWSQVDQRLYMTGPAVQVFAGKI 278


>gi|294788152|ref|ZP_06753395.1| diaminopimelate epimerase [Simonsiella muelleri ATCC 29453]
 gi|294483583|gb|EFG31267.1| diaminopimelate epimerase [Simonsiella muelleri ATCC 29453]
          Length = 282

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 92/279 (32%), Positives = 138/279 (49%), Gaps = 7/279 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAIN-ALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +VID      +  +  I           FDQ++++   Q   VD   
Sbjct: 4   LKFSKMHGLGNDFMVIDATRQTFDTANAPIREWADRHTGVGFDQLLIVESSQTEGVDFGY 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG RC V+F+T +    ++    +T +GI+  + N DG ++V+MG+
Sbjct: 64  RIFNADGSEVEQCGNGARCFVKFVTEQGLTDKQEIVVQTAKGIIKPRLNDDGLVTVNMGQ 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P    + +P                 V  L      +V+MGNPHA+ +V  ++    + S
Sbjct: 124 PRFAPEDVPFVL-RSGEQVGAVSYIVVKDLDSAEMSLVNMGNPHAVMWVG-NVDDAPVES 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           +G  L  H  F + VN+   +V     + LR +ERG G T ACG+ ACA+VVA   L   
Sbjct: 182 WGAALQNHQRFPQKVNVGFMQVVDKNHIKLRVYERGAGETQACGTGACAAVVAGVRLGAV 241

Query: 243 --NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
                V V + GG L I W + + V M G A   + G+L
Sbjct: 242 ASGEWVRVVLPGGELQISWEEGSDVMMMGPAVTVFSGEL 280


>gi|114766737|ref|ZP_01445675.1| diaminopimelate epimerase [Pelagibaca bermudensis HTCC2601]
 gi|114541056|gb|EAU44112.1| diaminopimelate epimerase [Roseovarius sp. HTCC2601]
          Length = 279

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 143/286 (50%), Gaps = 19/286 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     +T     A++       FDQ+ LI        DA +
Sbjct: 11  LSFMKMHGLGNDFVVLDGRARRITVTPGLARAIADRHRGVGFDQLALIE---TGEGDARL 67

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL     +   T  T RG L A++  DG  SV+MG P 
Sbjct: 68  TFYNADGSTAGACGNATRCIARFLMDESGKDRLTLVTERGKLFAQDAGDGLTSVNMGHPQ 127

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   D +                 P    MGNPH  FFVE +    DL +FG
Sbjct: 128 LDWQDIPLASEMDTLAL----------PIEGTPVATGMGNPHCTFFVE-NAEAIDLEAFG 176

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  N+ +A +   + L +R WERGVG+T + GS++CA+ VA+     T R
Sbjct: 177 PRFEHHPLYPQRTNVQVASLIGPDHLRMRVWERGVGVTLSSGSSSCATAVAAARRGLTGR 236

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKN 290
            V++++ GG L I+W D+  V+MTG     ++G        W++  
Sbjct: 237 KVTLELDGGTLQIDWRDDG-VWMTGATAHVFDGSFGP---AWLEAA 278


>gi|291520212|emb|CBK75433.1| diaminopimelate epimerase [Butyrivibrio fibrisolvens 16/4]
          Length = 277

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 88/284 (30%), Positives = 133/284 (46%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +++        ++ +I           D ++ I     A  D  +
Sbjct: 1   MKFTKMHGCGNDYVYVNLFEEKVENPAEVSIKVSDRHFGIGSDGLITIGPSDKA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKE------NRDGSISV 118
            I N DGSE + CGNG+RCV +++       +       G  V          +   + V
Sbjct: 59  HIYNADGSEAEMCGNGIRCVAKYVYDHHLTDNTEITVETGAGVLTLILFPENGKVQQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPI     IP+    DK+  +   +G        N   VSMGNPHA+ FV+ D   +
Sbjct: 119 DMGEPIHTPAEIPVVADGDKVIDEPIEVGGK----TWNMTCVSMGNPHAVVFVD-DTASF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L ++G L   H  F +  N    ++ S    ++R WERG   T ACG+  CA V+A   
Sbjct: 174 PLETYGPLFENHERFPKRTNTEFVQIISRTEANMRVWERGSAETWACGTGTCACVMACIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
             KT   V V + GG L IE+  ++NHVFMTG A + + G++++
Sbjct: 234 NGKTEDKVLVHLRGGDLTIEYDRESNHVFMTGPATEVFSGEIEV 277


>gi|113474945|ref|YP_721006.1| diaminopimelate epimerase [Trichodesmium erythraeum IMS101]
 gi|123056925|sp|Q116P1|DAPF_TRIEI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|110165993|gb|ABG50533.1| diaminopimelate epimerase [Trichodesmium erythraeum IMS101]
          Length = 278

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 96/277 (34%), Positives = 133/277 (48%), Gaps = 9/277 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           F K  G+GN  ++ID R     I     AI     +     D ++          D  +R
Sbjct: 5   FTKYHGLGNDFILIDNRHQLQPILTPEQAIELCDRNFGIGADGVIFALPG-VKQTDYTMR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSE + CGNG+RC+ +F+       +  +   T  GI+V +   DG ++VDMG+P
Sbjct: 64  IFNSDGSEPEMCGNGIRCLAKFIAELENNNKTKYNIHTGAGIIVPELQGDGQVTVDMGQP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            L    IP   +    D                   VSMGNPH I FVE D+   DLA  
Sbjct: 124 RLLASEIPTTLA--NADDKVVDQLLEVGGKSWFVTCVSMGNPHCITFVE-DVTAIDLAKI 180

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G     +P+F E  N    +V S + + +R WERG G T ACG+ ACASVVA        
Sbjct: 181 GPKFEHNPVFPERTNTEFIQVISPKYVKMRVWERGAGATLACGTGACASVVAGVLTQNNE 240

Query: 244 RAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           R V+V++ GG L IEW   +  ++MTG A+K + G +
Sbjct: 241 RLVTVELPGGCLEIEWSTIDQKIYMTGPAEKVFTGII 277


>gi|255079222|ref|XP_002503191.1| predicted protein [Micromonas sp. RCC299]
 gi|226518457|gb|ACO64449.1| predicted protein [Micromonas sp. RCC299]
          Length = 331

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 86/290 (29%), Positives = 135/290 (46%), Gaps = 16/290 (5%)

Query: 7   DFAKMEGIGNKILVIDMRGC-HDNITSDAINALSTD-DNTHFDQIMLIHDFQ--DASVDA 62
            F K +G+GN  +++D R      ++S+    L         D ++            D 
Sbjct: 43  KFYKYQGLGNDFVLVDNRDSSEIKLSSERCAQLCDRNFGIGADGVIFAMPPGLVQKDEDY 102

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
            +R+ N DG+E + CGNG+RC+  F         K++   T+ G++  +   DG +SVDM
Sbjct: 103 SMRMYNSDGTEPEMCGNGIRCLANFVAKMDGADPKAYKVGTLAGLIQPEVRADGQVSVDM 162

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED------- 173
           GEP LD   +P        D                   VSMGNPH + F ++       
Sbjct: 163 GEPTLDPPKVPCTFEA-TQDGAAVRAKMEVDGETWLVTAVSMGNPHCVTFGKEGECDEEG 221

Query: 174 -DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
             +  + L+ +G +  KHP F    N     V +   + +  WERG G T ACG+ ACA+
Sbjct: 222 IKVDSFALSHYGPMFEKHPAFPAKTNTEFTEVVNRNYVKMHVWERGAGATLACGTGACAT 281

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           VVA+    +T R  +V++ GG L IEW + +N V MTG A+  ++G + +
Sbjct: 282 VVAAVLEGRTERKCTVELPGGPLEIEWRESDNRVIMTGPAELVFDGVVAV 331


>gi|103488207|ref|YP_617768.1| diaminopimelate epimerase [Sphingopyxis alaskensis RB2256]
 gi|123252939|sp|Q1GPI7|DAPF_SPHAL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|98978284|gb|ABF54435.1| diaminopimelate epimerase [Sphingopyxis alaskensis RB2256]
          Length = 268

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 99/275 (36%), Positives = 138/275 (50%), Gaps = 16/275 (5%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
            F KM G+GN  +VID R     +T    +A++        DQ++L+     A  D  +R
Sbjct: 4   RFTKMHGLGNDFVVIDARVAPVEMTPARAHAIADRRHGIGCDQLILLEPSTSA--DVKMR 61

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I N DG EV++CGN  RCV          K    ET+ G+L      DG   V +GEP+ 
Sbjct: 62  IFNADGGEVEACGNATRCVATL-----IGKPAVIETLAGMLRVTP-ADGGAEVTLGEPVF 115

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPLA   D  D       PV    L +   V++GNPH +FFV  +     L   G 
Sbjct: 116 DWDHIPLAMPMDTRD------MPVAWDELEHGAAVNVGNPHIVFFV-PEADAVALDQLGP 168

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            +   P+F E VN+++A +     L LR WERGVGLT ACG+ ACA+ VA+         
Sbjct: 169 RIETDPLFPERVNVNVASLDGENQLQLRVWERGVGLTQACGTGACATAVAAIRAGLVRSP 228

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
           V+V + GG L+I W     + M+G A + ++G+ D
Sbjct: 229 VTVALPGGDLVIRWAPGEPIVMSGAATRVFDGETD 263


>gi|148244654|ref|YP_001219348.1| diaminopimelate epimerase [Candidatus Vesicomyosocius okutanii HA]
 gi|166225761|sp|A5CWN5|DAPF_VESOH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146326481|dbj|BAF61624.1| diaminopimelate epimerase [Candidatus Vesicomyosocius okutanii HA]
          Length = 271

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 79/280 (28%), Positives = 132/280 (47%), Gaps = 13/280 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D         +  I  L+       FDQ++++       VD  
Sbjct: 2   LINFTKMHGLGNDFMVVDNLAGDITFNAKKITNLANRAFGIGFDQLLVVETSNIRGVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
             I N +GSEV+ CGNG RC  RF+  +        T +T   I+    N D ++ VDMG
Sbjct: 62  YVIYNSNGSEVEQCGNGARCFARFVNYKNLTHSNPITVKTRSNIISLHLNDDNTVCVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IPL                   +   +   +S+GNPH +  V+ D+   D+ 
Sbjct: 122 KPSFNPADIPLLVP---------QQSEYYQIEGFDLGAISIGNPHCVMLVK-DVNTIDVN 171

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           +    + +  +     N+   ++ +   ++LR +ERG   T ACGS ACA+V        
Sbjct: 172 TIALKIQQSELLPNQANIGFMQILNTHEINLRVYERGSEETLACGSGACAAVAYGVEQGL 231

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             + V V + GG  LIE+    H+F++G A+  +EG+++I
Sbjct: 232 LKKNVVVHLSGGDALIEYTQGGHIFLSGPAQFVFEGQVEI 271


>gi|91227529|ref|ZP_01261866.1| diaminopimelate epimerase [Vibrio alginolyticus 12G01]
 gi|91188553|gb|EAS74845.1| diaminopimelate epimerase [Vibrio alginolyticus 12G01]
          Length = 276

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILNIEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP      + ++        N LF      VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPFKAK--QKEKTYIMRAGDNTLFCG---AVSMGNPHV-VTVVDDVDTAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + + LR +ERG G T ACGS ACA+V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVMSRDHIRLRVYERGAGETQACGSGACAAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG     ++G+L
Sbjct: 238 ENVKVSLPGGELRIAWQGPGKPLFMTGPTTHVFDGQL 274


>gi|326204224|ref|ZP_08194084.1| diaminopimelate epimerase [Clostridium papyrosolvens DSM 2782]
 gi|325985735|gb|EGD46571.1| diaminopimelate epimerase [Clostridium papyrosolvens DSM 2782]
          Length = 277

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 100/284 (35%), Positives = 153/284 (53%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + +D       N +  +            D ++LI     A  D  +
Sbjct: 1   MKFTKMQGLGNDYIYVDCTKNIIDNPSVVSKKVSDRHFGIGSDGLVLIMKSDIA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVA----KENRDGSISV 118
           R+ N DGSE + CGN +RCV +++       +K+ T ET+ GI V     ++N+   + V
Sbjct: 59  RMFNSDGSESEMCGNAIRCVGKYVFDNGLTDKKNLTIETLAGIKVLDLKIEDNKVVQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL+ K IP+    D+   +   +   N+        VSMGNPHAI +V+ D   +
Sbjct: 119 DMGEPILESKQIPVDSEKDRFISESVEVDGYNYK----VTAVSMGNPHAITYVD-DTASF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G  +  H +F + +N     V    +L +R WERG G T ACG+ A A +VAS  
Sbjct: 174 PLYEVGPKMETHKLFPKKINAEFVEVIDRTTLKMRVWERGAGETLACGTGASAVLVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              + RA ++K+LGG L+IEW + +NHV+MTG A+K +EG+++I
Sbjct: 234 NGLSERAATIKLLGGDLIIEWSEKDNHVYMTGPAEKVFEGEIEI 277


>gi|326796186|ref|YP_004314006.1| diaminopimelate epimerase [Marinomonas mediterranea MMB-1]
 gi|326546950|gb|ADZ92170.1| Diaminopimelate epimerase [Marinomonas mediterranea MMB-1]
          Length = 278

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 137/281 (48%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           ++ F+KM G+GN   V+D          + I  L        FDQ++++       +D  
Sbjct: 2   LLKFSKMHGLGNDFAVVDAVSRKVYFNKEQIEFLGDRNRGIGFDQLLIVEPPTSPDMDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N +GSEV+ CGNG RC  +F+  +    +     ET +G +      DG ++VDMG
Sbjct: 62  YRIYNSNGSEVEHCGNGARCFAKFVIEKDLTNKSVINVETKQGQIQLHVQDDGEVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      +P   +  + D    ++     + L     VS+GNPHA+  V+  L    ++
Sbjct: 122 APSFAPADLPFDATEKQDDLYTLNLEGYGSVEL---TPVSVGNPHAVIRVDR-LTDEIVS 177

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G L+  H  F   VN+    V S + ++LR +ER VG T ACG+  CA++VA      
Sbjct: 178 TVGPLVESHSAFPANVNVGFMEVMSRDEVNLRVYERDVGETQACGTGTCAAIVAGIRQGW 237

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            N  V+  +LGG L IEW      + MTG A K +EG++ +
Sbjct: 238 LNSKVTAHLLGGDLRIEWQGEGSPIMMTGPATKVFEGQIYL 278


>gi|293602485|ref|ZP_06684931.1| diaminopimelate epimerase [Achromobacter piechaudii ATCC 43553]
 gi|292819247|gb|EFF78282.1| diaminopimelate epimerase [Achromobacter piechaudii ATCC 43553]
          Length = 297

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 90/290 (31%), Positives = 134/290 (46%), Gaps = 12/290 (4%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIR 65
           +F KM G GN  +V+D       +T +   AL         DQI+++     A  D   R
Sbjct: 4   NFTKMHGAGNDFVVLDGVRQTIEMTPERARALGDRHFGIGADQILVVERPTVADADFRYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC VRF+  +    R     +   GILV  E  D  ++VDMG  
Sbjct: 64  IFNSDGSEVEHCGNGARCFVRFVHEQGLSDRNPLRAQIATGILVLDEGDDEQVTVDMGST 123

Query: 124 ILDWKLIPLA-------RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
             + + +P         R  +    +     P           V++ NPHA+  V+ ++ 
Sbjct: 124 RFEPEALPFDTAGLASMREGEDTLWELDLDAPDGVPAKVWLSAVAISNPHAVQVVD-NVD 182

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F+  VN    +V    ++ LR +ERG G T ACG+ ACA+V A 
Sbjct: 183 TAPVAVQGPLIETHPRFARRVNAGFLQVMDRHNVRLRVFERGAGETLACGTGACAAVAAG 242

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
                    V V+  GG L + W+ +  + MTG A+  + G++DI    +
Sbjct: 243 IRRGLLESPVRVQTRGGVLTVAWNGDQ-LRMTGPAESVFTGQVDIDKLVF 291


>gi|304392645|ref|ZP_07374585.1| diaminopimelate epimerase [Ahrensia sp. R2A130]
 gi|303295275|gb|EFL89635.1| diaminopimelate epimerase [Ahrensia sp. R2A130]
          Length = 288

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 135/284 (47%), Positives = 170/284 (59%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           V F+KM GIGN+I+V D+RG  D +T +A  AL  D +T FDQ+M IHD  D + DA IR
Sbjct: 5   VSFSKMNGIGNRIVVADLRGRADVVTEEAARALGHDPDTGFDQLMAIHDAGDENRDATIR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           I N DGS   +CGNG RCVV +L  R     F F      L AK   DG ISV+MG P  
Sbjct: 65  IYNTDGSRAGACGNGTRCVVDWLHQRGGGNDFRFAVDGQPLSAKRLEDGRISVNMGVPRF 124

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  IPL+  F         +GP+    L  P V ++GNPH +FF E+D   Y L  FG 
Sbjct: 125 DWTQIPLSEEFADTSGIELEVGPLGAPLLHTPAVANIGNPHCVFFAENDPDTYALDKFGP 184

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           +L  H +F +  N+SIA+VTS  ++ LRTWERG GLT ACGSAACA+VV +     T R 
Sbjct: 185 MLEHHMLFPDRANISIAQVTSPTTMKLRTWERGAGLTLACGSAACAAVVCAVRRELTERH 244

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
           V+V + GG L IEW D+N + MTG A  E++G  D  TG W + 
Sbjct: 245 VTVSLPGGDLDIEWRDDNFIIMTGTATHEFDGTFDPATGGWERA 288


>gi|297617036|ref|YP_003702195.1| diaminopimelate epimerase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144873|gb|ADI01630.1| diaminopimelate epimerase [Syntrophothermus lipocalidus DSM 12680]
          Length = 282

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 97/287 (33%), Positives = 151/287 (52%), Gaps = 17/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC---HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           + F KM G+GN  +VI+        ++ +  AI           D ++++   +D  +D 
Sbjct: 1   MRFTKMHGLGNDFIVIEAEKSELSPEDYSRTAIKLCDRHFGIGGDGLVIVG--KDRELDV 58

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIR------GILVAKENRDGSI 116
           F+RI N DGSE + CGN +RCV +F+  R    +               ++ K      +
Sbjct: 59  FMRIFNPDGSEPEMCGNAIRCVSKFVWERGLVSTTRISVNTLAGPRYPEVILKNGEVEKV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEPIL+  LIP+  S  K+  +                 VSMGNPH + FV+ +  
Sbjct: 119 RVDMGEPILERSLIPMLGSPGKVVGEELDTTAGRFRI----TAVSMGNPHCVVFVD-EFS 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              ++ +G +L  HP+F    N+  A++    ++ +R WERG G T ACG+ ACA++VAS
Sbjct: 174 SVPVSEWGPVLENHPVFPSRTNVEFAKIEDENTVSMRVWERGAGETLACGTGACATLVAS 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
                T R  +V++ GG L+IEW  DNNHV+MTGEAK+ + G++D++
Sbjct: 234 YLNDLTGRRATVRLKGGELIIEWDPDNNHVYMTGEAKEVFTGEVDLR 280


>gi|88808555|ref|ZP_01124065.1| diaminopimelate epimerase [Synechococcus sp. WH 7805]
 gi|88787543|gb|EAR18700.1| diaminopimelate epimerase [Synechococcus sp. WH 7805]
          Length = 368

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 90/288 (31%), Positives = 139/288 (48%), Gaps = 14/288 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDN-----ITSDAINA-LSTDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  ++++ R            +D +            D ++L    Q  
Sbjct: 1   MLQFSKYQGLGNDFILVEGRDGRLPESITSPNADWVRKVCDRRFGLGGDGLILALPPQ-G 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             D  +RI N DGSE + CGNG+RC+ RF       +  +S+  ET  G ++ +  +DG 
Sbjct: 60  QGDLRMRIFNADGSEAEMCGNGIRCLARFLADSDGDLPGRSWRIETPAGQIIPELQQDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P L  + +P   S D+    R  +         +   V MGNPH +  V+ DL
Sbjct: 120 IRVDMGAPFLKPEAVPTLLSPDENGLPRGEVTR--EGLTLSLAAVGMGNPHVVVPVD-DL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 + G  L   P+F    N+   +V S + L++R WERG G T ACG+ ACA++VA
Sbjct: 177 ETIPFEALGAQLECDPIFPAKTNVHFLKVLSRQHLEIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
           +  L  ++   +V + GG L I W      VFMTG A   ++G ++  
Sbjct: 237 AFLLGLSDSEATVVLPGGPLSISWPDQQGSVFMTGPAVAVFDGVMNPD 284


>gi|284006598|emb|CBA71859.1| diaminopimelate epimerase [Arsenophonus nasoniae]
          Length = 269

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 86/273 (31%), Positives = 125/273 (45%), Gaps = 10/273 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAI-NALSTDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D    +   + + I           FDQ++++    D  +D   RI N 
Sbjct: 1   MHGLGNDFMVVDAVTQNVYFSPELICRLSDRHRGIGFDQLLVVEAPYDPDLDFHYRIFNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DGSEV  CGNG RC  RF+  +    ++     T  G L      +  + V+MG P  + 
Sbjct: 61  DGSEVAQCGNGARCFARFVRLKKLTNKRDIKVSTQSGRLTLSVAENEDVCVNMGVPEFEP 120

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             +P         +                 VVS+GNPH +  VE D+   ++A  G +L
Sbjct: 121 NKVPFKA-----QKSEKTYIIRTQQQTILCGVVSIGNPHCVLQVE-DIDTAEVALLGPML 174

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
            KH  F E  N+   +V   E + LR  ERGVG T ACGS ACA+V          ++V 
Sbjct: 175 EKHERFPERANIGFMQVIDHEHIRLRVHERGVGETQACGSGACAAVAIGIQQGLLRKSVR 234

Query: 248 VKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           V + GG L I W+   H +FMTG A   ++G +
Sbjct: 235 VDLPGGMLKIRWNGLGHPLFMTGPATHVYDGVI 267


>gi|93005051|ref|YP_579488.1| diaminopimelate epimerase [Psychrobacter cryohalolentis K5]
 gi|122416051|sp|Q1QE99|DAPF_PSYCK RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|92392729|gb|ABE74004.1| diaminopimelate epimerase [Psychrobacter cryohalolentis K5]
          Length = 295

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 141/280 (50%), Gaps = 8/280 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +VID+     ++T D +  L        FDQ++++       VD  
Sbjct: 2   LIEFTKMHGLGNDFMVIDLVTQRLDLTKDLVQLLGDRHLGIGFDQLLVVEPPMRPDVDFS 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG+EV+ CGNG RC  RF+ +R    ++    ET  GI+    +R G + VDMG
Sbjct: 62  YRIFNTDGTEVEQCGNGARCFARFVQARKLSFKQRLRVETASGIISLTTDRYGWVEVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   IP         ++ +H+           +V +MGNPHA+  V+ D+   D+ 
Sbjct: 122 KPKFEPSEIPFTPRAITKIQNAYHLDVNGTPV--QLYVANMGNPHAVIKVD-DVLDADVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  +  HP F E VN+   ++ +   + LR +ERGVG T ACG+ ACA+V        
Sbjct: 179 TLGKAIESHPAFPERVNVGFMQIMNQRHIRLRVFERGVGETQACGTGACAAVAIGIREGW 238

Query: 242 TN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            +    V  ++ GG ++I+W     V MTG     +EG  
Sbjct: 239 LDEGEDVRAQLYGGSMVIKWQPGYSVMMTGPTAFVYEGVF 278


>gi|148978772|ref|ZP_01815152.1| diaminopimelate epimerase [Vibrionales bacterium SWAT-3]
 gi|145962193|gb|EDK27477.1| diaminopimelate epimerase [Vibrionales bacterium SWAT-3]
          Length = 276

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V K   +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSINVSTKKGKMVLKIEENDLITVNMGIP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I   +   L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPSKIPFKAKQP----EKTYILRTDAHTLFCG-AVSMGNPHV-VTVVDDVDTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V + E + LR +ERG G T ACGS AC +V          
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNREEVRLRVYERGAGETQACGSGACGAVAVGITQGLLA 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V++ GG L I W      ++MTG A   ++G+L
Sbjct: 238 ENVKVRLPGGDLHISWQGPGKPLYMTGPATHVFDGQL 274


>gi|163796736|ref|ZP_02190694.1| Diaminopimelate epimerase [alpha proteobacterium BAL199]
 gi|159177990|gb|EDP62537.1| Diaminopimelate epimerase [alpha proteobacterium BAL199]
          Length = 278

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 97/276 (35%), Positives = 137/276 (49%), Gaps = 8/276 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     ++     A+        +DQ + I   ++    A++
Sbjct: 4   LAFTKMHGLGNDFVVVDGRVHPATLSEVQYRAVGDRRRGVGYDQFLTILPARNGGT-AYM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
            I N DG+E Q+CGNG RCV   L     +     ETI G L+  +  DG ++VDMG   
Sbjct: 63  AIHNPDGTEAQACGNGTRCVAAVLMGETGQSEVAIETIAGRLICTDAGDGRVTVDMGPAN 122

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   D        +             V+MGNPHA+FFV  D    DL++ G
Sbjct: 123 LDWRAIPLASDTD-----TLSVTVPEAGTFGPATAVNMGNPHAVFFV-PDAEAVDLSTVG 176

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +    +F E  N+    V + + L +R WER  G+T ACGS ACA++VA+     T R
Sbjct: 177 PRIEHSAVFPERANIEFVTVLARDRLRMRVWERSAGITQACGSGACAALVAAVRRGLTER 236

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             +V + GG L I W  + HV MTG     + G LD
Sbjct: 237 RATVVLDGGPLEIFWRSDGHVEMTGPVATSFAGTLD 272


>gi|325261721|ref|ZP_08128459.1| diaminopimelate epimerase [Clostridium sp. D5]
 gi|324033175|gb|EGB94452.1| diaminopimelate epimerase [Clostridium sp. D5]
          Length = 282

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 85/288 (29%), Positives = 142/288 (49%), Gaps = 15/288 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++       N +  A+           D ++LI+  + A  D  +
Sbjct: 1   MKFTKMQGLGNDYVYVNGFTERIENPSEVAVKVSDRHFGIGSDGLILINPSKVA--DFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDG----SISV 118
            + N DGS  + CGNGMRCV    +      +     ET+ GI   + + +      + V
Sbjct: 59  EMYNADGSRGEMCGNGMRCVGKYVYDYGLTDKTEIAVETLGGIKYLELSVENGKVVQVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG+P L   LIP+    + +  +   +    +        VSMGNPH + +++ D+ H 
Sbjct: 119 DMGKPELKSALIPIVSDEEMVINEPIIVDGKEYKMTG----VSMGNPHTVVYMD-DIEHL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G     H  F + +N   A V   +++ +R WERG G T ACG+ ACA  V+S  
Sbjct: 174 DIEKTGPKFEYHERFPKRINTEFAAVLDRQTVSMRVWERGSGETLACGTGACAVAVSSIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIKTGK 285
              T   V+V++LGG LLI+W  + + V+MTG A+  ++G+ +  + +
Sbjct: 234 NGLTEDEVTVRLLGGDLLIKWDREKDTVYMTGPAEVVFDGEWNQSSKE 281


>gi|84393559|ref|ZP_00992313.1| diaminopimelate epimerase [Vibrio splendidus 12B01]
 gi|84375838|gb|EAP92731.1| diaminopimelate epimerase [Vibrio splendidus 12B01]
          Length = 276

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 94/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V K   +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSINVSTKKGKMVLKIEDNDQITVNMGIP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I   +   L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPGKIPFKAKQP----EKTYILRTDVHTLFCG-AVSMGNPHV-VTVVDDVDTADVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V + E + LR +ERG G T ACGS AC +V          
Sbjct: 178 GPLLESHERFPERVNAGFMQVINREEVRLRVYERGAGETQACGSGACGAVAVGINQGLLA 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V++ GG L I W      +FMTG A   ++G+L
Sbjct: 238 ENVKVRLPGGDLQISWQGPGKPLFMTGPATHVFDGQL 274


>gi|239813906|ref|YP_002942816.1| diaminopimelate epimerase [Variovorax paradoxus S110]
 gi|259595065|sp|C5CND4|DAPF_VARPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|239800483|gb|ACS17550.1| diaminopimelate epimerase [Variovorax paradoxus S110]
          Length = 294

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 137/292 (46%), Gaps = 14/292 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA---SVD 61
           + F KM+G GN  +V+D       +T+     L+        DQI+ +          VD
Sbjct: 3   IRFTKMQGAGNDFVVLDETRGTLGLTAAQYRFLADRHFGVGADQILTVRPPSKGAAEGVD 62

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVD 119
               I N DG EV+ CGNG RC +RF        + +   ET+ GI+  +   DG ++VD
Sbjct: 63  FQYVIHNADGGEVEQCGNGARCFMRFVREHHLTDKDTVRVETLAGIIEPRMGADGRVTVD 122

Query: 120 MGEPILDWKLIPLA------RSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           MG PI +   +P        +           +G      + +  V+SMGNPHA+  V+ 
Sbjct: 123 MGPPIFEPARVPFDTAGLDPQPTGSWHTWHLALGTHADSAIVSVAVLSMGNPHAVQVVD- 181

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           ++    +A  G L+  HP F++ VN    +V     + LR +ERG G T ACG+ ACA+V
Sbjct: 182 NVDTAPVARQGPLIEHHPRFAQRVNAGFMQVVDRSHIKLRVFERGAGETLACGTGACAAV 241

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTG 284
           VA   L    R V V+  GG L I W    H V MTG A   +EG +++   
Sbjct: 242 VAGIRLGLLERRVDVQTHGGVLTIGWEGEGHPVLMTGPATTVFEGDIEVPEL 293


>gi|254230110|ref|ZP_04923506.1| diaminopimelate epimerase [Vibrio sp. Ex25]
 gi|262392885|ref|YP_003284739.1| diaminopimelate epimerase [Vibrio sp. Ex25]
 gi|151937355|gb|EDN56217.1| diaminopimelate epimerase [Vibrio sp. Ex25]
 gi|262336479|gb|ACY50274.1| diaminopimelate epimerase [Vibrio sp. Ex25]
          Length = 276

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 134/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILNIEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRAGEKTLFCG-AVSMGNPHV-VTVVDDVDTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + + LR +ERG G T ACGS ACA+V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDHIRLRVYERGAGETQACGSGACAAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FMTG     ++G+L
Sbjct: 238 ENVKVSLPGGELRIAWQGPGKPLFMTGPTTHVFDGQL 274


>gi|124268429|ref|YP_001022433.1| diaminopimelate epimerase [Methylibium petroleiphilum PM1]
 gi|166225730|sp|A2SKV9|DAPF_METPP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|124261204|gb|ABM96198.1| diaminopimelate epimerase [Methylibium petroleiphilum PM1]
          Length = 296

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 93/291 (31%), Positives = 143/291 (49%), Gaps = 13/291 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       ++      L+        DQ++++    +  +D   
Sbjct: 3   LRFTKMQGAGNDFVVLDATREPLTLSPAQYRYLADRRFGVGADQVLIVGASDEPGIDFTY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTS--RMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI+N DGSEV+ CGNG RC VR++      K+ +    T  G++  +   DG ++VDMG 
Sbjct: 63  RIVNADGSEVEQCGNGARCFVRYVREAGLTKKSAIRVRTAGGVIEPRWLVDGRVTVDMGA 122

Query: 123 PILDWKLIPL-ARSFDKMDRDRFHIGPVNH-LFLRNPFVVSMGNPHAIFFVEDD----LY 176
           P+ +   +P  A      + + F + P++         VVSMGNPHA+  V       + 
Sbjct: 123 PVFEPARVPFDAAGLQPRELNGFALWPLDAADRTVEAAVVSMGNPHAVMNVAQFGSGGVD 182

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+ +H  F + VN    +V S   + LR +ERG G T ACG+ ACA+VVA 
Sbjct: 183 EAPVAELGPLVERHTRFPQRVNAGFLQVLSDTHVKLRVYERGAGETLACGTGACAAVVAG 242

Query: 237 GCLHKT--NRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIKT 283
             L        V V   GG L IEW    +  V+MTG A+  + G++D+  
Sbjct: 243 IRLGWLRAGTPVDVDTRGGELTIEWAGRSDAPVWMTGPAESVYVGEIDLPE 293


>gi|29655253|ref|NP_820945.1| diaminopimelate epimerase [Coxiella burnetii RSA 493]
 gi|154706485|ref|YP_001425375.1| diaminopimelate epimerase [Coxiella burnetii Dugway 5J108-111]
 gi|161830776|ref|YP_001596002.1| diaminopimelate epimerase [Coxiella burnetii RSA 331]
 gi|164685819|ref|ZP_01945724.2| diaminopimelate epimerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212213429|ref|YP_002304365.1| diaminopimelate epimerase [Coxiella burnetii CbuG_Q212]
 gi|212219479|ref|YP_002306266.1| diaminopimelate epimerase [Coxiella burnetii CbuK_Q154]
 gi|81628361|sp|Q83AD4|DAPF_COXBU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082831|sp|A9KGY8|DAPF_COXBN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082832|sp|A9N9J6|DAPF_COXBR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807497|sp|B6J395|DAPF_COXB2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807498|sp|B6J630|DAPF_COXB1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|29542525|gb|AAO91459.1| diaminopimelate epimerase [Coxiella burnetii RSA 493]
 gi|154355771|gb|ABS77233.1| diaminopimelate epimerase [Coxiella burnetii Dugway 5J108-111]
 gi|161762643|gb|ABX78285.1| diaminopimelate epimerase [Coxiella burnetii RSA 331]
 gi|164601335|gb|EAX33603.2| diaminopimelate epimerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212011839|gb|ACJ19220.1| diaminopimelate epimerase [Coxiella burnetii CbuG_Q212]
 gi|212013741|gb|ACJ21121.1| diaminopimelate epimerase [Coxiella burnetii CbuK_Q154]
          Length = 276

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 97/278 (34%), Positives = 138/278 (49%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           V+F KM+G GN  +VID       +T+  I  ++       FDQ+++I   ++ SVD   
Sbjct: 3   VNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHF 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC+ RF+ +     R+     T+  +L  K   DG +SV MG 
Sbjct: 63  RIFNADGSEVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  +   IP   S        F+   V++  ++   VV++GNPHAI  VE  +   ++  
Sbjct: 123 PRFEPTEIPFIAS----GVANFYDIAVDNQIVKLG-VVNIGNPHAIIPVER-INAEEVGK 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L+ H  F EG N+   +V   +++ LR +ERG G T ACGS ACA+V         
Sbjct: 177 LGARLSVHECFPEGANVGFMQVIDPQNIRLRVYERGTGETLACGSNACAAVAVGRRCGLL 236

Query: 243 NRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKL 279
              V V   GG L I+W      V MTG A   + G+ 
Sbjct: 237 QERVVVSQPGGSLTIDWQGPLTPVTMTGPATTVFCGEW 274


>gi|219116604|ref|XP_002179097.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217409864|gb|EEC49795.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 334

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 95/296 (32%), Positives = 139/296 (46%), Gaps = 15/296 (5%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQD- 57
           +++  V F+K  G+GN  ++ID R   +  +T +    L         D ++        
Sbjct: 39  LEARKVPFSKYHGLGNDFILIDDRDKSEPSLTPEESAMLCHRNFGIGGDGVIFALQPPSE 98

Query: 58  ----ASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS----FTFETIRGILVAK 109
               A  D  +RI N DGSE + CGNG+RC+ +FL    + KS    +   T+ G +V  
Sbjct: 99  SGDGADFDFTMRIYNSDGSEPEMCGNGIRCMAQFLKDLGESKSDDGAYQIHTLAGRIVPV 158

Query: 110 ENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIF 169
            N DG+I+VDMGEP L+   +P     +             +        V MGNPHAIF
Sbjct: 159 MNEDGTITVDMGEPFLEAAKVPTTLEANAEHDSVVEQTLEANGKTWKCTAVGMGNPHAIF 218

Query: 170 FVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
           FV D     D    G  L  H  F    N+   +V   + L ++ WERG G T ACG+ A
Sbjct: 219 FVNDLEKDIDFEKDGPALEAHESFPAKTNVEFVQVKGDDHLIMKVWERGAGPTLACGTGA 278

Query: 230 CASVVASGCLHKT---NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           CA  VA+    K    ++ V V + GG L IEW + +N ++MTG A   + G+  +
Sbjct: 279 CALTVAAMRAGKIPRGDQPVRVTLPGGDLWIEWRESDNKIYMTGPATFAFAGETKV 334


>gi|28899757|ref|NP_799362.1| diaminopimelate epimerase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838744|ref|ZP_01991411.1| diaminopimelate epimerase [Vibrio parahaemolyticus AQ3810]
 gi|260365175|ref|ZP_05777740.1| diaminopimelate epimerase [Vibrio parahaemolyticus K5030]
 gi|260878125|ref|ZP_05890480.1| diaminopimelate epimerase [Vibrio parahaemolyticus AN-5034]
 gi|260895818|ref|ZP_05904314.1| diaminopimelate epimerase [Vibrio parahaemolyticus Peru-466]
 gi|260900849|ref|ZP_05909244.1| diaminopimelate epimerase [Vibrio parahaemolyticus AQ4037]
 gi|31340032|sp|Q87KJ4|DAPF_VIBPA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|28808009|dbj|BAC61246.1| diaminopimelate epimerase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747830|gb|EDM58714.1| diaminopimelate epimerase [Vibrio parahaemolyticus AQ3810]
 gi|308087181|gb|EFO36876.1| diaminopimelate epimerase [Vibrio parahaemolyticus Peru-466]
 gi|308092770|gb|EFO42465.1| diaminopimelate epimerase [Vibrio parahaemolyticus AN-5034]
 gi|308110598|gb|EFO48138.1| diaminopimelate epimerase [Vibrio parahaemolyticus AQ4037]
 gi|308111034|gb|EFO48574.1| diaminopimelate epimerase [Vibrio parahaemolyticus K5030]
          Length = 276

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILDVEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRAGDKTLFCG-AVSMGNPHV-VTVVDDVDTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V S + + LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVSRDHIRLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
            +V V + GG L I W      +FMTG A   ++G+L
Sbjct: 238 ESVKVSLPGGELHISWQGPGKPLFMTGPATHVFDGQL 274


>gi|328472416|gb|EGF43282.1| diaminopimelate epimerase [Vibrio parahaemolyticus 10329]
          Length = 276

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 92/277 (33%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G ++     DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILDVEDDGEVTVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRAGDKTLFCG-AVSMGNPHV-VTVVDDVDTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V + + + LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNRDHIRLRVYERGAGETQACGSGACGAVAVGILQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
            +V V + GG L I W      +FMTG A   ++G+L
Sbjct: 238 ESVKVSLPGGELHISWQGPGKPLFMTGPATHVFDGQL 274


>gi|241767262|ref|ZP_04765000.1| Diaminopimelate epimerase [Acidovorax delafieldii 2AN]
 gi|241362069|gb|EER58195.1| Diaminopimelate epimerase [Acidovorax delafieldii 2AN]
          Length = 292

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 133/288 (46%), Gaps = 12/288 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +T      L+        DQI+ +       +D   
Sbjct: 3   IRFTKMQGAGNDFVVLDETQGRLGLTPAHYRFLADRHFGVGADQILTVRPSPAEGIDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC  R++  +      T   +T+ G++  +   DG ++VDMG 
Sbjct: 63  VIHNADGGEVEQCGNGARCFARYVRDKGLTTKDTIRVQTLAGVIAPQLTPDGRVTVDMGR 122

Query: 123 PILDWKLIPLARSF------DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           P  D   +P   +           +    +            VVSMGNPHA+  V+ D+ 
Sbjct: 123 PEFDAARVPFDAAGLAPVAQGLGQKWPLALAGSAQDAPVMVAVVSMGNPHAVQLVQ-DVD 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F   VN    ++     + LR +ERG G T ACG+ ACA+V A 
Sbjct: 182 TAPVAQTGPLIESHPRFPRRVNAGYLQIVDRGHVRLRVFERGAGETLACGTGACAAVAAG 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEW--HDNNHVFMTGEAKKEWEGKLDIK 282
             L   +  V V+  GG L I W   + + VFMTG A   ++G++++ 
Sbjct: 242 IRLGLLDARVDVQTRGGLLTIAWSGQEADSVFMTGPATLVFDGQIELP 289


>gi|48428755|gb|AAT42404.1| diaminopimelate epimerase [Collimonas fungivorans Ter331]
          Length = 280

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 98/280 (35%), Positives = 134/280 (47%), Gaps = 9/280 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G GN  +VID    H + T      L         DQ++++   Q   VD   RI N 
Sbjct: 1   MHGAGNDFVVIDAIHQHVDFTPAQWQRLGDRRFGVGADQMLVVEKSQAEGVDFRYRIYNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG EV+ CGNG R  V+F+T +    +++   ET+ GI+  K   DG I+V MG P+L  
Sbjct: 61  DGGEVEQCGNGARAFVKFVTDKGLTSKRAIRVETMSGIIEPKLEDDGRITVAMGAPVLAP 120

Query: 128 KLIPL---ARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             +P          M  D      V    +    VVSMGNPHA+  VE D     + + G
Sbjct: 121 AAVPFDASNLDSRAMGEDTLWPLDVQGKQVW-ISVVSMGNPHAVQVVE-DSEAAPVLAEG 178

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+  HP F   VN    ++    S+ LR +ERG G T ACG+ ACA+VVA       + 
Sbjct: 179 PLIEHHPRFPRRVNAGFMQIVDRHSIKLRVFERGAGETLACGTGACAAVVAGIRRGLLDS 238

Query: 245 AVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
            V+V+  GG L I W      V MTG A   +EG+++I  
Sbjct: 239 PVAVQTHGGELSIAWAGGQQAVMMTGPAVSVFEGEIEIAA 278


>gi|163745242|ref|ZP_02152602.1| diaminopimelate epimerase [Oceanibulbus indolifex HEL-45]
 gi|161382060|gb|EDQ06469.1| diaminopimelate epimerase [Oceanibulbus indolifex HEL-45]
          Length = 277

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 99/285 (34%), Positives = 142/285 (49%), Gaps = 19/285 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R    N++     A+        FDQ+ +I      + DA +
Sbjct: 9   LPFMKMHGLGNDFVVLDARAEAINVSPAMAQAIGHRQFGVGFDQLAVI---TQGAGDAQL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL     R S    T RG L AK+  +G  SV+MG P 
Sbjct: 66  TFYNSDGSLSAACGNATRCIARFLMDETGRDSLHLTTARGDLAAKDAGNGLTSVNMGHPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L W  +PLAR  D +                +P    MGNPH  FFV+ D+   DL+  G
Sbjct: 126 LKWDEVPLAREMDTLHL----------PIEGDPVAAGMGNPHCTFFVK-DVEAVDLSDIG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                 P+F E  N+ +A++     + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 PRAEHDPLFPERTNVQVAQIVGPNHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
           AV + + GG L I+W D+  V+MTG     + G     T  +++ 
Sbjct: 235 AVRIDLDGGTLHIDWRDDG-VWMTGPTMHVFSGTF---TADFLES 275


>gi|121606324|ref|YP_983653.1| diaminopimelate epimerase [Polaromonas naphthalenivorans CJ2]
 gi|120595293|gb|ABM38732.1| diaminopimelate epimerase [Polaromonas naphthalenivorans CJ2]
          Length = 295

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 90/293 (30%), Positives = 135/293 (46%), Gaps = 12/293 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS 59
           M    + F KM+G GN  +++D       ++      L+        DQI+ +       
Sbjct: 1   MPFMRIRFTKMQGAGNDFVMLDETRGPLGLSPAHYRFLADRHFGVGADQILTVRPSPGEG 60

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSIS 117
           +D    I N DG EV+ CGNG RC VRF+  +    + +   +T+ GI+      DG ++
Sbjct: 61  IDFEYVIHNADGGEVEQCGNGARCFVRFVREQGLTTKDAVKVKTLGGIIEPCMQPDGRVT 120

Query: 118 VDMGEPILDWKLIPLARSF------DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV 171
           V+MG P+ + + IP   +           +    +            VVSMGNPHA+  V
Sbjct: 121 VNMGAPVFELERIPFNPAGLTPQTAGSWQKWPLALDGHAQAAPVFVAVVSMGNPHAVQLV 180

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
           + D+    +   G L+  HP F   VN    +V S   + LR +ERG G T ACG+ ACA
Sbjct: 181 D-DVDTAPVLEAGPLIEHHPSFPRRVNAGFMQVVSRSQIRLRVYERGAGETLACGTGACA 239

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD--NNHVFMTGEAKKEWEGKLDIK 282
           +VVA   L   +  V V   GG L IEW    +  V MTG A   +E ++++ 
Sbjct: 240 AVVAGIRLGLLDSRVDVLTRGGQLTIEWAGTLDAPVMMTGPATTVFESEIEVP 292


>gi|134045763|ref|YP_001097249.1| diaminopimelate epimerase [Methanococcus maripaludis C5]
 gi|254767111|sp|A4FXV0|DAPF_METM5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|132663388|gb|ABO35034.1| diaminopimelate epimerase [Methanococcus maripaludis C5]
          Length = 277

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 94/284 (33%), Positives = 142/284 (50%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + +D         ++    +S        D ++LI     A  D  +
Sbjct: 1   MKFTKMHGLGNDYIYVDAISQKIENPNEISKFVSDRHFGIGSDGLVLILPSDVA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGN +RCV +F+  +      T   ET+ GI V +   +      + V
Sbjct: 59  RMFNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTISIETLAGIKVLEMTVENGKVVLVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL  + IP+      +  +             N   VSMGNPHAI ++E ++  +
Sbjct: 119 DMGEPILKAETIPVLSEKHPVIDEEITAKDY----CYNFTCVSMGNPHAITYIE-NVEEF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G L   H  F +  N+    +    ++ +R WERG G T ACG+ ACA + AS  
Sbjct: 174 PLEKIGPLFEVHEKFPKKTNVEFVELIDDSTVKMRVWERGAGETLACGTGACAVLTASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                R  +VK+LGG L+IEW++ +NH++MTG A   +EG++DI
Sbjct: 234 KGYVGRKATVKLLGGDLIIEWNEKDNHIYMTGPATTVFEGEIDI 277


>gi|262278117|ref|ZP_06055902.1| diaminopimelate epimerase [Acinetobacter calcoaceticus RUH2202]
 gi|262258468|gb|EEY77201.1| diaminopimelate epimerase [Acinetobacter calcoaceticus RUH2202]
          Length = 281

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + ++ I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTETIQRLADRHFGIGFDQLLIVEPPDLPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTSKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVAEQPEALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V     + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQVIDENHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|119776381|ref|YP_929121.1| diaminopimelate epimerase [Shewanella amazonensis SB2B]
 gi|166225753|sp|A1SAP5|DAPF_SHEAM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|119768881|gb|ABM01452.1| diaminopimelate epimerase [Shewanella amazonensis SB2B]
          Length = 275

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 140/281 (49%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDG ++V+MG
Sbjct: 61  YRIFNADGSEVEQCGNGARCFARFVRNKGLTQKHKIKVSTSAGKMTLRLERDGGVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            PILD   IP         +        +         VSMGNPH +  V+ D+    +A
Sbjct: 121 VPILDPAQIPFKAK-----KFEKTYLLQSAQQTFLCGAVSMGNPHVVLEVD-DITQAPVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L +H  F +GVN+   +V + + + LR +ERG   T ACGS ACA+ V      K
Sbjct: 175 DVGAQLTRHERFPKGVNVGFMQVVAPDHIKLRVYERGAAETLACGSGACAAAVVGQLQGK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
               V V + GG L I W      ++MTG A++ ++G++ +
Sbjct: 235 LGSRVRVDLPGGSLTINWEGEGKPLWMTGPAQQVYDGQIQL 275


>gi|219669923|ref|YP_002460358.1| diaminopimelate epimerase [Desulfitobacterium hafniense DCB-2]
 gi|254767101|sp|B8FSD4|DAPF_DESHD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219540183|gb|ACL21922.1| Diaminopimelate epimerase [Desulfitobacterium hafniense DCB-2]
          Length = 283

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 100/284 (35%), Positives = 142/284 (50%), Gaps = 17/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC---HDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVD 61
           ++  KM G+GN  + ID             +    L         D ++++     A  D
Sbjct: 1   MEIVKMHGLGNDFVFIDHFQGAPAELPDYPELARKLCHRQFGVGGDGLIMVLPSDKA--D 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGS---- 115
           A +RI+N DGSE + CGNG+RC  R++  +    +     ET+ GIL  + +  G     
Sbjct: 59  ARMRILNSDGSEPEMCGNGIRCFARYIYDQGYVSQNPLQVETLAGILTLQLSITGDQVTG 118

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEPIL  + +P+    D +   R  +      F      VSMGNPH + FVE D 
Sbjct: 119 VRVDMGEPILKSEQVPVLIQGDPVVGARLDVDGQEFEF----TAVSMGNPHCVLFVE-DY 173

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              D    G  + KHP+F    N+    V S   L ++ WERG G T ACG+ ACASVVA
Sbjct: 174 ETLDFERIGPAIEKHPLFPRKTNVEFIIVNSPRELTMKVWERGAGPTLACGTGACASVVA 233

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +    +T R V+V + GG LLIEW ++N V+MTG A   ++G L
Sbjct: 234 AVLNGRTERKVTVHLPGGDLLIEWGEDNRVYMTGPAAYVFKGVL 277


>gi|259417389|ref|ZP_05741308.1| diaminopimelate epimerase [Silicibacter sp. TrichCH4B]
 gi|259346295|gb|EEW58109.1| diaminopimelate epimerase [Silicibacter sp. TrichCH4B]
          Length = 275

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 100/277 (36%), Positives = 139/277 (50%), Gaps = 14/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQD-ASVDA 62
           M+ F KM G+GN  +VID R     IT      ++       FDQ+ +I   ++ AS DA
Sbjct: 1   MLTFMKMHGLGNDFVVIDARTQDIQITPAMAKGIAHRQLGMGFDQLAVIFAAKEGASADA 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +   N DGS   +CGN  RC+ R+L  +  + +    T RG L AK+  +G  SV+MG 
Sbjct: 61  HLVFYNADGSTSAACGNATRCIARYLMDQSGKDALNLTTDRGELAAKDAGNGLTSVNMGA 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L W  IPL+   D ++                P    MGNPH  FFVE D     L  
Sbjct: 121 PQLLWDEIPLSEEMDTLEL----------PIEGAPTATGMGNPHCTFFVE-DAELIPLEE 169

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG     HP++ E  N+ IA V   + L +R WERGVG+T A GS++CA+ VA+     T
Sbjct: 170 FGPRYEHHPLYPERTNVQIAHVMGPDHLRMRVWERGVGVTLASGSSSCATAVAAARKGLT 229

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            R V + + GG L I+W ++  V+MTG      +G  
Sbjct: 230 GRNVQIDLDGGTLWIDWREDG-VWMTGPTMHVADGSF 265


>gi|89895489|ref|YP_518976.1| hypothetical protein DSY2743 [Desulfitobacterium hafniense Y51]
 gi|89334937|dbj|BAE84532.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 287

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 100/284 (35%), Positives = 142/284 (50%), Gaps = 17/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC---HDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVD 61
           ++  KM G+GN  + ID             +    L         D ++++     A  D
Sbjct: 5   MEIVKMHGLGNDFVFIDHFQGAPAELPDYPELARKLCHRQFGVGGDGLIMVLPSDKA--D 62

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGS---- 115
           A +RI+N DGSE + CGNG+RC  R++  +    +     ET+ GIL  + +  G     
Sbjct: 63  ARMRILNSDGSEPEMCGNGIRCFARYIYDQGYVSKNPLQVETLAGILTLQLSITGDQVTG 122

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           + VDMGEPIL  + +P+    D +   R  +      F      VSMGNPH + FVE D 
Sbjct: 123 VRVDMGEPILKSEQVPVLIQGDPVVGARLDVDGQEFEF----TAVSMGNPHCVLFVE-DY 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              D    G  + KHP+F    N+    V S   L ++ WERG G T ACG+ ACASVVA
Sbjct: 178 ETLDFERIGPAIEKHPLFPRKTNVEFIIVNSPRELTMKVWERGAGPTLACGTGACASVVA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +    +T R V+V + GG LLIEW ++N V+MTG A   ++G L
Sbjct: 238 AVLNGRTERKVTVHLPGGDLLIEWGEDNRVYMTGPAAYVFKGVL 281


>gi|163803626|ref|ZP_02197491.1| diaminopimelate epimerase [Vibrio sp. AND4]
 gi|159172574|gb|EDP57434.1| diaminopimelate epimerase [Vibrio sp. AND4]
          Length = 276

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 88/277 (31%), Positives = 130/277 (46%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLANRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +      DG ++V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKITLAIEDDGEVAVNMGVP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP         +++ +I       L     VSMGNPH    V DD+   ++ + 
Sbjct: 124 EFEPNKIPFKAK----QKEKTYIMRTGEKTLFCG-AVSMGNPHV-VTVVDDVDTAEVETL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E  N    ++    ++ LR +ERG G T ACGS AC +V         +
Sbjct: 178 GPLLESHERFPERANAGFMQIVDRNNIRLRVYERGTGETQACGSGACGAVAVGIMQGLLD 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V + GG L I W      +FM G A   ++G+L
Sbjct: 238 ENVKVSLPGGDLRISWQGPGKPLFMAGPATHVFDGQL 274


>gi|212276289|ref|NP_001130140.1| hypothetical protein LOC100191234 [Zea mays]
 gi|194688384|gb|ACF78276.1| unknown [Zea mays]
 gi|195608480|gb|ACG26070.1| diaminopimelate epimerase [Zea mays]
 gi|219888355|gb|ACL54552.1| unknown [Zea mays]
          Length = 352

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 132/289 (45%), Gaps = 13/289 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDAS 59
               + F K +G+GN  +++D R          +A      +     D ++ +    +  
Sbjct: 64  SERALHFVKYQGLGNDFIMVDNRDSSVPKVTPEEAAKLCDRNFGIGADGVIFVMPGVN-D 122

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +     SFT  T  G ++ +   DG +
Sbjct: 123 ADYTMRIFNSDGSEPEMCGNGVRCFARFIGELENLQGTHSFTIHTGAGKIIPEIQSDGQV 182

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMGEPIL    IP        ++              +   VSMGNPH + F  ++  
Sbjct: 183 KVDMGEPILSGADIPTKL-VATKNKAVIQAELAVEGLTWHVTCVSMGNPHCVTFGANELK 241

Query: 175 ---LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    L+  G     H MF    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 242 TLQIDDLKLSEIGPKFEHHEMFPARTNTEFVQVLSRSHLKMRVWERGAGATLACGTGACA 301

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            VVA+    +  R   V + GG L IEW + +NHV+MTG A+  + G +
Sbjct: 302 VVVAAVLEGRAERKCVVDLPGGPLEIEWREDDNHVYMTGPAEAVFYGSV 350


>gi|317401435|gb|EFV82068.1| DapF protein [Achromobacter xylosoxidans C54]
          Length = 297

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 91/290 (31%), Positives = 128/290 (44%), Gaps = 12/290 (4%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIR 65
           +F KM G GN  +V+D       +T +   AL         DQI+L+        D   R
Sbjct: 4   NFTKMHGAGNDFVVLDGVRQAIEMTPERARALGDRHFGIGADQILLVERATRPDADFRYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC VRF+  +    R     E   GILV  E  D  ++VDMG  
Sbjct: 64  IFNADGSEVEHCGNGARCFVRFVHEQGLSDRNPLRAEIATGILVLDEGDDEQVTVDMGST 123

Query: 124 ILDWKLIPLAR-------SFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
             D   +P                       P           V++ NPHA+  V+ ++ 
Sbjct: 124 RFDPAALPFDTAGLASRTEGQDTLWQLELDVPAGLPRSVALSAVAISNPHAVQVVD-NVD 182

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              +A  G L+  HP F+  VN    ++    S+ LR  ERG G T ACG+ ACA+V A 
Sbjct: 183 TAPVAIVGPLIETHPRFARRVNAGFMQIVDRHSIRLRVHERGAGETLACGTGACAAVAAG 242

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKW 286
                 +  V V+  GG L I W+    + +TG A+  + G++DI    +
Sbjct: 243 IRRGLLDSPVRVQTRGGVLTIAWNGEQ-LRLTGPAESVFTGQVDIDKLVF 291


>gi|157377261|ref|YP_001475861.1| diaminopimelate epimerase [Shewanella sediminis HAW-EB3]
 gi|189082841|sp|A8G0W0|DAPF_SHESH RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|157319635|gb|ABV38733.1| Diaminopimelate epimerase [Shewanella sediminis HAW-EB3]
          Length = 280

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 90/279 (32%), Positives = 141/279 (50%), Gaps = 5/279 (1%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC  RF+ ++    ++     T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGGEVEQCGNGARCFARFVRNKGLTNKQKIRVSTSNGKITLRLERDGNVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+L+   IP      +         P + +       VSMGNPH +  VE D+   D+ 
Sbjct: 121 IPVLEPGRIPFNAKKMEKTYLLQATNPDSTMQTFLFGAVSMGNPHCVLDVE-DIEAADVE 179

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL +H  F +GVN+   ++ +   + LR +ERG   T ACG+ ACA+ V      K
Sbjct: 180 GIGALLTRHERFPKGVNVGFMQIINSGHIKLRVYERGAAETLACGTGACAAAVVGQLQGK 239

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
            +  V V + GG L I W      ++MTG A+  ++G++
Sbjct: 240 LDNCVRVDLPGGTLTINWEGEGKPLWMTGPAEHVYDGQI 278


>gi|225569359|ref|ZP_03778384.1| hypothetical protein CLOHYLEM_05443 [Clostridium hylemonae DSM
           15053]
 gi|225162158|gb|EEG74777.1| hypothetical protein CLOHYLEM_05443 [Clostridium hylemonae DSM
           15053]
          Length = 277

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 141/284 (49%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + ++          +A   LS        D +++I   + A  D  +
Sbjct: 1   MKFTKMHGLGNDYVYVNCFKEKIGNPPEAARILSDRHFGVGSDGLIMICPSEKA--DFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGIL----VAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +      + + + ET+ G+       K+ +   I V
Sbjct: 59  EMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTNISVETLGGVKYLDLTVKDGKAVLIKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L  + IP+    D +  +   +    +        VSMGNPHA+ FV+ D+   
Sbjct: 119 DMGRPELKPERIPIVSGGDAVISEPIVVDGAIYRMTG----VSMGNPHAVIFVD-DVKGL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           +L + G     H  F + VN   ARV   E++++R WERG G T ACG+ ACA  VA   
Sbjct: 174 ELEAVGPKFENHERFPKRVNTEFARVIDRETVEMRVWERGSGETLACGTGACAVAVACIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              T   V+V++LGG LLIEW  + + V+MTG A   ++G++ I
Sbjct: 234 NGLTEDKVTVRLLGGDLLIEWDKEADKVYMTGPATVVFDGEIQI 277


>gi|85708150|ref|ZP_01039216.1| diaminopimelate epimerase [Erythrobacter sp. NAP1]
 gi|85689684|gb|EAQ29687.1| diaminopimelate epimerase [Erythrobacter sp. NAP1]
          Length = 269

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 101/277 (36%), Positives = 139/277 (50%), Gaps = 17/277 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           VDF KM G+GN  +V+D R      I++   +AL+  +     DQ++++    D   D  
Sbjct: 3   VDFTKMHGLGNDFVVLDARETPLPAISNATASALADRNTGVGCDQLIVLEPSDD--HDFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DG EV++CGN  R V     S       T ET  G +  +    G  SVDMGEP
Sbjct: 61  MRIYNSDGGEVEACGNASRAVAMLHGS-----PATVETAGGAIRLEP-AQGGASVDMGEP 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +W  IPLA + D  +       PV    L     V++GNPH IFFV+ D    DLA  
Sbjct: 115 RFEWDAIPLAYAMDTAN------MPVGWGELEAGIAVNVGNPHVIFFVQ-DADAVDLAEL 167

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  +    +F E +N+++A   S   L LR WERG GLT ACG+ ACA+ VA+       
Sbjct: 168 GPQIETDALFPERINVNVASRLSDNHLKLRVWERGAGLTRACGTGACATAVAAISRLHMK 227

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
             V+V + GG L I W     + MTG A + + G  +
Sbjct: 228 SPVTVSLPGGDLEIAWERGESIVMTGPATESFRGSFE 264


>gi|225028432|ref|ZP_03717624.1| hypothetical protein EUBHAL_02706 [Eubacterium hallii DSM 3353]
 gi|224954276|gb|EEG35485.1| hypothetical protein EUBHAL_02706 [Eubacterium hallii DSM 3353]
          Length = 290

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 139/287 (48%), Gaps = 15/287 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM GIGN  + ++         ++    +S        D ++LI     A  D  +
Sbjct: 9   MKFTKMHGIGNDYVYVNCFEESIKNPAEVSKFVSDRHFGIGSDGLILISPS--AKADFRM 66

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDG----SISV 118
            I N DGS+ + CGNG+RCV    +      +   + ET+ GI   K   +     ++ V
Sbjct: 67  NIYNADGSQAEMCGNGIRCVAKYVYDYGLTDKTEISVETLAGIKYLKLQVENGKVATVEV 126

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG PIL+ K IP+A   + +      +    +        VSMGNPHAI F++ ++   
Sbjct: 127 NMGAPILEPKKIPVAVENNPVVDVPVEVKGKTYHM----TCVSMGNPHAIIFMD-NVKEL 181

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+ + G     HP+F +  N     V    ++++R WERG   T ACG+ ACA+ VA   
Sbjct: 182 DIEAIGPYFENHPVFPKRTNTEFVEVLDKNTVNMRVWERGSDETLACGTGACATTVACIL 241

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTG 284
            +KT   V+V +LGG L I W    + V+MTG A   ++G++ +  G
Sbjct: 242 NNKTEDEVTVHLLGGDLKIRWDRKENLVYMTGPATVVFDGEITLPEG 288


>gi|114769927|ref|ZP_01447537.1| diaminopimelate epimerase [alpha proteobacterium HTCC2255]
 gi|114549632|gb|EAU52514.1| diaminopimelate epimerase [alpha proteobacterium HTCC2255]
          Length = 280

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 90/275 (32%), Positives = 140/275 (50%), Gaps = 15/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           V F KM G+GN  ++ID R     + +     +        +DQ+++I   + A  D  +
Sbjct: 11  VPFLKMHGLGNDFVIIDARESESPVNAQIAKVIGDRHFGVGYDQLVVITKSKKA--DVEV 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RCV + +      +  T +T  G+LVA++ ++  ISV+MG P 
Sbjct: 69  VFWNSDGSLSDACGNASRCVAKLIMDENNIEEITLKTGSGVLVAQKGQNDLISVNMGHPQ 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW +IPL    D ++               +P  V +GNPH +F V+ D+   DL S+G
Sbjct: 129 LDWDVIPLKEKVDLIEL----------PIEGSPGAVGIGNPHCVFVVD-DVNSVDLISWG 177

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
           + +  H +F +  N+   ++   +++  RT+ERG G T ACGS ACA  V +     T R
Sbjct: 178 SKIETHELFPKKTNVEFIQIIDQKNIRQRTFERGAGETLACGSGACAVAVVAHLKGLTER 237

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            VSV + GG L I W  +  ++MTG     ++G L
Sbjct: 238 NVSVHLDGGELNINWAKDG-IWMTGPTTLVFKGVL 271


>gi|116329548|ref|YP_799268.1| diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116329863|ref|YP_799581.1| diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122282362|sp|Q04W97|DAPF_LEPBJ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|122282673|sp|Q04X60|DAPF_LEPBL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|116122292|gb|ABJ80335.1| Diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123552|gb|ABJ74823.1| Diaminopimelate epimerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 281

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 91/284 (32%), Positives = 145/284 (51%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KMEGIGN  + ID    +  +T + I  +S        D ++ I + +    D  +
Sbjct: 4   LKFTKMEGIGNDYIYIDSTQANIRLTPEQIQKISNRNFGIGSDGVIFIRNSKQG--DFMM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE-----NRDGSIS 117
            + N DGS  + CGNG+RCV +++        K+   ET  G+L         N+   +S
Sbjct: 62  DMYNSDGSSSEMCGNGIRCVAKYIYDHGLTNSKNPKIETGAGVLEVDLKIGSGNKVDFVS 121

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+PIL    IP+    ++   D+       +L       VSMGNPH + FV+ D   
Sbjct: 122 VNMGKPILVPSKIPVNWKDEEAIIDQTFEIAGKNL---KFTAVSMGNPHCVIFVD-DCDQ 177

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G L+ +HP+F + +N+    V   +    RTWERG G T ACG+ ACA  VA  
Sbjct: 178 FPVTGIGPLIERHPIFPKRINVEFVTVRGKDHFYQRTWERGAGETLACGTGACAVTVAGN 237

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              K+ + V + + GG L I+W ++ +V MTG AK+ + G++++
Sbjct: 238 LTGKSGKEVKIDLRGGTLRIQWQESGNVLMTGPAKEIFSGEIEV 281


>gi|293609895|ref|ZP_06692197.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828347|gb|EFF86710.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 281

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 142/281 (50%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + ++ I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTETIQRLADRHFGIGFDQLLIVEPPDLPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + S T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTTKTSITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP          +  +   + +    N  VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFIAEQP----EALYTLELANDQNINIDVVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQVIDEKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|238009464|gb|ACR35767.1| unknown [Zea mays]
          Length = 350

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 91/286 (31%), Positives = 131/286 (45%), Gaps = 10/286 (3%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDAS 59
               + F K +G+GN  +++D R          +A      +     D ++ +    +  
Sbjct: 65  SERALHFVKYQGLGNDFIMVDNRDSSVPKVTPEEAAKLCDRNFGIGADGVIFVMPGVN-G 123

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +      FT  T  G +V +   DG +
Sbjct: 124 ADYTMRIFNSDGSEPEMCGNGVRCFARFIAEIENLQGTNRFTIHTGAGKIVPEIQSDGQV 183

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMGEPIL    IP        ++              +   VSMGNPH + F  ++  
Sbjct: 184 KVDMGEPILSGLDIPTKL-LATKNKAVVQAELAVEGLTWHVTCVSMGNPHCVTFGANELK 242

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    L+  G     H MF    N    +V S   L +R WERG G T ACG+ ACA VV
Sbjct: 243 VDDLKLSEIGPKFEHHEMFPARTNTEFVQVLSRSHLKMRVWERGAGATLACGTGACAVVV 302

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           A+    +  R   V + GG L IEW + +NHV+MTG A+  + G +
Sbjct: 303 AAVLEGRAERKCVVDLPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 348


>gi|299769074|ref|YP_003731100.1| diaminopimelate epimerase [Acinetobacter sp. DR1]
 gi|298699162|gb|ADI89727.1| diaminopimelate epimerase [Acinetobacter sp. DR1]
          Length = 281

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 140/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + ++ I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTETIQRLADRHFGIGFDQLLIVEPPDLPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + S T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTTKTSITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFIAEQPEALYTLELANDRNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    ++   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQIIDEKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
            + +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LSNSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|171056820|ref|YP_001789169.1| diaminopimelate epimerase [Leptothrix cholodnii SP-6]
 gi|229807513|sp|B1Y6S6|DAPF_LEPCP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|170774265|gb|ACB32404.1| Diaminopimelate epimerase [Leptothrix cholodnii SP-6]
          Length = 297

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 93/292 (31%), Positives = 132/292 (45%), Gaps = 15/292 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +++     L         DQI+++       VD   
Sbjct: 3   LHFTKMQGAGNDFVVLDATRAPLALSAADYRFLGDRRFGVGADQILVVERSTTPGVDFRY 62

Query: 65  RIINC-DGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMG 121
           RI N   G EV+ CGNG RC  RF+      +      ET+  ++      DG ++VDM 
Sbjct: 63  RIFNGGSGDEVEQCGNGARCFARFVRDNGLSQQVRVKVETVNSLIELHVEADGRVTVDMN 122

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLR---------NPFVVSMGNPHAIFFVE 172
           +PI +  LIP   +         H        L+         +  V+SMGNPHA+  V 
Sbjct: 123 QPIFEHALIPFDSAGLSARPHNGHGNGFELWPLQLPGASLPSVDVAVLSMGNPHAVQRV- 181

Query: 173 DDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACAS 232
            D+    +A  G  +  H  F   VN    +V S   + LR +ERG G T ACG+ ACA+
Sbjct: 182 HDVDTAPVAEIGPRVETHARFPRHVNAGFMQVMSRREVRLRVFERGAGETLACGTGACAA 241

Query: 233 VVASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKT 283
           VVA   L   +  V V+  GG L I W    H V MTG A+  + G +D+ T
Sbjct: 242 VVAGIRLGWLDPEVDVQTRGGLLTIAWAGLGHPVLMTGPAQTVFTGDIDLPT 293


>gi|114561632|ref|YP_749145.1| diaminopimelate epimerase [Shewanella frigidimarina NCIMB 400]
 gi|122300905|sp|Q088K8|DAPF_SHEFN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|114332925|gb|ABI70307.1| diaminopimelate epimerase [Shewanella frigidimarina NCIMB 400]
          Length = 275

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 86/281 (30%), Positives = 142/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGSEVEQCGNGARCFARFVRNKGLTQKNKIRVSTNSGKITLRIERDGNVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+++   IP         +          +       +SMGNPH +  VE D+   ++ 
Sbjct: 121 VPVIEPSQIPFKAK-----KSEKTYLLQTPMQTYLCGAISMGNPHCVIQVE-DVQTVNVD 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G+ L +H  F +GVN+   +V +   + LR +ERG   T ACG+ ACA+        K
Sbjct: 175 EIGSSLTRHERFPKGVNVGFMQVINPGHIKLRVYERGAAETLACGTGACAAAAVGQLQDK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            ++ V V + GG L+I W      ++MTG A+  ++G++ +
Sbjct: 235 LDKQVRVDLPGGSLIINWEGEGKPLWMTGPAEHVYDGQIQL 275


>gi|310814821|ref|YP_003962785.1| diaminopimelate epimerase [Ketogulonicigenium vulgare Y25]
 gi|308753556|gb|ADO41485.1| diaminopimelate epimerase [Ketogulonicigenium vulgare Y25]
          Length = 277

 Score =  223 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 101/275 (36%), Positives = 144/275 (52%), Gaps = 15/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D RG    +T   + AL+       FDQ+ +I      + D  +
Sbjct: 9   LPFMKMHGLGNDFVVMDERGLPPRVTPALVAALADRNRGVGFDQMAII--TDGGNADLHL 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R+   R  + S T  T RG+L+A+E  +G  SV+MG P+
Sbjct: 67  TFFNADGSPSAACGNATRCIARYEMDRTGKTSLTITTDRGVLLAREEGNGLTSVNMGHPM 126

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
            DW  IPLA   D +              L  P   SMGNPH  FFV+ D+   DLA+ G
Sbjct: 127 TDWDEIPLAEDVDTLAL----------PILGAPTATSMGNPHCTFFVD-DVMAIDLAAIG 175

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +  HP+F E  N+  A+V   + + +R WERG G+T A GS++CA+ VA+     T  
Sbjct: 176 PTIEHHPLFPERTNVQFAQVIGEDRIRMRVWERGTGITLASGSSSCATAVAAYRRGLTRA 235

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG L +EW D+  V+MTG     + G L
Sbjct: 236 KVEIVLDGGSLQVEWRDDG-VWMTGPTMHAFNGVL 269


>gi|39995638|ref|NP_951589.1| diaminopimelate epimerase [Geobacter sulfurreducens PCA]
 gi|39982401|gb|AAR33862.1| diaminopimelate epimerase [Geobacter sulfurreducens PCA]
 gi|307634712|gb|ADI83383.2| diaminopimelate epimerase [Geobacter sulfurreducens KN400]
          Length = 282

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 84/287 (29%), Positives = 130/287 (45%), Gaps = 13/287 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++       N    AI   + +     D ++LI     A  D  +
Sbjct: 1   MKFTKMHGAGNDYVYVNCFEETVGNPEQTAIKVSNRNFGIGSDGLILIMPSDKA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAK-------ENRDGSIS 117
           R+ N DGSE + CGNG+RCV ++                G  V         + R   + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVTKKEITAETGAGVLTLQLFTGADGRVDRVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P L    IP+    D  D               N   VSMGNPH + FV+ D+ +
Sbjct: 119 VNMGKPRLTRAEIPMLG--DPGDGQVVGQPLNILHTTFNITCVSMGNPHCVIFVD-DVEN 175

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G L+  H MF    N+   ++ S   +  RTWERG G T ACG+ A A  VA  
Sbjct: 176 FQVEKYGPLIENHEMFPRRTNVEFVQIISRTEVRQRTWERGAGETLACGTGASAVCVAGA 235

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
               T + +   + GG L +EW ++  ++MTG A + + G++++ T 
Sbjct: 236 LNGLTEKNILNHLSGGDLELEWAEDGFLYMTGPATEVFSGEINLGTL 282


>gi|308800918|ref|XP_003075240.1| unnamed protein product [Ostreococcus tauri]
 gi|116061794|emb|CAL52512.1| unnamed protein product [Ostreococcus tauri]
          Length = 327

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 80/293 (27%), Positives = 132/293 (45%), Gaps = 19/293 (6%)

Query: 7   DFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTD-DNTHFDQIMLIHDFQDA-SVDAF 63
           +FAK +G+GN  ++ID R      +T++    +         D ++     +     D  
Sbjct: 36  EFAKYQGLGNDFVLIDNRASDAVPVTAEQAAKMCDRNFGIGADGLIFAMPARPGTDEDYS 95

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           +R+ N DGSE + CGNG+RC+ RF         + +   T+ G++  +   DG ++VDMG
Sbjct: 96  MRMFNSDGSEPEMCGNGIRCLARFVSDVDGSAPRKYKVWTLAGLIQPELRADGQVAVDMG 155

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF----------- 170
           +P+L+   +P   +    D                   VSMGNPH + F           
Sbjct: 156 KPVLEPANVPTKLAA-TKDSAAVRCEMDIDGEKWLVTAVSMGNPHCVTFGRAGDGELGAD 214

Query: 171 -VEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
                +  + L+++G     H  F    N     V +   + +  WERG G T ACG+ A
Sbjct: 215 GPGLKVEDFALSTYGPKFESHVNFPARTNTEFTEVVNRGYVKMHVWERGAGATLACGTGA 274

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           CA+VVA     + +R   V++ GG L I W + + +V MTG A+  + G + +
Sbjct: 275 CATVVAGVLEGRVDRECVVELPGGPLEIHWREADGNVIMTGPAEPVFTGVITV 327


>gi|260549304|ref|ZP_05823524.1| diaminopimelate epimerase [Acinetobacter sp. RUH2624]
 gi|260407710|gb|EEX01183.1| diaminopimelate epimerase [Acinetobacter sp. RUH2624]
          Length = 281

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVAEEPEALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQVIDEKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|148239598|ref|YP_001224985.1| diaminopimelate epimerase [Synechococcus sp. WH 7803]
 gi|147848137|emb|CAK23688.1| Diaminopimelate epimerase [Synechococcus sp. WH 7803]
          Length = 368

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 141/288 (48%), Gaps = 14/288 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDN-----ITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  ++++ R    +       SD +  +         D ++L    Q  
Sbjct: 1   MLQFSKYQGLGNDFILVEGRDGRLSESIVSPDSDWVRKICDRRFGLGGDGLILALPPQ-G 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             +  +RI N DGSE + CGNG+RC+ RF          +S++ ET  G+++ +  +DG 
Sbjct: 60  QGELRMRIFNADGSEAEMCGNGIRCLARFLADSDGDSPGRSWSIETPAGMIIPELQQDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P L  +++P   S D     R  +         +   V MGNPH +  V+ DL
Sbjct: 120 IRVDMGAPFLKPEMVPTLLSPDAKGLPRGEVSR--EGLTLSLAAVGMGNPHVVVPVD-DL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 + G  L   P+F    N+   +V   + L++R WERG G T ACG+ ACA++VA
Sbjct: 177 EAIPFEALGAQLECDPLFPAKTNVHFLKVHGRQHLEIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
           +  +  ++   +V + GG L I W      VFMTG A   ++G ++  
Sbjct: 237 AVLMGLSDSEATVVLPGGPLSIRWSDQQGSVFMTGPAVAVFDGVMNPD 284


>gi|86136888|ref|ZP_01055466.1| diaminopimelate epimerase [Roseobacter sp. MED193]
 gi|85826212|gb|EAQ46409.1| diaminopimelate epimerase [Roseobacter sp. MED193]
          Length = 292

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 96/284 (33%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIR 65
            F KM G+GN  +V+D R     IT      ++       FDQ+ LI        DA + 
Sbjct: 26  PFMKMHGLGNDFVVVDARSHPLEITPALARGIAHRQFGVGFDQLALIE---QGKGDAHLT 82

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             N DGS   +CGN  RC+ R L     +      T RG L A +  +G  SV+MG P L
Sbjct: 83  FFNADGSTSAACGNATRCIARHLMDESGKSELHLTTDRGDLFACDAGNGLTSVNMGHPQL 142

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW+ IPL    D ++                P    MGNPH  FFVE D     L  FG 
Sbjct: 143 DWRDIPLREETDTLEL----------PIEGGPTATGMGNPHCTFFVE-DAGLIPLTDFGP 191

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
               HP++ E  N+ +A +   + + +R WERGVG+T A GS++CA+ VA+     T R 
Sbjct: 192 RYEHHPLYPERTNVQVAHLVGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGRR 251

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
           V + + GG L I+W D+  V+MTG     + G     T  +++ 
Sbjct: 252 VQIDLDGGTLWIDWRDDG-VWMTGPTMHVFSGTF---TAAFLES 291


>gi|114705322|ref|ZP_01438230.1| diaminopimelate epimerase [Fulvimarina pelagi HTCC2506]
 gi|114540107|gb|EAU43227.1| diaminopimelate epimerase [Fulvimarina pelagi HTCC2506]
          Length = 312

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 147/294 (50%), Positives = 197/294 (67%), Gaps = 1/294 (0%)

Query: 3   SSM-VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           + M V FA+M G+GN+I+V D+RG    I+  A  AL+  + T FDQIM IHD +    D
Sbjct: 17  ARMSVPFARMNGLGNEIVVADLRGSKTRISPQAARALAGHEATRFDQIMAIHDPRLDGTD 76

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A IRIIN DGSE ++CGNG RCVV+ L S   ++ FTFET  GI++A E  DG I+VDMG
Sbjct: 77  ALIRIINRDGSEAEACGNGTRCVVQALGSENGQRDFTFETRAGIIIAHEADDGMITVDMG 136

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P   W+ IPLA  F         IGP++   L +P V SMGNPHAIF+V++D++ YDL 
Sbjct: 137 RPRFGWEDIPLAEEFRDTRAIELQIGPIDAPVLHSPSVASMGNPHAIFWVKNDVWSYDLE 196

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
            FG +L  HP+F E  N+SIA+VT+ +SL LRTWERGVGLT ACGSAACA+ V++    +
Sbjct: 197 RFGPVLEHHPIFPERANISIAQVTASDSLTLRTWERGVGLTLACGSAACAAAVSAARTGR 256

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEA 295
           T+RAV+V + GG LLI W +++ V MTG A   W G+LD  TG +++  +++  
Sbjct: 257 TDRAVTVTVPGGDLLIHWREDDKVMMTGPATWMWSGRLDPATGDFVRDAQEEAE 310


>gi|254467049|ref|ZP_05080460.1| diaminopimelate epimerase [Rhodobacterales bacterium Y4I]
 gi|206687957|gb|EDZ48439.1| diaminopimelate epimerase [Rhodobacterales bacterium Y4I]
          Length = 266

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 141/281 (50%), Gaps = 19/281 (6%)

Query: 10  KMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIIN 68
           KM G+GN  +V+D R     +T      ++       FDQ+ ++    +   DA +   N
Sbjct: 2   KMHGLGNDFVVLDARAQDIAVTPAMARGIAHRQFGVGFDQLAVL---TNGKGDAHLTFYN 58

Query: 69  CDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWK 128
            DGS   +CGN  RC+ R L     +      T RG L A++  +G  SV+MG P LDW+
Sbjct: 59  ADGSTSGACGNATRCIARHLILETGKPELHLTTDRGDLYARDAGNGLTSVNMGAPQLDWQ 118

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLA   D ++                P    MGNPH  FFVE D     L  FG    
Sbjct: 119 DIPLAEEADTLEL----------PIEGGPTATGMGNPHCTFFVE-DAEVIPLEEFGQRYE 167

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
            HP++ +  N+ +A+VT  + + +R WERGVG+T A GS++CA+ VA+     T R V +
Sbjct: 168 HHPLYPQRTNVQVAQVTGPDRIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGRKVQI 227

Query: 249 KMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
            + GG L I+W ++  V+MTG     ++G L   T ++++ 
Sbjct: 228 DLDGGTLWIDWAEDG-VWMTGPTMHVFDGTL---TREFLES 264


>gi|289207305|ref|YP_003459371.1| diaminopimelate epimerase [Thioalkalivibrio sp. K90mix]
 gi|288942936|gb|ADC70635.1| diaminopimelate epimerase [Thioalkalivibrio sp. K90mix]
          Length = 278

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 135/282 (47%), Gaps = 12/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDAS-VDAF 63
           ++F KM G+GN  +VID       +    +  L+        DQI+L+    D +     
Sbjct: 3   LEFTKMHGLGNDFVVIDGTRQDVRLDEATLRQLADRHFGIGCDQILLVEPPGDPTQALFR 62

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +   + +    ET+ G +V     D  + V+MG
Sbjct: 63  YRIFNADGSEVEQCGNGARCFARFVREQGLTEAREIPVETLGGRIVLHVEDDEHVRVNMG 122

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P+   + IPL    +         G    L       VSMGNPHA+  V+ D+    + 
Sbjct: 123 QPVFTPEQIPLVAEHEADAYTLDVQGHAITLG-----AVSMGNPHAVLLVD-DVASAPVT 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G L+ +H  F   VN+  A +     +DLR +ERGVG T ACGS A A++      + 
Sbjct: 177 EVGPLIERHECFPRRVNVGFAALRDRTHVDLRVFERGVGETLACGSGAAAAMAILRRRNL 236

Query: 242 TNRAVSVKMLGGGLLIEWH--DNNHVFMTGEAKKEWEGKLDI 281
            +  V V + GG L++ W+      V++TG A   + G +D+
Sbjct: 237 VDDEVEVSLPGGTLVLSWNAQAEAPVWLTGPATTVFNGWIDL 278


>gi|89052809|ref|YP_508260.1| diaminopimelate epimerase [Jannaschia sp. CCS1]
 gi|88862358|gb|ABD53235.1| diaminopimelate epimerase [Jannaschia sp. CCS1]
          Length = 281

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 96/275 (34%), Positives = 137/275 (49%), Gaps = 15/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID RG    +T     AL        FDQ+ +I    D+  D  +
Sbjct: 13  LPFLKMHGLGNDFVVIDARGVARAMTPALARALGDRHRGVGFDQLAVIETGTDS--DVEL 70

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R       +   T  T RG+L A +  DG  SV+MGEP+
Sbjct: 71  TFWNADGSTAGACGNATRCIARREMELTGKHRITLRTERGLLEAIDVGDGLTSVNMGEPV 130

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           + W+ IPL  + D ++                P    MGNPH  FFVE D    DL + G
Sbjct: 131 MGWRDIPLKGACDTLNL----------PIDGTPVATGMGNPHCTFFVE-DADAIDLETLG 179

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
               +HP+F +  N+  A V   + L +R WERGVG+T A GS++CA  V++     T R
Sbjct: 180 AKYERHPLFPQRTNVQFAHVVGPDHLRMRVWERGVGVTLASGSSSCAVAVSAARRGLTGR 239

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG + ++W  +  V+MTG     + G+L
Sbjct: 240 KVRLTLDGGEISVDWRSDG-VWMTGPTAHVFSGEL 273


>gi|255291937|dbj|BAH90425.1| diaminopimelate epimerase [uncultured bacterium]
          Length = 305

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 95/303 (31%), Positives = 139/303 (45%), Gaps = 25/303 (8%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  +V+D       +++     L+        DQI+ +       VD   
Sbjct: 3   IRFTKMQGAGNDFVVLDETTALLGLSAAQYRWLADRHFGVGADQILSVRAAPGPGVDFEY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            I N DG EV+ CGNG RC VR++  R    ++    +   G++   E  DG ++VDMG 
Sbjct: 63  VIHNADGGEVEQCGNGARCFVRYVRERGLTDKRRVHVQVRHGVIELVEQADGRVTVDMGA 122

Query: 123 PILDWKLIPLAR------SFDKMDRDRFHIGPVN-------------HLFLRNPFVVSMG 163
           P+ +   IP                  +   P++                + N  V+SMG
Sbjct: 123 PVFELPRIPFDPAGLTPVPAGADAAHLWQWWPLDLGRSAATAVAEPASDAIVNVAVLSMG 182

Query: 164 NPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTA 223
           NPHA+  V  D+    +A  G L+  HP F + VN    ++    ++ LR +ERGVG T 
Sbjct: 183 NPHAVQLV-ADVEAAPVARHGALIESHPAFPKRVNAGFMQILDRAAVRLRVYERGVGETL 241

Query: 224 ACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDI 281
           ACG+ ACA+VVA   L   +  V V   GG L IEW     + VFMTG A   +EG+ +I
Sbjct: 242 ACGTGACAAVVAGVRLGLLDSRVDVHTRGGVLSIEWAGGERDPVFMTGPATTVFEGETEI 301

Query: 282 KTG 284
              
Sbjct: 302 PEL 304


>gi|296284754|ref|ZP_06862752.1| diaminopimelate epimerase [Citromicrobium bathyomarinum JL354]
          Length = 269

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 84/279 (30%), Positives = 133/279 (47%), Gaps = 17/279 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G+GN  +++D R      + +  I AL+       FDQ++++    +A  D  
Sbjct: 3   LPFIKMHGLGNDFVILDGREIDLPSLDTAQIRALADRHRGIGFDQLIVLGPSDEA--DLA 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           +RI N DG EV++CGN  R V             +  T  G L  +          MG  
Sbjct: 61  MRIHNADGGEVEACGNATRAVAVLHGQ-----PASIATAGGTLRVRPGE-NMAEAAMGRA 114

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
              W+ IPLA + D  +       P+    L  P  V++GNPH +FFV+ D     L + 
Sbjct: 115 RFHWQDIPLAYAMDTRE------MPLGWDMLERPSAVNVGNPHIVFFVD-DARAVPLETL 167

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  +   P+F E +N+++A++ S +++ LR WERG GLT ACG+ ACA+   +      +
Sbjct: 168 GPEIETDPLFPERINVNVAQILSRKAIRLRVWERGAGLTLACGTGACATATVAYRQGLVD 227

Query: 244 RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
             V V + GG L I   +   + M G A + + G  ++ 
Sbjct: 228 AEVEVTLPGGTLTIRHDEEGGIHMAGPASEAFRGTFELD 266


>gi|78224185|ref|YP_385932.1| diaminopimelate epimerase [Geobacter metallireducens GS-15]
 gi|78195440|gb|ABB33207.1| diaminopimelate epimerase [Geobacter metallireducens GS-15]
          Length = 282

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 81/285 (28%), Positives = 128/285 (44%), Gaps = 13/285 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++      +     AI   + +     D ++LI     A  D  +
Sbjct: 1   MKFTKMHGAGNDYVYVNCFEERVDNPEQVAIKVSNRNFGIGSDGLILIMPSDKA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAK-------ENRDGSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +         + +   + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVSKKEITAETGAGILTLQLVPGADGKIEKVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L    IP+A   +  D               N   VSMGNPH + FV+ D+  
Sbjct: 119 VNMGVPRLKRAEIPMAG--EPADGQIVSQPLNILHTTFNITCVSMGNPHCVIFVD-DVES 175

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G L+  H +F    N+   ++ S   +  RTWERG G T ACG+ A A  VA  
Sbjct: 176 FQVEKYGPLIENHELFPRRTNVEFVQIISRTEVRQRTWERGAGETLACGTGASAVCVAGA 235

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
               T + +   + GG L +EW D+  ++MTG A + + G++D+ 
Sbjct: 236 LNCLTEKKILNHLSGGDLELEWADDGFLYMTGPATEVFSGEIDLA 280


>gi|184159194|ref|YP_001847533.1| diaminopimelate epimerase [Acinetobacter baumannii ACICU]
 gi|332876023|ref|ZP_08443809.1| diaminopimelate epimerase [Acinetobacter baumannii 6014059]
 gi|229807491|sp|B2HX82|DAPF_ACIBC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|183210788|gb|ACC58186.1| Diaminopimelate epimerase [Acinetobacter baumannii ACICU]
 gi|323519138|gb|ADX93519.1| diaminopimelate epimerase [Acinetobacter baumannii TCDC-AB0715]
 gi|332735889|gb|EGJ66930.1| diaminopimelate epimerase [Acinetobacter baumannii 6014059]
          Length = 281

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      K           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVAEEPKALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|226505860|ref|NP_001141344.1| hypothetical protein LOC100273435 [Zea mays]
 gi|194704094|gb|ACF86131.1| unknown [Zea mays]
 gi|223948299|gb|ACN28233.1| unknown [Zea mays]
          Length = 353

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 131/289 (45%), Gaps = 13/289 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDAS 59
               + F K +G+GN  +++D R          +A      +     D ++ +    +  
Sbjct: 65  SERALHFVKYQGLGNDFIMVDNRDSSVPKVTPEEAAKLCDRNFGIGADGVIFVMPGVN-G 123

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +      FT  T  G +V +   DG +
Sbjct: 124 ADYTMRIFNSDGSEPEMCGNGVRCFARFIAEIENLQGTNRFTIHTGAGKIVPEIQSDGQV 183

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMGEPIL    IP        ++              +   VSMGNPH + F  ++  
Sbjct: 184 KVDMGEPILSGLDIPTKL-LATKNKAVVQAELAVEGLTWHVTCVSMGNPHCVTFGANELK 242

Query: 175 ---LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    L+  G     H MF    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 243 VLQVDDLKLSEIGPKFEHHEMFPARTNTEFVQVLSRSHLKMRVWERGAGATLACGTGACA 302

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            VVA+    +  R   V + GG L IEW + +NHV+MTG A+  + G +
Sbjct: 303 VVVAAVLEGRAERKCVVDLPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 351


>gi|118594102|ref|ZP_01551449.1| diaminopimelate epimerase [Methylophilales bacterium HTCC2181]
 gi|118439880|gb|EAV46507.1| diaminopimelate epimerase [Methylophilales bacterium HTCC2181]
          Length = 286

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 93/278 (33%), Positives = 134/278 (48%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G GN  +VI+    +  +TS  I  L+       FDQ+++I     A  +   
Sbjct: 7   IPFSKMHGSGNDFVVINQIDNNYRLTSSQIKKLADRNFGIGFDQLLIIEKPTQAPAEFKY 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC   +  +         T ET  G++V    +DG ISVDMG 
Sbjct: 67  RIFNADGSEVSQCGNGARCFFHYLRMKKLSSSNEITVETQSGMIVLSYKKDGLISVDMGV 126

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P+ D+K IP       +  +               + +SMGNPHA+  +   L   DL  
Sbjct: 127 PVYDYKQIPF------ISTNTTLPTVTVDDKSYEFYPISMGNPHAVIKL-ASLQGVDLVK 179

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L K   F + VN+   +V    +L L+ +ERG G+T ACGS ACA+ V +      
Sbjct: 180 IGKVLQKSAAFPDSVNVGFVQVIDKHTLSLKVYERGSGMTLACGSGACAAGVVAIQKRWA 239

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              VSV + GG L I       V + G A+  ++G+L+
Sbjct: 240 QNPVSVLVDGGVLTINLTPQGSVELLGPAEWIFDGELN 277


>gi|222054498|ref|YP_002536860.1| Diaminopimelate epimerase [Geobacter sp. FRC-32]
 gi|221563787|gb|ACM19759.1| Diaminopimelate epimerase [Geobacter sp. FRC-32]
          Length = 278

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 81/284 (28%), Positives = 129/284 (45%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +D         +D AI   + +     D ++LI     A V   +
Sbjct: 1   MKFTKMHGAGNDYVYVDCFSEQVENPADVAIKVSNRNFGIGSDGLILIMPSDKAHV--RM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKE-------NRDGSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +          N+   + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVDKKEITAETGAGILTLQLFTNCCNKVDKVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+P L    IP++   D                  N    SMGNPH + FV+ D+ +
Sbjct: 119 VNMGKPRLTRGEIPMSGPADARVVSEPLNILHT---TFNITCASMGNPHCVIFVD-DVDN 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G L+  H +F    N+   ++ S   +  RTWERG G T ACG+ A A  VA  
Sbjct: 175 FQVEKYGPLIENHEIFPRRTNVEFVQIISRTEVRQRTWERGAGETLACGTGASAVCVAGA 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               T++ +   + GG L +EW ++  ++MTG A + + G++ I
Sbjct: 235 LNGLTDKKILNHLSGGDLELEWSEDGFLYMTGPAVEVFSGEIAI 278


>gi|325111163|ref|YP_004272231.1| diaminopimelate epimerase [Planctomyces brasiliensis DSM 5305]
 gi|324971431|gb|ADY62209.1| diaminopimelate epimerase [Planctomyces brasiliensis DSM 5305]
          Length = 281

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 89/283 (31%), Positives = 129/283 (45%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  + +D+      +     A            D ++LI     A  DA 
Sbjct: 1   MKFTKMHGAGNDYVYVDLFREELPVDAPELARQVSDRHTAIGSDGLILIQPSDKA--DAR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRG------ILVAKENRDGSIS 117
           +R+ N DGSE + CGNG+RCV +++      +        G       +  ++ R   + 
Sbjct: 59  MRMFNADGSEAEMCGNGLRCVAKYVYDHDIARKEELTLETGAGLLTVQVFPEDGRVKQVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG+PIL+   IP   + D        +G            VSMGNPH I FV+  L  
Sbjct: 119 VNMGQPILESAKIPTTLAGDPPVEADLQVGDQ----TLKVTCVSMGNPHCITFVDK-LSD 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             +   G  + KH +F   VN     V S   L++R WERG G T ACG+ ACA  VA  
Sbjct: 174 EWVHGVGPQVEKHTVFPNRVNAEFIEVISPTELNMRVWERGSGETMACGTGACAVAVAGV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
              +  R V++ +LGG L +EW  +   VFMTG A + + G+ 
Sbjct: 234 LSGRCERKVTIHLLGGDLELEWSEETGEVFMTGPAVEVYSGEW 276


>gi|154502973|ref|ZP_02040033.1| hypothetical protein RUMGNA_00795 [Ruminococcus gnavus ATCC 29149]
 gi|153796512|gb|EDN78932.1| hypothetical protein RUMGNA_00795 [Ruminococcus gnavus ATCC 29149]
          Length = 292

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 87/283 (30%), Positives = 135/283 (47%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++       N +  A+   + +     D ++LI+  + A  D  +
Sbjct: 16  MKFTKMQGLGNDYVYVNGFEERIENPSEMAVKVSNRNFGVGSDGLILINPSEKA--DFEM 73

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGIL----VAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +      +   + ET+ GI       ++ +   + V
Sbjct: 74  EMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTHISVETLGGIKYLDLTVEDGKVVLVRV 133

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PIL    IP+     +       +    +        VSMGNPHA+ F++ D+ H 
Sbjct: 134 DMGSPILTPAQIPVIADEAEAVAVPILVDETEYQM----TCVSMGNPHAVIFMD-DIEHL 188

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++   G     H  F   VN    +V    +  +R WERG G T ACG+ ACA  VA   
Sbjct: 189 EIEKIGPKFEHHERFPNRVNTEFVKVLDRHTASMRVWERGSGETLACGTGACAVAVACIL 248

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
              T   V+VK+LGG LLIEW  + N ++MTG A+  ++G   
Sbjct: 249 GGYTENKVTVKLLGGDLLIEWDREQNKIYMTGPAEVVFDGVWK 291


>gi|169795021|ref|YP_001712814.1| diaminopimelate epimerase [Acinetobacter baumannii AYE]
 gi|213158316|ref|YP_002320367.1| diaminopimelate epimerase [Acinetobacter baumannii AB0057]
 gi|215482569|ref|YP_002324761.1| diaminopimelate epimerase [Acinetobacter baumannii AB307-0294]
 gi|260556501|ref|ZP_05828719.1| diaminopimelate epimerase [Acinetobacter baumannii ATCC 19606]
 gi|301345398|ref|ZP_07226139.1| diaminopimelate epimerase [Acinetobacter baumannii AB056]
 gi|301511588|ref|ZP_07236825.1| diaminopimelate epimerase [Acinetobacter baumannii AB058]
 gi|301594792|ref|ZP_07239800.1| diaminopimelate epimerase [Acinetobacter baumannii AB059]
 gi|332854281|ref|ZP_08435281.1| diaminopimelate epimerase [Acinetobacter baumannii 6013150]
 gi|332865657|ref|ZP_08436483.1| diaminopimelate epimerase [Acinetobacter baumannii 6013113]
 gi|226724200|sp|B7GY71|DAPF_ACIB3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724201|sp|B7I5Y5|DAPF_ACIB5 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807490|sp|B0VDN4|DAPF_ACIBY RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169147948|emb|CAM85811.1| diaminopimelate epimerase [Acinetobacter baumannii AYE]
 gi|213057476|gb|ACJ42378.1| diaminopimelate epimerase [Acinetobacter baumannii AB0057]
 gi|213989050|gb|ACJ59349.1| diaminopimelate epimerase [Acinetobacter baumannii AB307-0294]
 gi|260409760|gb|EEX03060.1| diaminopimelate epimerase [Acinetobacter baumannii ATCC 19606]
 gi|332728097|gb|EGJ59486.1| diaminopimelate epimerase [Acinetobacter baumannii 6013150]
 gi|332735178|gb|EGJ66258.1| diaminopimelate epimerase [Acinetobacter baumannii 6013113]
          Length = 281

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVAEEPEALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|16127916|ref|NP_422480.1| diaminopimelate epimerase [Caulobacter crescentus CB15]
 gi|221236736|ref|YP_002519173.1| diaminopimelate epimerase [Caulobacter crescentus NA1000]
 gi|21362486|sp|Q9A280|DAPF_CAUCR RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767096|sp|B8GVW2|DAPF_CAUCN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|13425448|gb|AAK25648.1| diaminopimelate epimerase [Caulobacter crescentus CB15]
 gi|220965909|gb|ACL97265.1| diaminopimelate epimerase [Caulobacter crescentus NA1000]
          Length = 288

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 102/279 (36%), Positives = 145/279 (51%), Gaps = 8/279 (2%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDN------THFDQIMLIHDFQDASVD 61
           F KM G+GN  +VI       + T + I A++             DQ++ I   +     
Sbjct: 5   FLKMNGLGNDFVVIQTLTEAFDPTPEQIRAIAKRPGVDGKGGIGCDQVIAIDPPRAEGAS 64

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           A++R  N DG    +CGNG RCV   L     + +  F+T+ G L      D  ++VDMG
Sbjct: 65  AYVRFWNSDGEVAGACGNGTRCVAWLLMQSAGKDAVAFDTVAGRLSGVAAGDKLVTVDMG 124

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P LDW  IPLA   +  +R    +GP++   +  P  VSMGNPH +FFV+  +      
Sbjct: 125 PPGLDWTQIPLAEEMN-TERVELQVGPIDAPLVHTPVCVSMGNPHVVFFVDAPVTDDFAR 183

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G+L+  HP+F EGVN+  A + S + + L+ WERG GLT ACG+ ACA+ VA+     
Sbjct: 184 GTGSLVEHHPLFPEGVNVGFAHIASRDHIRLKVWERGAGLTQACGTGACAAQVAAVRRGL 243

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           T+R   V+   G L IEW + + HV MTG    E+ GKL
Sbjct: 244 TDRKARVEFDTGSLTIEWRESDGHVIMTGPITMEYAGKL 282


>gi|298711974|emb|CBJ32916.1| diaminopimelate epimerase [Ectocarpus siliculosus]
          Length = 285

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 142/280 (50%), Gaps = 8/280 (2%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDD-NTHFDQIMLIHDFQDASV 60
           + +V F+K +G+GN  +++D R   +  +T++   +L         D ++      D  +
Sbjct: 4   TKLVPFSKYQGLGNDFILVDNREETEPMLTAEESASLCDRRYGIGGDGVIFALPGSD-EM 62

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS--FTFETIRGILVAKENRDGSISV 118
           D  +RIIN DGSE + CGNG+RC+ RFL     +K   +   T+ G ++     DG ++V
Sbjct: 63  DYSMRIINSDGSEPEMCGNGIRCMARFLADLEGKKKAEYKIHTLAGTIIPMAREDGLVTV 122

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L+   +P     +           V+         VSMGNPHA+ FV  D+   
Sbjct: 123 DMGPPELNGPKVPSTLPTNDDGVVLKEPIKVDGKD-WEVTCVSMGNPHAVVFV-PDVDAL 180

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL + G     HP F   +N    +V +   + +  WERG G+T ACG+ ACA VVAS  
Sbjct: 181 DLPTIGPQFETHPSFPAKINTEFVQVLNRGHVKMVVWERGCGITQACGTGACALVVASVL 240

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
               +R  +V + GG L IEW + +  V+MTG A+  ++G
Sbjct: 241 AGLADRKCTVTLPGGDLQIEWRESDGKVYMTGPAELAFQG 280


>gi|307943539|ref|ZP_07658883.1| diaminopimelate epimerase [Roseibium sp. TrichSKD4]
 gi|307773169|gb|EFO32386.1| diaminopimelate epimerase [Roseibium sp. TrichSKD4]
          Length = 321

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 125/298 (41%), Positives = 175/298 (58%), Gaps = 5/298 (1%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDAS 59
           M S+ V F KM G+GN  +V D R    N+  + I AL   D    FDQ++ +       
Sbjct: 15  MASARVPFLKMNGLGNDFVVWDARSSAFNLPKEKIAALGNRDTGIGFDQMITVERSPL-G 73

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKEN-RDGSISV 118
           VDAF+RI NCDGS+V +CGN  RCV R L         T ET  G+L A       +++V
Sbjct: 74  VDAFMRIHNCDGSQVDACGNATRCVGRLLMEEKSTDRATIETKAGLLNAFATAVPRTVTV 133

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG+P L+W  IPLA  F         IGP++  +L  P  +SMGNPHAIF+V+ D+  +
Sbjct: 134 DMGKPRLNWDEIPLAEEFYDTRAIELQIGPIDAPYLHTPAAISMGNPHAIFWVK-DVEAH 192

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL + G LL  HP+F EG N+S+A V +   + L+ WERG GLT ACG+AACA+ VA+  
Sbjct: 193 DLGTIGPLLEHHPVFPEGANISLAHVFAENQIRLKVWERGAGLTQACGTAACAAAVAAAR 252

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEA 295
             K  R  ++ + GG + IEW + ++HV MTG  + E+EG++D+ T +W +    D+A
Sbjct: 253 DDKAGRKSTIHLPGGPIEIEWREGDDHVLMTGLTEVEFEGEVDLDTLEWQRTGPGDDA 310


>gi|254508790|ref|ZP_05120901.1| diaminopimelate epimerase [Vibrio parahaemolyticus 16]
 gi|219548247|gb|EED25261.1| diaminopimelate epimerase [Vibrio parahaemolyticus 16]
          Length = 269

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 91/273 (33%), Positives = 130/273 (47%), Gaps = 10/273 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   RI N 
Sbjct: 1   MHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRIFNA 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMGEPILDW 127
           DGSEV+ CGNG RC  RF+  +     ++    T +G +V     D  ++V+MG P  + 
Sbjct: 61  DGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMVLNIEEDDQVTVNMGVPEFEP 120

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             IP          ++ +I       L     VSMGNPH    V DD+   D+ + G LL
Sbjct: 121 NKIPFKAK----QTEKTYILRAEDKTLFCG-AVSMGNPHV-VTVVDDVATADVETLGPLL 174

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             H  F E VN    +V S   ++LR +ERG G T ACGS AC +V         +  V+
Sbjct: 175 ESHERFPERVNAGFMQVISRNEVNLRVYERGAGETQACGSGACGAVAVGVVQGLLDEHVT 234

Query: 248 VKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
           V + GG L I W      +FMTG A   ++G+L
Sbjct: 235 VHLPGGDLKISWKGPGKPLFMTGPATHVFDGQL 267


>gi|148265927|ref|YP_001232633.1| diaminopimelate epimerase [Geobacter uraniireducens Rf4]
 gi|146399427|gb|ABQ28060.1| diaminopimelate epimerase [Geobacter uraniireducens Rf4]
          Length = 278

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 77/284 (27%), Positives = 128/284 (45%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++      +  +D AI   + +     D ++LI     A  D  +
Sbjct: 1   MKFTKMHGAGNDYVYVNCFSERVDNPADVAIKVSNRNFGIGSDGLILIMPSDKA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKE-------NRDGSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +          N+   + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVGKKEISAETGAGILTLQLFTNEANKVEKVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L    IP+         +             +    SMGNPH + FV+ D+ +
Sbjct: 119 VNMGRPRLTRSEIPMTGEAGAKVINEPLNILHT---TFHITCASMGNPHCVIFVD-DVEN 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G ++  H +F    N+   ++ S   +  RTWERG G T ACG+ A A  VA  
Sbjct: 175 FQVEKYGPIIENHEIFPRRTNVEFVQIISRTEVRQRTWERGAGETLACGTGASAVCVAGA 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               T + +   + GG L +EW ++  ++MTG A + + G+++I
Sbjct: 235 LNGLTEKKILNHLSGGDLELEWAEDGFLYMTGPAVEVFSGEIEI 278


>gi|171320564|ref|ZP_02909588.1| Diaminopimelate epimerase [Burkholderia ambifaria MEX-5]
 gi|171094191|gb|EDT39274.1| Diaminopimelate epimerase [Burkholderia ambifaria MEX-5]
          Length = 282

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 90/283 (31%), Positives = 136/283 (48%), Gaps = 11/283 (3%)

Query: 11  MEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIIN 68
           M G GN  +V+D        +T   + AL+        DQ++L+        D   RI N
Sbjct: 1   MHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFKYRIFN 60

Query: 69  CDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
           CDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG P+  
Sbjct: 61  CDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMGAPVFA 120

Query: 127 WKLIPL-ARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
              +P  A   D     R  + P++     R    VSMGNPHA+  V+ D+  Y +   G
Sbjct: 121 PAQVPFDATGLDGRTEGRDTLWPLDVGGATRWISAVSMGNPHAVQVVD-DVEAYPVLEEG 179

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+  H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A       + 
Sbjct: 180 PLIEHHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRRGLLDS 239

Query: 245 AVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 240 PVTVHTHGGTLTIGWDGARDEAAALMMAGPAATVFEGEIDLTA 282


>gi|239500989|ref|ZP_04660299.1| diaminopimelate epimerase [Acinetobacter baumannii AB900]
          Length = 281

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVADEPEALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|229807519|sp|A3M804|DAPF_ACIBT RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|193078107|gb|ABO13048.2| diaminopimelate epimerase [Acinetobacter baumannii ATCC 17978]
          Length = 281

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVADEPEALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E VN    +V   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVELHKRFPERVNAGFMQVIDDKHVRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|225439868|ref|XP_002278566.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 370

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 95/291 (32%), Positives = 138/291 (47%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           +S  + F K  G+GN  +++D R   +  +T +    L         D ++         
Sbjct: 82  ESGFLHFVKYHGLGNDFILVDNRDSSEPKLTPEQAVKLCDRNFGIGADGVIFAMPG-ING 140

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +   ++SFT  T  G++V +   DG +
Sbjct: 141 TDYTMRIFNSDGSEPEMCGNGVRCFARFIAELENLHGKQSFTLHTGAGLIVPEIQDDGKV 200

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-----V 171
            VDMG+PIL    +P     +  D+              N   VSMGNPH + F      
Sbjct: 201 KVDMGKPILKALDVPTKLPAN-KDQSVVKSELNVDGVSWNVTCVSMGNPHCVTFGTKGGQ 259

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +   +LA  G     H MF    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 260 NLQVDELNLADIGPKFEHHAMFPARTNTEFVQVISRSHLKMRVWERGAGATLACGTGACA 319

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            VVA+       R+ +V + GG L IEW  ++NHV+MTG A+  + G + +
Sbjct: 320 VVVAAVLEGHAGRSCTVDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 370


>gi|86148172|ref|ZP_01066470.1| diaminopimelate epimerase [Vibrio sp. MED222]
 gi|218710944|ref|YP_002418565.1| diaminopimelate epimerase [Vibrio splendidus LGP32]
 gi|254767122|sp|B7VMD4|DAPF_VIBSL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|85834019|gb|EAQ52179.1| diaminopimelate epimerase [Vibrio sp. MED222]
 gi|218323963|emb|CAV20325.1| Diaminopimelate epimerase [Vibrio splendidus LGP32]
          Length = 276

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 133/277 (48%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIR 65
            F+KM G+GN  +V+D    +   + D I  L+       FDQ++++    D   D   R
Sbjct: 4   HFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYR 63

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGEP 123
           I N DGSEV+ CGNG RC  RF+  +     ++    T +G +V K   +  I+V+MG P
Sbjct: 64  IFNADGSEVEQCGNGARCFARFVRMKGLTNKYSINVSTKKGKMVLKIEDNDLITVNMGIP 123

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
             +   IP          ++ +I   +   L     VSMGNPH    V DD+   D+ + 
Sbjct: 124 EFEPGKIPFKAKQP----EKTYILRTDVHTLFCG-AVSMGNPHV-VTVVDDVDTADVDTL 177

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  H  F E VN    +V + E + LR +ERG G T ACGS AC +V          
Sbjct: 178 GPLLESHERFPERVNAGFMQVVNREEVRLRVYERGAGETQACGSGACGAVAVGITQGLLA 237

Query: 244 RAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKL 279
             V V++ GG L I W      + MTG A   ++G+L
Sbjct: 238 ENVKVRLPGGDLHISWQGPGKPLLMTGPATHVFDGQL 274


>gi|22124300|ref|NP_667723.1| diaminopimelate epimerase [Yersinia pestis KIM 10]
 gi|45442954|ref|NP_994493.1| diaminopimelate epimerase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594545|ref|YP_068736.1| diaminopimelate epimerase [Yersinia pseudotuberculosis IP 32953]
 gi|108806175|ref|YP_650091.1| diaminopimelate epimerase [Yersinia pestis Antiqua]
 gi|108810285|ref|YP_646052.1| diaminopimelate epimerase [Yersinia pestis Nepal516]
 gi|145600712|ref|YP_001164788.1| diaminopimelate epimerase [Yersinia pestis Pestoides F]
 gi|153949600|ref|YP_001399202.1| diaminopimelate epimerase [Yersinia pseudotuberculosis IP 31758]
 gi|153997099|ref|ZP_02022232.1| diaminopimelate epimerase [Yersinia pestis CA88-4125]
 gi|162421020|ref|YP_001605134.1| diaminopimelate epimerase [Yersinia pestis Angola]
 gi|165926336|ref|ZP_02222168.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939113|ref|ZP_02227664.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011684|ref|ZP_02232582.1| diaminopimelate epimerase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213579|ref|ZP_02239614.1| diaminopimelate epimerase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401857|ref|ZP_02307345.1| diaminopimelate epimerase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420950|ref|ZP_02312703.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426291|ref|ZP_02318044.1| diaminopimelate epimerase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170026222|ref|YP_001722727.1| diaminopimelate epimerase [Yersinia pseudotuberculosis YPIII]
 gi|186893545|ref|YP_001870657.1| diaminopimelate epimerase [Yersinia pseudotuberculosis PB1/+]
 gi|218930848|ref|YP_002348723.1| diaminopimelate epimerase [Yersinia pestis CO92]
 gi|229837175|ref|ZP_04457340.1| diaminopimelate epimerase [Yersinia pestis Pestoides A]
 gi|229839535|ref|ZP_04459694.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229900098|ref|ZP_04515235.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229900456|ref|ZP_04515585.1| diaminopimelate epimerase [Yersinia pestis Nepal516]
 gi|270488810|ref|ZP_06205884.1| diaminopimelate epimerase [Yersinia pestis KIM D27]
 gi|294505509|ref|YP_003569571.1| diaminopimelate epimerase [Yersinia pestis Z176003]
 gi|17380442|sp|P46357|DAPF_YERPE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|81640737|sp|Q66FZ5|DAPF_YERPS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123246795|sp|Q1CNH8|DAPF_YERPN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123372750|sp|Q1CBM6|DAPF_YERPA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166225764|sp|A4TRA3|DAPF_YERPP RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167012039|sp|A7FD74|DAPF_YERP3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813257|sp|B2K072|DAPF_YERPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813258|sp|A9R8K5|DAPF_YERPG RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229813259|sp|B1JPE1|DAPF_YERPY RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|21957072|gb|AAM83974.1|AE013639_3 diaminopimelate epimerase [Yersinia pestis KIM 10]
 gi|45437821|gb|AAS63370.1| diaminopimelate epimerase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51587827|emb|CAH19430.1| diaminopimelate epimerase [Yersinia pseudotuberculosis IP 32953]
 gi|108773933|gb|ABG16452.1| diaminopimelate epimerase [Yersinia pestis Nepal516]
 gi|108778088|gb|ABG12146.1| diaminopimelate epimerase [Yersinia pestis Antiqua]
 gi|115349459|emb|CAL22432.1| diaminopimelate epimerase [Yersinia pestis CO92]
 gi|145212408|gb|ABP41815.1| diaminopimelate epimerase [Yersinia pestis Pestoides F]
 gi|149289405|gb|EDM39483.1| diaminopimelate epimerase [Yersinia pestis CA88-4125]
 gi|152961095|gb|ABS48556.1| diaminopimelate epimerase [Yersinia pseudotuberculosis IP 31758]
 gi|162353835|gb|ABX87783.1| diaminopimelate epimerase [Yersinia pestis Angola]
 gi|165912886|gb|EDR31512.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921860|gb|EDR39057.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989453|gb|EDR41754.1| diaminopimelate epimerase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205252|gb|EDR49732.1| diaminopimelate epimerase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961079|gb|EDR57100.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048750|gb|EDR60158.1| diaminopimelate epimerase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054810|gb|EDR64614.1| diaminopimelate epimerase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752756|gb|ACA70274.1| Diaminopimelate epimerase [Yersinia pseudotuberculosis YPIII]
 gi|186696571|gb|ACC87200.1| diaminopimelate epimerase [Yersinia pseudotuberculosis PB1/+]
 gi|229682475|gb|EEO78562.1| diaminopimelate epimerase [Yersinia pestis Nepal516]
 gi|229686878|gb|EEO78957.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229695901|gb|EEO85948.1| diaminopimelate epimerase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229706118|gb|EEO92127.1| diaminopimelate epimerase [Yersinia pestis Pestoides A]
 gi|262363575|gb|ACY60296.1| diaminopimelate epimerase [Yersinia pestis D106004]
 gi|262367503|gb|ACY64060.1| diaminopimelate epimerase [Yersinia pestis D182038]
 gi|270337314|gb|EFA48091.1| diaminopimelate epimerase [Yersinia pestis KIM D27]
 gi|294355968|gb|ADE66309.1| diaminopimelate epimerase [Yersinia pestis Z176003]
 gi|320013557|gb|ADV97128.1| diaminopimelate epimerase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 274

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   + + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+  +    ++  +  T  G ++     D  + V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  + + +P   +        + +    H  L    VVSMGNPH +  V+ D+   ++A 
Sbjct: 121 PDFEPQTVPFRAA---KAEKTYILRAAEHTVLCG--VVSMGNPHCVMQVD-DVSVANVAL 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G +L  H  F E  N+   +V S + + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPVLENHERFPERANIGFMQVVSRDHIRLRVYERGAGETQACGSGACAAVAVGVVQDLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V++ GG L I W    H ++MTG A   ++G + +
Sbjct: 235 NENVHVELPGGSLHIRWQGPGHPLYMTGPATHVYDGFIHL 274


>gi|172062034|ref|YP_001809686.1| diaminopimelate epimerase [Burkholderia ambifaria MC40-6]
 gi|171994551|gb|ACB65470.1| Diaminopimelate epimerase [Burkholderia ambifaria MC40-6]
          Length = 282

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 87/283 (30%), Positives = 132/283 (46%), Gaps = 11/283 (3%)

Query: 11  MEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFIRIIN 68
           M G GN  +V+D        +T   + AL+        DQ++L+        D   RI N
Sbjct: 1   MHGAGNDFVVLDGYSRALPPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFKYRIFN 60

Query: 69  CDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
           CDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG P+  
Sbjct: 61  CDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMGAPVFA 120

Query: 127 WKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
              +P   S      +              R    VSMGNPHA+  V+ D+  Y +   G
Sbjct: 121 PAQVPFDASGLDGRAEGRDTLWPLDVGGATRWISAVSMGNPHAVQVVD-DVEAYPVLEEG 179

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+ +H  F + VN    ++ S   + LR +ERG G T ACG+ ACA+V A       + 
Sbjct: 180 PLIERHARFPQRVNAGFMQIVSRHEVKLRVYERGAGETLACGTGACAAVAAGIRRGLLDS 239

Query: 245 AVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
            V+V   GG L I W     +   + M G A   +EG++D+  
Sbjct: 240 PVTVHTHGGTLTIGWDGARDEAAALMMAGPAATVFEGEIDLTA 282


>gi|262376586|ref|ZP_06069814.1| diaminopimelate epimerase [Acinetobacter lwoffii SH145]
 gi|262308296|gb|EEY89431.1| diaminopimelate epimerase [Acinetobacter lwoffii SH145]
          Length = 281

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 139/281 (49%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      +    I  L+       FDQ++++      S D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDPVTIQRLANRNFGIGFDQLLVVEPPDVPSADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC  +F+  R    +     +T  GI+  +   +G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFAKFVHDRQLTTKTKIKVQTKSGIVEPELGANGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    + IP          +  +   +         VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPQEIPFVADAP----ESLYDIDLAGGEKLTIDVVNMGNPHAVTIV-PDVIAADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F   VN    ++   +   LR +ERGVG T ACG+ ACA+ ++      
Sbjct: 177 RIGPQVEAHARFPARVNAGFMQIIDEKHARLRVYERGVGETLACGTGACAAAISGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
            +  V +++ GG L IEW + + V+MTG     +EG+LD++
Sbjct: 237 LSSKVEIELAGGKLQIEWKEGDVVWMTGPTATVYEGRLDLR 277


>gi|124023206|ref|YP_001017513.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9303]
 gi|123963492|gb|ABM78248.1| Diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9303]
          Length = 323

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 135/285 (47%), Gaps = 14/285 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMR-----GCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  ++ID R         N     +  +         D ++L    + A
Sbjct: 1   MLQFSKYQGLGNDFVLIDGREGQLSDQVINPDPAWVRKICDRHFGIGADGLILALPPR-A 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             D  ++I N DGS  + CGNG+RC+ RF   +   +  + +  ET+ GI+      DG 
Sbjct: 60  DGDLRMQIFNADGSLAEMCGNGIRCLTRFLADIDGDLCAQRWNIETLAGIICPILQEDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P LD + IP   +       +            N   V MGNPH I  VE DL
Sbjct: 120 ICVDMGSPFLDPESIPTTLTIGSAGLPQGEC--HLGGTSLNVAAVGMGNPHVIVPVE-DL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                  +G +L KH  F    N+   ++ S   L++R WERG G T ACG+ ACAS+VA
Sbjct: 177 ESIPFEKWGQILEKHQTFPAKTNVHFLKIHSTNQLEIRVWERGSGPTLACGTGACASLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +  L  ++    V + GG L I W      VFMTG A+  ++G L
Sbjct: 237 ACLLGLSDDHAEVLLPGGVLQISWPGRRGSVFMTGPAEPVFDGVL 281


>gi|323702031|ref|ZP_08113699.1| diaminopimelate epimerase [Desulfotomaculum nigrificans DSM 574]
 gi|323532913|gb|EGB22784.1| diaminopimelate epimerase [Desulfotomaculum nigrificans DSM 574]
          Length = 281

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 90/288 (31%), Positives = 138/288 (47%), Gaps = 16/288 (5%)

Query: 6   VDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           + F K+ G+GN  ++++     G  D+  + A            D ++L+ D      D 
Sbjct: 1   MHFTKVHGLGNDFILVNAGMGEGLPDDYITLAPKMCDRRFGIGADGLVLLLDS--GVADV 58

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGS----I 116
            +RIIN DGSE + CGN +RCV ++L       +     ET+ GI+V +  +       +
Sbjct: 59  RMRIINSDGSEAEMCGNAIRCVAKYLYEHGIVRKDEIKVETLAGIIVPQIIQKNGRVEAV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMG P L+ + IP+  +  ++  +   +             VSMGNPH + FV  DL 
Sbjct: 119 RVDMGAPRLERQEIPMLGTPGQVVNEPLQVNGQTFKI----TAVSMGNPHCVIFV-PDLS 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L   G  +  HP F    N+   +V S   + +  WERG G T ACG+ ACA   A 
Sbjct: 174 VIPLNQIGPQIETHPAFPRKTNVEFVQVLSPTEVRMMVWERGAGPTMACGTGACAVATAG 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
                T R+V+V + GG L IEW DN  ++MTG A++ + G+  +  G
Sbjct: 234 VLNGLTARSVTVHLPGGSLHIEWADNGRLYMTGPAEEVFNGEYIVYNG 281


>gi|291544783|emb|CBL17892.1| diaminopimelate epimerase [Ruminococcus sp. 18P13]
          Length = 279

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 88/285 (30%), Positives = 135/285 (47%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  + ++       N    ++           D ++LI   Q A  D  +
Sbjct: 1   MKFTKMQGIGNDYIYVNCFEEQVVNPEQLSVRLSDRRFGIGGDGLILIMPSQIA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISV 118
           RI N DGSE   CGNG RC+ +++       +   T ET  GI   + +  G     ++V
Sbjct: 59  RIFNADGSEAMMCGNGTRCIGKYVYEHGLTNKTHITLETNSGIKYLELHCTGDQVTSVTV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG+ IL  + IP+     +    +          L     VS+GNPHA+ F +  +   
Sbjct: 119 DMGKAILTPREIPVESDSQEPFVAKPVQVG---DRLERLTCVSVGNPHAVVFCDR-VEDL 174

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL   G L   H +F + VN    RV    +L +R WERG G T ACG+ ACA+ VA+  
Sbjct: 175 DLEKLGPLFEHHAIFPDRVNTEFVRVIDDHTLQMRVWERGSGETLACGTGACATTVAAVL 234

Query: 239 LHKT--NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
                    + VK+ GG L I +  +  V MTG A++ ++G++++
Sbjct: 235 NGYCPQGEPILVKLRGGDLTITYQADGTVMMTGPAEEVFQGEINL 279


>gi|159479426|ref|XP_001697794.1| diaminopimelate epimerase [Chlamydomonas reinhardtii]
 gi|158274162|gb|EDO99946.1| diaminopimelate epimerase [Chlamydomonas reinhardtii]
          Length = 318

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 86/293 (29%), Positives = 135/293 (46%), Gaps = 16/293 (5%)

Query: 1   MQSSM-VDFAKMEGIGNKILVIDMRGCHDNI-TSDAINALSTD-DNTHFDQIMLIHDFQD 57
           M S+  + F+K +G+GN  +++D R   + + T +    +         D ++       
Sbjct: 26  MASAKPLTFSKYQGLGNDFILVDNRHTSEPVVTPEQAVKICDRNFGIGGDGVIFALPP-V 84

Query: 58  ASVDAFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGS 115
              D  +RI N DGSE + CGNG+RC+ +F         + +   T+ G++  +   DG 
Sbjct: 85  GDTDLTMRIFNSDGSEPEMCGNGIRCLAKFVSDIDNAAPRKYKIHTLAGLIQPEMLADGQ 144

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV---- 171
           + VDMG PIL+   +P   +             V          VSMGNPHA+ +     
Sbjct: 145 VRVDMGTPILEGPKVPTTLA-PTQGSTVVQQDLVVEGKTYKVTCVSMGNPHAVIYSCDGE 203

Query: 172 --EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
             + D    +LA+ G    ++ +F    N     V S   + +  WERG G T ACG+ A
Sbjct: 204 PIKIDDLDKELAALGPKFERNAVFPARTNTEFVEVISRSHVRMVVWERGAGRTLACGTGA 263

Query: 230 CASVVASGCLHKTNRA--VSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           CA VVA     + +R     V + GG L IEW   +NH++MTG A+  + G+L
Sbjct: 264 CALVVAGILEGRVDRNQVCRVDLPGGPLQIEWRQSDNHIYMTGPAELVFSGQL 316


>gi|255658378|ref|ZP_05403787.1| diaminopimelate epimerase [Mitsuokella multacida DSM 20544]
 gi|260849709|gb|EEX69716.1| diaminopimelate epimerase [Mitsuokella multacida DSM 20544]
          Length = 278

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 89/283 (31%), Positives = 134/283 (47%), Gaps = 14/283 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+K +G GN  +++D    +  +  + A            D ++ +     A  D  +
Sbjct: 1   MRFSKWQGCGNDFVLVDCFKENVSDFAAFAKKVCDRHYGIGGDGVLYVLPSDKA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRD----GSISV 118
           RI N DGSE + CGNG+RC           +++ FT ET  GILV +   +      + V
Sbjct: 59  RIFNTDGSEAEMCGNGIRCFARYLHDFGLTEKEEFTVETGAGILVPRLQIEAGKVTGVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEP+L+ + IP+                           VSMGNPH + FVE D   +
Sbjct: 119 DMGEPVLEGEKIPVTG---FGMNRVIEEDIEVKGKTYKMTCVSMGNPHCVIFVE-DAEAF 174

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G     HP F    N     V   + + +R WERG  +T ACG+ +CA+ VA   
Sbjct: 175 PIYELGASFESHPAFPRKTNTEFVEVRDRQHVRMRVWERGAAVTLACGTGSCATGVAGVL 234

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
             +T+R V V++ GG L +EW +  NHVFMTG A+  + G++D
Sbjct: 235 TGRTDRKVEVELDGGKLTVEWDEATNHVFMTGPAELVFTGEID 277


>gi|255020693|ref|ZP_05292755.1| Diaminopimelate epimerase [Acidithiobacillus caldus ATCC 51756]
 gi|254969929|gb|EET27429.1| Diaminopimelate epimerase [Acidithiobacillus caldus ATCC 51756]
          Length = 290

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 98/277 (35%), Positives = 131/277 (47%), Gaps = 10/277 (3%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIR 65
            F KMEG+GN  +V+D    +  +  +    ++        DQI+L+        D   R
Sbjct: 14  PFTKMEGLGNDFVVLDGVRRNFLLDPETCQRIAHRHYGIGCDQILLVEPASSPDCDFRYR 73

Query: 66  IINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEP 123
           I N DG EV  CGNG RC            ++S   ET  G L  + + DG+++VDMG P
Sbjct: 74  IFNADGGEVGQCGNGARCFALFVRRAGLTDKRSIRVETASGPLELQVHDDGTVTVDMGVP 133

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            LD   IP          +       +H+ L     V MGNPHA+  VE D+    +A  
Sbjct: 134 RLDPADIPFRAPA--AANNYRLDLGQDHIELA---AVGMGNPHALLRVE-DVRGAPVAEI 187

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G LL  HP F E  N+    + S  +L LRTWERG G T ACGS ACA+VVA        
Sbjct: 188 GPLLEHHPAFPERTNVGFMEIVSPHALRLRTWERGAGETLACGSNACAAVVAGRGWGALR 247

Query: 244 RAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
             V V++ GG L I W     H+ MTG A+  ++G  
Sbjct: 248 ERVRVELPGGSLEIHWPGPGQHLRMTGPARVVFDGVW 284


>gi|254504487|ref|ZP_05116638.1| diaminopimelate epimerase [Labrenzia alexandrii DFL-11]
 gi|222440558|gb|EEE47237.1| diaminopimelate epimerase [Labrenzia alexandrii DFL-11]
          Length = 293

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 119/287 (41%), Positives = 164/287 (57%), Gaps = 5/287 (1%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V D R     +T D I  L        FDQ++ +       VDAF+RI N 
Sbjct: 1   MNGLGNDFVVWDAREKPLRLTKDQIAKLGDREHGIGFDQMITVERST-CGVDAFMRIHNS 59

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD-GSISVDMGEPILDWK 128
           DG +V +CGN  RC+ R L     +   T ET  G+L A +     +++VDMG+P L+W 
Sbjct: 60  DGGQVDACGNATRCIGRLLMEENAKDLVTIETNAGLLHAFDAAGLRNVTVDMGKPRLNWD 119

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLA  F         IGP++   L  P VV+MGNPHAIF+V+ D+  YDLA  G LL 
Sbjct: 120 QIPLAEEFADTRAIELQIGPIDEPILHTPAVVNMGNPHAIFWVK-DVEAYDLARVGPLLE 178

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
           +HP+F EG N+S+A +     + ++ WERG GLT ACG+AACA  VA+    KT R  ++
Sbjct: 179 RHPVFPEGANISLAHIFDDNQIRVKVWERGAGLTLACGTAACAVGVAAARDDKTGRKTTI 238

Query: 249 KMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDE 294
            + GG + IEW + + HV MTG  + E+EG++DI+T  W K    D 
Sbjct: 239 HLPGGPIGIEWREGDGHVLMTGLTEVEFEGEVDIETLTWRKTAGGDA 285


>gi|113954972|ref|YP_730575.1| diaminopimelate epimerase [Synechococcus sp. CC9311]
 gi|113882323|gb|ABI47281.1| diaminopimelate epimerase [Synechococcus sp. CC9311]
          Length = 380

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 86/288 (29%), Positives = 138/288 (47%), Gaps = 14/288 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNIT-----SDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  ++++ R     +       + +  L         D ++L    +  
Sbjct: 1   MLQFSKYQGLGNDFVLLEGRAGQLPLNIAEPDPNWVRQLCDRRFGIGGDGLILALPPEHG 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             +  +RI N DGSE + CGNG+RC+ RF          +++  ET+ G++V +   DG 
Sbjct: 61  E-ELRMRIFNADGSEAEMCGNGIRCLARFLADSDGDQPGRTWRTETMAGVIVPELCEDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG+P L+   +P      +    +  I             V MGNPH +  V+ DL
Sbjct: 120 IRVDMGKPFLNSDQVPTNLPQGRSGLPQGEIDLQGSTL--QLAAVGMGNPHVVVPVQ-DL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 ++G+ L    +F    N+    V    +L++R WERG G T ACG+ ACA++VA
Sbjct: 177 KSIPFDAWGSALEVDSLFPAKTNVHFLEVIDQHTLEIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKLDIK 282
           +  L  +    +VK+ GG L I W      VFMTG A   ++G L+ +
Sbjct: 237 ASLLGLSESEATVKLPGGPLEISWPDPKGSVFMTGPAVSVFDGVLNPE 284


>gi|317969888|ref|ZP_07971278.1| diaminopimelate epimerase [Synechococcus sp. CB0205]
          Length = 341

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 89/285 (31%), Positives = 132/285 (46%), Gaps = 14/285 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMR-----GCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M  F+K +G+GN  L++D R          +T + +  L         D ++L     + 
Sbjct: 1   MFQFSKYQGLGNDFLMLDGRQSGDTDFLFGLTPELVVQLCDRRFGVGGDGVILALPP-NG 59

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             +  +RI N DG+E + CGNG+RC+ RF          +++  +T+ G +V +   DG+
Sbjct: 60  GGELRMRIFNADGTEPEMCGNGIRCLARFLADCDGDGPGRTWQVDTLAGRIVPELLPDGT 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P L    IP      +       +      F        MGNPH +  V+  +
Sbjct: 120 IRVDMGAPFLKPSEIPTTLEVGEAGLPSGELEIDGERF--AVAAAGMGNPHVVVPVD-SV 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
              DL  FG+ L  HP F    N+    V S   L +R WERG G T ACG+ ACA++VA
Sbjct: 177 DEIDLERFGSQLEIHPAFPAKTNVHFVEVLSPSHLVMRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
              L  + R   + + GG L I W   N  VFM G A+  ++G +
Sbjct: 237 CHRLGLSERTARIDLPGGPLQIHWDAMNGKVFMDGPAEHVFDGSI 281


>gi|255320349|ref|ZP_05361533.1| diaminopimelate epimerase [Acinetobacter radioresistens SK82]
 gi|262379368|ref|ZP_06072524.1| diaminopimelate epimerase [Acinetobacter radioresistens SH164]
 gi|255302544|gb|EET81777.1| diaminopimelate epimerase [Acinetobacter radioresistens SK82]
 gi|262298825|gb|EEY86738.1| diaminopimelate epimerase [Acinetobacter radioresistens SH164]
          Length = 281

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 146/281 (51%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +V+D+        +  I  L+       FDQ++++      + D  
Sbjct: 1   MLEFTKMHGLGNDFMVVDLITQRAYFDTLTIQRLADRHFGIGFDQLLIVEPPDLPTADFK 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC  RF+  R    +     +T  GI+  K   +G + V+MG
Sbjct: 61  YRIFNADGSEVEQCGNGVRCFARFVHERQLTTKTKIKVQTKSGIVEPKLGPNGWVRVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    +LIP        + D  +   +N+  L    VV+MGNPHA+  V  D+   ++A
Sbjct: 121 YPKFAPELIPFVTE----ETDPLYALELNNNQLLKIDVVNMGNPHAVTIV-PDVLTAEVA 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S G  +  H  F E VN+   ++ + + + LR +ERG G T ACG+ ACA+ V+      
Sbjct: 176 SIGPQVESHVRFPERVNVGFMQILNEKQVRLRVFERGSGETLACGTGACAAAVSGMRRGL 235

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
               V V++ GG L I W + + V+MTG     +EG+LD++
Sbjct: 236 LAPEVEVELAGGKLQIGWREGDVVWMTGPTANVYEGRLDLR 276


>gi|260438092|ref|ZP_05791908.1| diaminopimelate epimerase [Butyrivibrio crossotus DSM 2876]
 gi|292809572|gb|EFF68777.1| diaminopimelate epimerase [Butyrivibrio crossotus DSM 2876]
          Length = 277

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 87/283 (30%), Positives = 135/283 (47%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KMEG+GN  + ++       + +  AI           D ++LI     A  D F+
Sbjct: 1   MKFTKMEGLGNDYVYVNCLEEQIADPSKTAIEVSDRHFGIGSDGLILIKPSDKA--DFFM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGS----ISV 118
            + N DGS+ + CGNG+RCV    +      +   T +T+ GI     N +      + V
Sbjct: 59  EMYNADGSQGKMCGNGIRCVGKFVYDYGLTDKTEITVDTLAGIKYLSLNIENKAVKSVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG+P     LIP+    D +    F  G   +        VSMGNPH I +++ D+ + 
Sbjct: 119 NMGKPEFTPALIPVKADGDVVIDKEFIFGGNAYRI----TCVSMGNPHCITYMD-DIKNL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++   G +     +F + VN     V   ++L +R WERG G T ACG+ ACA  VAS  
Sbjct: 174 EIEKIGPVFENDSIFPDRVNTEFVEVIDRDTLSMRVWERGSGETLACGTGACAVAVASIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
               N +V+VK+LGG L I W  + + V+M G A   + G+ +
Sbjct: 234 NGLCNDSVTVKLLGGDLKITWDREADVVYMEGPANIVFTGEWN 276


>gi|91791758|ref|YP_561409.1| diaminopimelate epimerase [Shewanella denitrificans OS217]
 gi|123061318|sp|Q12S90|DAPF_SHEDO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|91713760|gb|ABE53686.1| diaminopimelate epimerase [Shewanella denitrificans OS217]
          Length = 275

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 141/281 (50%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLANRNFGVGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+ ++   ++      T  G +  +  RDGS+ V+MG
Sbjct: 61  YRIFNADGSEVEQCGNGARCFARFVRNKGLTQKNKIRVSTSSGKMTLRLERDGSVVVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+ D   IP         +          +       +SMGNPH +  V+ D+    + 
Sbjct: 121 VPVTDPSNIPFKAK-----KVEKTYLLQTPVQTFLCGAISMGNPHCVIEVD-DIDTVAVD 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL +H  FS+GVN+   ++ +   + LR +ERG G T ACG+ ACA+        K
Sbjct: 175 EIGALLTRHERFSKGVNVGFMQIINPGHIKLRVYERGAGETLACGTGACAAAAIGQLQDK 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
            +R V V + GG L I+W      ++MTG A+  ++G++ +
Sbjct: 235 LSRQVRVDLPGGTLHIDWDGEGKPLWMTGPAEHVYDGQIQL 275


>gi|23502782|ref|NP_698909.1| diaminopimelate epimerase [Brucella suis 1330]
 gi|62290786|ref|YP_222579.1| diaminopimelate epimerase [Brucella abortus bv. 1 str. 9-941]
 gi|82700697|ref|YP_415271.1| diaminopimelate epimerase [Brucella melitensis biovar Abortus 2308]
 gi|148560145|ref|YP_001259754.1| diaminopimelate epimerase [Brucella ovis ATCC 25840]
 gi|163843955|ref|YP_001628359.1| diaminopimelate epimerase [Brucella suis ATCC 23445]
 gi|189025000|ref|YP_001935768.1| diaminopimelate epimerase [Brucella abortus S19]
 gi|225853370|ref|YP_002733603.1| diaminopimelate epimerase [Brucella melitensis ATCC 23457]
 gi|237816293|ref|ZP_04595286.1| diaminopimelate epimerase [Brucella abortus str. 2308 A]
 gi|254696186|ref|ZP_05158014.1| diaminopimelate epimerase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704943|ref|ZP_05166771.1| diaminopimelate epimerase [Brucella suis bv. 3 str. 686]
 gi|254731104|ref|ZP_05189682.1| diaminopimelate epimerase [Brucella abortus bv. 4 str. 292]
 gi|256112264|ref|ZP_05453185.1| diaminopimelate epimerase [Brucella melitensis bv. 3 str. Ether]
 gi|256263148|ref|ZP_05465680.1| diaminopimelate epimerase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370334|ref|YP_003107845.1| diaminopimelate epimerase [Brucella microti CCM 4915]
 gi|260546050|ref|ZP_05821790.1| diaminopimelate epimerase [Brucella abortus NCTC 8038]
 gi|260758836|ref|ZP_05871184.1| diaminopimelate epimerase [Brucella abortus bv. 4 str. 292]
 gi|260760560|ref|ZP_05872903.1| diaminopimelate epimerase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261755643|ref|ZP_05999352.1| diaminopimelate epimerase [Brucella suis bv. 3 str. 686]
 gi|265993695|ref|ZP_06106252.1| diaminopimelate epimerase [Brucella melitensis bv. 3 str. Ether]
 gi|29839333|sp|Q8FYF0|DAPF_BRUSU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|75496183|sp|Q57AW6|DAPF_BRUAB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|123546212|sp|Q2YLR4|DAPF_BRUA2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|166224246|sp|A5VSQ7|DAPF_BRUO2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|189082828|sp|B0CIT6|DAPF_BRUSI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|229807487|sp|B2S885|DAPF_BRUA1 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|254767092|sp|C0RFH7|DAPF_BRUMB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|23348803|gb|AAN30824.1| diaminopimelate epimerase [Brucella suis 1330]
 gi|62196918|gb|AAX75218.1| DapF, diaminopimelate epimerase [Brucella abortus bv. 1 str. 9-941]
 gi|82616798|emb|CAJ11888.1| Diaminopimelate epimerase [Brucella melitensis biovar Abortus 2308]
 gi|148371402|gb|ABQ61381.1| diaminopimelate epimerase [Brucella ovis ATCC 25840]
 gi|163674678|gb|ABY38789.1| diaminopimelate epimerase [Brucella suis ATCC 23445]
 gi|189020572|gb|ACD73294.1| Diaminopimelate epimerase [Brucella abortus S19]
 gi|225641735|gb|ACO01649.1| diaminopimelate epimerase [Brucella melitensis ATCC 23457]
 gi|237788360|gb|EEP62575.1| diaminopimelate epimerase [Brucella abortus str. 2308 A]
 gi|256000497|gb|ACU48896.1| diaminopimelate epimerase [Brucella microti CCM 4915]
 gi|260096157|gb|EEW80033.1| diaminopimelate epimerase [Brucella abortus NCTC 8038]
 gi|260669154|gb|EEX56094.1| diaminopimelate epimerase [Brucella abortus bv. 4 str. 292]
 gi|260670992|gb|EEX57813.1| diaminopimelate epimerase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261745396|gb|EEY33322.1| diaminopimelate epimerase [Brucella suis bv. 3 str. 686]
 gi|262764676|gb|EEZ10597.1| diaminopimelate epimerase [Brucella melitensis bv. 3 str. Ether]
 gi|263093051|gb|EEZ17201.1| diaminopimelate epimerase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409933|gb|ADZ66998.1| Diaminopimelate epimerase [Brucella melitensis M28]
 gi|326539646|gb|ADZ87861.1| diaminopimelate epimerase [Brucella melitensis M5-90]
          Length = 303

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 147/285 (51%), Positives = 195/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|256059906|ref|ZP_05450092.1| diaminopimelate epimerase [Brucella neotomae 5K33]
 gi|261323878|ref|ZP_05963075.1| diaminopimelate epimerase [Brucella neotomae 5K33]
 gi|261299858|gb|EEY03355.1| diaminopimelate epimerase [Brucella neotomae 5K33]
          Length = 303

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 146/285 (51%), Positives = 194/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISV MG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVGMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|161619850|ref|YP_001593737.1| diaminopimelate epimerase [Brucella canis ATCC 23365]
 gi|260567581|ref|ZP_05838051.1| diaminopimelate epimerase [Brucella suis bv. 4 str. 40]
 gi|189082827|sp|A9M8R8|DAPF_BRUC2 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|161336661|gb|ABX62966.1| diaminopimelate epimerase [Brucella canis ATCC 23365]
 gi|260157099|gb|EEW92179.1| diaminopimelate epimerase [Brucella suis bv. 4 str. 40]
          Length = 303

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 147/285 (51%), Positives = 195/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|254700573|ref|ZP_05162401.1| diaminopimelate epimerase [Brucella suis bv. 5 str. 513]
 gi|261751081|ref|ZP_05994790.1| diaminopimelate epimerase [Brucella suis bv. 5 str. 513]
 gi|261740834|gb|EEY28760.1| diaminopimelate epimerase [Brucella suis bv. 5 str. 513]
          Length = 303

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 146/285 (51%), Positives = 195/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVD+G P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDIGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|83949967|ref|ZP_00958700.1| diaminopimelate epimerase [Roseovarius nubinhibens ISM]
 gi|83837866|gb|EAP77162.1| diaminopimelate epimerase [Roseovarius nubinhibens ISM]
          Length = 277

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 99/275 (36%), Positives = 135/275 (49%), Gaps = 15/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V D R     IT      ++        DQ+ LI    +   DA +
Sbjct: 9   LPFMKMHGLGNDFVVFDGRARDIAITPALARLVADRHRGIGCDQLALITA--EGPGDAHL 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R L   + R +    T RG L A++   G  SV+MG P 
Sbjct: 67  TFWNADGSMAAACGNATRCIARHLMDDLGRDALHLTTARGDLAARDMGQGVTSVNMGAPQ 126

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA + D ++                P    MGNPH  FFVE D     LA FG
Sbjct: 127 LDWAEIPLAEAMDTLEL----------PIEGGPTATGMGNPHCTFFVE-DAERVALAEFG 175

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP+F E  N+ +A +   + L +R WERGVG T A GS++CA+ VA+     T R
Sbjct: 176 PRYEHHPLFPERTNVQVASLIGPDHLRMRVWERGVGPTLASGSSSCATAVAAARRGLTGR 235

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V++ + GG L I+W ++  V+MTG      +G L
Sbjct: 236 CVTITLDGGTLEIDWREDG-VWMTGRTAHVCDGVL 269


>gi|238923849|ref|YP_002937365.1| diaminopimelate epimerase [Eubacterium rectale ATCC 33656]
 gi|259595055|sp|C4Z900|DAPF_EUBR3 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|238875524|gb|ACR75231.1| diaminopimelate epimerase [Eubacterium rectale ATCC 33656]
          Length = 285

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 136/287 (47%), Gaps = 14/287 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +++     +  +  +I           D ++ I     A  D  +
Sbjct: 1   MKFTKMHGCGNDYVYVNLFEEKLDDPARVSIYVSDRHFGIGSDGLITIGPSDKA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
           RI N DGSE + CGNG+RCV +++               G  +       +EN+   + V
Sbjct: 59  RIYNADGSEAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVEENKVSQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVEDDL 175
           DMGEPIL    IP+ ++      D + +            +   VSMGNPHA+ FV+ D+
Sbjct: 119 DMGEPILTPGDIPVVKADGSAYSDDYRVIDEPISAGNREWHMTCVSMGNPHAVVFVD-DV 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             ++L  +G L   H MF +  N     + S     +R WERG   T ACG+  CA+V+A
Sbjct: 178 AGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWERGSAETWACGTGTCATVMA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIE-WHDNNHVFMTGEAKKEWEGKLDI 281
                KT+  V V + GG L IE   + NHVFMTG A + + G++DI
Sbjct: 238 CILNKKTDNKVLVHLRGGDLTIEYIPETNHVFMTGPATEVFSGEIDI 284


>gi|121533712|ref|ZP_01665539.1| Diaminopimelate epimerase [Thermosinus carboxydivorans Nor1]
 gi|121307703|gb|EAX48618.1| Diaminopimelate epimerase [Thermosinus carboxydivorans Nor1]
          Length = 279

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 86/280 (30%), Positives = 141/280 (50%), Gaps = 13/280 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F K  G GN  ++++       +    A+           D ++++   Q A  D  +
Sbjct: 1   MQFTKWHGQGNDFVIVNGFQEKIEDYAQAAVKICDRHFGIGADGLVIVGPSQVA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDG----SISV 118
           RI N DGSE + CGN  RCV    +      +   T ET+ G +  +   +     ++ V
Sbjct: 59  RIFNSDGSEAEMCGNVTRCVARYVYEYGLTDKTKITLETLAGPIKPELIFENGVLRTVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEP L    IP+    D    +  ++  + +    +   VSMGNPH I FV+ D+   
Sbjct: 119 DMGEPRLKRAQIPMIGEPD---SEAINVPLIVNDKTYDITCVSMGNPHCIIFVD-DVDEI 174

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           +LA+ G L+  HP F    N+   +V +   + +R WERG G+T ACG+ A A++VA+  
Sbjct: 175 NLAAVGPLIENHPTFPRKTNVEFVQVLNDHEMRMRVWERGAGITLACGTGASATLVAAVL 234

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGK 278
             KT R  ++ + GG L++EW ++NHV+M+G A + + G+
Sbjct: 235 NGKTGRVATIHLDGGDLVLEWGNDNHVYMSGPAVEVFRGE 274


>gi|167630192|ref|YP_001680691.1| diaminopimelate epimerase [Heliobacterium modesticaldum Ice1]
 gi|229807510|sp|B0TGR9|DAPF_HELMI RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|167592932|gb|ABZ84680.1| diaminopimelate epimerase [Heliobacterium modesticaldum Ice1]
          Length = 281

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 144/288 (50%), Gaps = 19/288 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH----DNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++F KM G+GN  +V++         ++    A+           D ++L+     A  D
Sbjct: 1   MEFVKMHGLGNDFIVVNAMEPPLLDREDWEEIAVRICDRHYGIGGDGLILLFPSDKA--D 58

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRD-----G 114
              RI+N DGSE + CGNG+RC+ R++  R    ++    ET+ GI+V +   D      
Sbjct: 59  IRWRILNSDGSEPEMCGNGIRCLARYVYERGIVAKRRIEVETLAGIIVPEIITDAAGAVT 118

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            + VDMGEP L    IP+             +G      +     +SMGNPH + +V +D
Sbjct: 119 GVCVDMGEPRLQRHQIPMVGPEGPAVNQELVVGD----AVVRVTALSMGNPHCLIYV-ND 173

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +    + + G  +  HP F    N+   +V + + + +R WERG G T ACG+ ACA+VV
Sbjct: 174 IDEAPVTTLGPKVEVHPAFPAKTNVEFVQVVAPDEVQMRVWERGAGPTLACGTGACATVV 233

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            S     T+R V+V + GG L IEW  +NN V+MTG A + + G+L +
Sbjct: 234 GSVLNGYTDRKVTVHLAGGPLHIEWREENNRVYMTGPAVEVFRGELPL 281


>gi|254470941|ref|ZP_05084344.1| diaminopimelate epimerase [Pseudovibrio sp. JE062]
 gi|211960083|gb|EEA95280.1| diaminopimelate epimerase [Pseudovibrio sp. JE062]
          Length = 291

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 118/288 (40%), Positives = 165/288 (57%), Gaps = 5/288 (1%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V D R     +T   I  +        FDQ++ +     +   AF+RI N 
Sbjct: 1   MNGLGNDFVVFDSREKKIVLTPAQIATIGDREKGIGFDQMITVEPA-SSDAYAFMRIHNR 59

Query: 70  DGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGS-ISVDMGEPILDWK 128
           DGSEV +CGN  RC+ R L       S T +T  G+L+A  +   + +SVDMG P L+W 
Sbjct: 60  DGSEVDACGNATRCIGRLLMGEAGTPSVTIQTNAGLLIAHASDSETLVSVDMGRPRLEWD 119

Query: 129 LIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLA 188
            IPLA  F         IGP++   L +P VV++GNPHAIF+V+ D+  +DL  FG LL 
Sbjct: 120 QIPLAEEFADTRAIELQIGPIDAPVLHSPSVVNVGNPHAIFWVD-DIEAHDLERFGPLLE 178

Query: 189 KHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSV 248
            HPMF E  N+S+A++     + L+ WERGVGLT ACG+AACA+ VA+    +  R  +V
Sbjct: 179 CHPMFPEKANISLAQIIGENEIRLKVWERGVGLTRACGTAACATGVAAARTGRAARKCTV 238

Query: 249 KMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEA 295
            + GG L IEW ++N H+ MTGE   E+EG+L++ T  + K    D A
Sbjct: 239 HLPGGPLGIEWREDNDHIMMTGETAIEFEGELNLDTLAYTKTASGDAA 286


>gi|254694561|ref|ZP_05156389.1| diaminopimelate epimerase [Brucella abortus bv. 3 str. Tulya]
 gi|261214885|ref|ZP_05929166.1| diaminopimelate epimerase [Brucella abortus bv. 3 str. Tulya]
 gi|260916492|gb|EEX83353.1| diaminopimelate epimerase [Brucella abortus bv. 3 str. Tulya]
          Length = 303

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 147/285 (51%), Positives = 195/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLLSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|170724854|ref|YP_001758880.1| diaminopimelate epimerase [Shewanella woodyi ATCC 51908]
 gi|229813248|sp|B1KQD0|DAPF_SHEWM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169810201|gb|ACA84785.1| Diaminopimelate epimerase [Shewanella woodyi ATCC 51908]
          Length = 279

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 91/279 (32%), Positives = 141/279 (50%), Gaps = 6/279 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           M+ FAKM G+GN  +V+D    +   + + I  L+       FDQ++L+    D  +D  
Sbjct: 1   MIHFAKMHGLGNDFMVVDGVTQNVFFSPEQIKRLADRNFGVGFDQLLLVEPPYDPDLDFH 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV+ CGNG RC  RF+ ++    +      T  G +  +  RDG+++V+MG
Sbjct: 61  YRIFNADGGEVEQCGNGARCFARFVRNKGLTNKHKIKVSTSNGKITLRLERDGNVTVNMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P+LD   IP                  + +       +SMGNPH +  VE D+ H ++ 
Sbjct: 121 VPVLDPSKIPFNAK-RVEKTYLLQTSSSHAMETFLCGAISMGNPHCVLEVE-DIEHAEVE 178

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G LL ++  F +GVN+   +V     + LR +ERG   T ACG+ ACA+        K
Sbjct: 179 RIGALLTQNERFPKGVNVGFMQVIDAGHIKLRVYERGAAETLACGTGACAAAAVGQLQGK 238

Query: 242 TNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            N+ V V + GG L I W  + N ++MTG A+  ++G++
Sbjct: 239 LNKMVRVDLPGGTLTINWEGEGNPLWMTGPAEHVYDGQI 277


>gi|17986417|ref|NP_539051.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|256045536|ref|ZP_05448419.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260562846|ref|ZP_05833332.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|265991962|ref|ZP_06104519.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. Rev.1]
 gi|21362470|sp|Q8YJF0|DAPF_BRUME RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|17982011|gb|AAL51315.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|260152862|gb|EEW87954.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. 16M]
 gi|263003028|gb|EEZ15321.1| diaminopimelate epimerase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 303

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 146/285 (51%), Positives = 194/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    + P +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVDPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|153852916|ref|ZP_01994353.1| hypothetical protein DORLON_00335 [Dorea longicatena DSM 13814]
 gi|149754558|gb|EDM64489.1| hypothetical protein DORLON_00335 [Dorea longicatena DSM 13814]
          Length = 282

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 140/284 (49%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++               +S        D +++I+  + A  D  +
Sbjct: 1   MKFTKMQGLGNDYVYVNCFEEKIENPPAVARYVSDRHFGIGSDGLIMINPSEVA--DFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGIL----VAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +      +   + ET+ GI       ++ +   + V
Sbjct: 59  EMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTQISVETLGGIKYLDLTVEDGKVVLVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG+P L   LIP+    +K+  +   +    +        VSMGNPH + +V+ D+ + 
Sbjct: 119 DMGKPELKSDLIPIISENEKVIDEPIEVDGQVYHMTG----VSMGNPHTVIYVD-DVKNL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           DL   G     H  F + +N          ++++R WERG G T ACG+ ACA  VAS  
Sbjct: 174 DLEKIGPKFENHERFPKRINTEFVHCIDRNTVEMRVWERGSGETLACGTGACAVAVASIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            + T+  V+VK+LGG L IEW    NHVFMTG AK  ++G +DI
Sbjct: 234 NNLTDTRVTVKLLGGDLQIEWDQKKNHVFMTGPAKVVFDGVIDI 277


>gi|167761453|ref|ZP_02433580.1| hypothetical protein CLOSCI_03863 [Clostridium scindens ATCC 35704]
 gi|167661119|gb|EDS05249.1| hypothetical protein CLOSCI_03863 [Clostridium scindens ATCC 35704]
          Length = 277

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 89/284 (31%), Positives = 142/284 (50%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  + ++         S+    +S        D +++I+  + A  D  +
Sbjct: 1   MRFTKMHGLGNDYVYVNCFKEKVEHPSEVARFVSDRHFGIGSDGLIMINPSKVA--DFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGIL----VAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +      + S + ET+ GI       K+ +   + V
Sbjct: 59  EMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTSISVETLGGIKYLDLTVKDGKVALVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG+P L  + IP+    +++  +   +G + +        VSMGNPH + +V+ DL   
Sbjct: 119 DMGKPELKPERIPIVSDEERVVNEPIIVGGMEYRMTG----VSMGNPHVVVYVK-DLEGV 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            +   G     H  F + VN    +V   +++++R WERG G T ACG+ ACA  VAS  
Sbjct: 174 KIEHVGPKFENHERFPKRVNTEFTKVLDRKTVEMRVWERGSGETLACGTGACAVAVASIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              T   V+VK+LGG LLIEW  +   V+MTG A   ++G++ I
Sbjct: 234 NGMTEDQVTVKLLGGDLLIEWDQEAGRVYMTGPATVVYDGEIAI 277


>gi|152979621|ref|YP_001345250.1| diaminopimelate epimerase [Actinobacillus succinogenes 130Z]
 gi|171704361|sp|A6VQR8|DAPF_ACTSZ RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|150841344|gb|ABR75315.1| Diaminopimelate epimerase [Actinobacillus succinogenes 130Z]
          Length = 274

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 96/280 (34%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +     + I  L+       FDQ++L+    D  +D   
Sbjct: 1   MHFSKMHGLGNDFVVVDAVTQNVFFPEEVIKKLADRHRGIGFDQLLLVEPPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG I V+MGE
Sbjct: 61  RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTAKGRMVLTVKDDGQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  VE D+   ++A 
Sbjct: 121 PIWEPAKIPFNA-----NKFEKNYILRTDIQTVLCGAVSMGNPHCVIQVE-DIKTANVAQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V     + LR +ERG G T ACGS ACA+          
Sbjct: 175 LGPLLESHERFPERVNAGFMQVIDRHHIKLRVYERGAGETQACGSGACAAAAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           +  V V + GG L+IEW    H ++MTG+A   ++G + +
Sbjct: 235 DSPVQVDLPGGSLIIEWDGEGHPLYMTGDATHIYDGVIKL 274


>gi|169632676|ref|YP_001706412.1| diaminopimelate epimerase [Acinetobacter baumannii SDF]
 gi|229807501|sp|B0VT30|DAPF_ACIBS RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|169151468|emb|CAP00217.1| diaminopimelate epimerase [Acinetobacter baumannii]
          Length = 281

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 137/281 (48%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++        D  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC            + + T +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP      +           N        VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPNEIPFVADEPEALYTLELANDQNISID----VVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F E +N    +V   + + LR +ER VG T ACG+ ACA+ V+      
Sbjct: 177 GIGPQVESHKRFPERINAGFMQVIDDKHVRLRVFERCVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              +V V++ GG L IEW + + V+MTG     ++G+LD++
Sbjct: 237 LANSVEVELAGGKLQIEWQEGDVVWMTGPTTHVYDGRLDLR 277


>gi|150398764|ref|YP_001322531.1| diaminopimelate epimerase [Methanococcus vannielii SB]
 gi|150011467|gb|ABR53919.1| Diaminopimelate epimerase [Methanococcus vannielii SB]
          Length = 292

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 101/284 (35%), Positives = 151/284 (53%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           V F KM G+GN  + I+         ++    +S        D ++LI D + A  D  +
Sbjct: 16  VKFTKMHGLGNDYIYINAVLEDIKNPNEFSKFVSDRHFGIGSDGLVLILDSKIA--DFKM 73

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGS----ISV 118
           R+ N DGSE + CGN +RCV +F+       +K  T ET+ G+ V +   +G     + V
Sbjct: 74  RMFNSDGSEAEMCGNAIRCVGKFVYDNKLTDKKIITIETLAGVKVLEMTVEGEEVVLVKV 133

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEP L+   IP+      +  +       N  F      VSMGNPHA+ ++E D+ ++
Sbjct: 134 DMGEPTLEALKIPVISDKYPVINETIDSNGYNFKF----TCVSMGNPHAVTYIE-DVDNF 188

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           +L   G L   H  F +  N+    V + E+L +R WERG G T ACG+ ACA +V+S  
Sbjct: 189 ELQKIGPLFEAHEKFPKKTNVEFVNVINDETLKMRVWERGAGETLACGTGACAVLVSSVL 248

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              + R  +VK+LGG L++EW + NNHV+MTG A K +EGK+ +
Sbjct: 249 NGLSKRKATVKLLGGDLIVEWSESNNHVYMTGPATKVFEGKIKL 292


>gi|301155563|emb|CBW15031.1| diaminopimelate epimerase [Haemophilus parainfluenzae T3T1]
          Length = 274

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDAVTQNAYFTPETIKRLADRHRGIGFDQLLIVEPPYDPDLDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGKMVLTVKEDGQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  V+ D+   ++A 
Sbjct: 121 PIWEPNKIPFTA-----NKFEKNYILRTDVQTVLCGAVSMGNPHCVVQVD-DIETANVAE 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+          
Sbjct: 175 LGPLLENHERFPERVNAGFMQVVNRNHIKLRVYERGAGETQACGSGACAAAAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V + GG LLIEW    + ++MTG+A   ++G + +
Sbjct: 235 DNKVQVDLPGGSLLIEWEGVGSPLYMTGDATHIYDGNIHL 274


>gi|254713653|ref|ZP_05175464.1| diaminopimelate epimerase [Brucella ceti M644/93/1]
 gi|254715993|ref|ZP_05177804.1| diaminopimelate epimerase [Brucella ceti M13/05/1]
 gi|261217761|ref|ZP_05932042.1| diaminopimelate epimerase [Brucella ceti M13/05/1]
 gi|261321391|ref|ZP_05960588.1| diaminopimelate epimerase [Brucella ceti M644/93/1]
 gi|260922850|gb|EEX89418.1| diaminopimelate epimerase [Brucella ceti M13/05/1]
 gi|261294081|gb|EEX97577.1| diaminopimelate epimerase [Brucella ceti M644/93/1]
          Length = 303

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 146/285 (51%), Positives = 195/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG+P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGKPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|254251136|ref|ZP_04944454.1| Diaminopimelate epimerase [Burkholderia dolosa AUO158]
 gi|124893745|gb|EAY67625.1| Diaminopimelate epimerase [Burkholderia dolosa AUO158]
          Length = 311

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 86/288 (29%), Positives = 135/288 (46%), Gaps = 11/288 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G GN  +V+D        +T   + AL+        DQ++++        D  
Sbjct: 25  LSFTKMHGAGNDFVVLDGYSRALPPLTQAQVRALANRHFGIGADQLLVVEKPTVDGADFK 84

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI NCDG EV+ CGNG RC V+F++ R    ++S   + ++G++      +G + VDMG
Sbjct: 85  YRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMG 144

Query: 122 EPILDWKLIPLARSF--DKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
            P+ +   +    S    + +              R    VSMGNPHA+  V+ D   Y 
Sbjct: 145 APVFEPAQVLFDASGLEGRPEGRDTLWPLDVGGATRWISTVSMGNPHAVQVVD-DAEAYP 203

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G L+ +H  F + VN    ++ S   + LR +ER  G T ACG+ ACA+V A    
Sbjct: 204 VLDEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYERSAGETLACGTGACAAVAAGIRR 263

Query: 240 HKTNRAVSVKMLGGGLLIEW----HDNNHVFMTGEAKKEWEGKLDIKT 283
              +  V+V   GG L I W     +   + M G A+  +EG++D+  
Sbjct: 264 GLLDSPVAVHTHGGTLTIGWDGARDETAALTMAGPAETVFEGEIDLNA 311


>gi|71892348|ref|YP_278082.1| diaminopimelate epimerase [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|123640808|sp|Q491Z7|DAPF_BLOPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|71796454|gb|AAZ41205.1| diaminopimelate epimerase [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
          Length = 274

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 148/280 (52%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  ++ID    + ++TS+ I  LS       FDQ++++    D ++D   
Sbjct: 1   MRFTKMNGLGNDFVIIDAVTQNIHLTSENIRYLSDRFYGVGFDQLLIVEPPYDPAIDFHC 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG+EV  CGNGMRCV +F+  +    +++    T    ++     D  +SV+MG 
Sbjct: 61  RIYNSDGTEVNQCGNGMRCVAQFVCLKKLTNKRNIHISTRANHIILSIMNDNRVSVNMGA 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI D KLIP   S  +     F         +    VVSMGNPH I  VE  + +  + S
Sbjct: 121 PIFDPKLIPFYISQYQKTYILFLP-----TQIILCGVVSMGNPHCIILVEK-IENIQVTS 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+ L  H  F E VN+S  ++ +  ++ LR +ERGVG T ACG+AACA+V         
Sbjct: 175 LGSALEDHHCFPERVNVSFMQIINCNNIRLRVYERGVGETQACGTAACAAVAVGIQQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
             +V+V + GG + + W   +N ++MTG     ++G +++
Sbjct: 235 YESVNVNLPGGTISVNWKGASNALYMTGSTSYVYDGYINL 274


>gi|306842919|ref|ZP_07475555.1| diaminopimelate epimerase [Brucella sp. BO2]
 gi|306286942|gb|EFM58462.1| diaminopimelate epimerase [Brucella sp. BO2]
          Length = 303

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 147/285 (51%), Positives = 194/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+IT  A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITPAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P   W
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFGW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GPV+   L +P + SMGNPHAIF+V+ D++ Y+L  FG LL
Sbjct: 127 RDIPLAQAVADTRKIELQVGPVDAPVLHSPSIASMGNPHAIFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTMDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|189426372|ref|YP_001953549.1| diaminopimelate epimerase [Geobacter lovleyi SZ]
 gi|189422631|gb|ACD97029.1| Diaminopimelate epimerase [Geobacter lovleyi SZ]
          Length = 278

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 84/284 (29%), Positives = 132/284 (46%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +D      +  ++ AI   + +     D ++LI     A  D  +
Sbjct: 1   MKFTKMHGAGNDYVYVDCFKETVDNPAETAIKVSNRNFGIGSDGLILIMPTDKA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAK-------ENRDGSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +         EN+   + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVTKTEITAETGAGILTLQLFPNAENKVERVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L  + IP+                           VSMGNPH I +V+ D+ +
Sbjct: 119 VNMGPPRLSREEIPMNG---TPAAQVVAEELTVLDKTFKITCVSMGNPHCIIYVD-DVDN 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +A++G L+  H +F    N+   ++ S   +  RTWERG G T ACG+ A A  VA  
Sbjct: 175 FPVATYGPLIENHQLFPRRTNVEFIQIISRTEVKQRTWERGAGETLACGTGASAVCVAGV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             + T+R +   + GG L +EW +N  VFMTG A + + G++ +
Sbjct: 235 LNNLTDRKILNHLAGGDLELEWVENGPVFMTGPATEVFSGEIAL 278


>gi|163743348|ref|ZP_02150728.1| diaminopimelate epimerase [Phaeobacter gallaeciensis 2.10]
 gi|161383342|gb|EDQ07731.1| diaminopimelate epimerase [Phaeobacter gallaeciensis 2.10]
          Length = 281

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 95/275 (34%), Positives = 138/275 (50%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R    +IT      ++       FDQ+ +I        DA +
Sbjct: 12  LPFMKMHGLGNDFVVVDARDQTWDITPAMAAGIAHRQMGIGFDQLTVI---TKGDEDAHL 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R L     +      T RG+L+A++  +G  SV+MG+P 
Sbjct: 69  TFYNADGSTSAACGNATRCIARHLLDESGKTHLRLTTDRGLLLAEDAGNGLTSVNMGQPQ 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   D ++                P    MGNPH  FFV  +     LA FG
Sbjct: 129 LDWQDIPLAEDVDTLEL----------PIEGAPTATGMGNPHCTFFVG-NAEVIPLAEFG 177

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A V + + L +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 178 ARYEHHPLYPERTNVQVAHVVAPDHLRMRVWERGVGITLASGSSSCATAVAAARRGLTGR 237

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG L I+W ++  V+MTG      +G  
Sbjct: 238 KVQIDLDGGTLWIDWREDG-VWMTGPTMHVADGYF 271


>gi|306843382|ref|ZP_07475983.1| diaminopimelate epimerase [Brucella sp. BO1]
 gi|306276073|gb|EFM57773.1| diaminopimelate epimerase [Brucella sp. BO1]
          Length = 300

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 147/285 (51%), Positives = 195/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+IT  A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITPAAAICLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GPV+   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 RDIPLAQAVADTRKIELQVGPVDAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTMDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|291527977|emb|CBK93563.1| diaminopimelate epimerase [Eubacterium rectale M104/1]
          Length = 285

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 135/287 (47%), Gaps = 14/287 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +++     +  +  +I           D ++ I        D  +
Sbjct: 1   MKFTKMHGCGNDYVYVNLFEEKLDDPARVSIYVSDRHFGIGSDGLITIGPS--GKADFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
           RI N DGSE + CGNG+RCV +++               G  +       +EN+   + V
Sbjct: 59  RIYNADGSEAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVEENKVSQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVEDDL 175
           DMGEPIL    IP+ ++      D + +            +   VSMGNPHA+ FV+ D+
Sbjct: 119 DMGEPILTPGDIPVVKADGSAYSDDYRVIDEPISAGNREWHMTCVSMGNPHAVVFVD-DV 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             ++L  +G L   H MF +  N     + S     +R WERG   T ACG+  CA+V+A
Sbjct: 178 AGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWERGSAETWACGTGTCATVMA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIE-WHDNNHVFMTGEAKKEWEGKLDI 281
                KT+  V V + GG L IE   + NHVFMTG A + + G++DI
Sbjct: 238 CILNKKTDNKVLVHLRGGDLTIEYIPETNHVFMTGPATEVFSGEIDI 284


>gi|258515536|ref|YP_003191758.1| diaminopimelate epimerase [Desulfotomaculum acetoxidans DSM 771]
 gi|257779241|gb|ACV63135.1| diaminopimelate epimerase [Desulfotomaculum acetoxidans DSM 771]
          Length = 277

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 146/284 (51%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC--HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F K+ G+GN  +V++        ++   A            D ++L+H     + D  
Sbjct: 1   MHFVKVHGLGNDFVVVNAMTETLPADLPELARRVCHRYFGIGADGLVLLHKSD--AADLR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDG----SIS 117
           ++IIN DGSE + CGN +RCV ++   +   K      ET+ GI + +   +      I 
Sbjct: 59  MQIINSDGSEPEMCGNAIRCVAKYAYEQNLVKKTKIQVETLAGIKIPELILENGAVKFIR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL+   IP+  S  ++  +  ++G            VSMGNPH + FV++ +  
Sbjct: 119 VDMGEPILERAEIPMRGSAGRVLAEDLNVGN----ETFKVTAVSMGNPHCLIFVDEAVS- 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + ++  G  +  H +F    N+    V +   + ++ WERG G T ACG+ ACA+VVA+ 
Sbjct: 174 FPVSLIGPQIEIHEVFPRKTNVEFIEVLNRREVKMKVWERGAGETMACGTGACATVVAAV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               T R V+V + GG LLIEW DNNHV+MTG A++ + G   +
Sbjct: 234 LNGLTERQVTVHLTGGDLLIEWADNNHVYMTGPAEEVFAGSYKL 277


>gi|254707543|ref|ZP_05169371.1| diaminopimelate epimerase [Brucella pinnipedialis M163/99/10]
 gi|261315024|ref|ZP_05954221.1| diaminopimelate epimerase [Brucella pinnipedialis M163/99/10]
 gi|261304050|gb|EEY07547.1| diaminopimelate epimerase [Brucella pinnipedialis M163/99/10]
          Length = 303

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 145/285 (50%), Positives = 193/285 (67%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DL TWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLHTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|87199423|ref|YP_496680.1| diaminopimelate epimerase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135104|gb|ABD25846.1| diaminopimelate epimerase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 275

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 105/276 (38%), Positives = 145/276 (52%), Gaps = 16/276 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R    ++T+    AL+        DQ++++     A  D  +
Sbjct: 9   IPFRKMHGLGNDFVVIDAREAAVSMTAARAAALADRRTGIGCDQLIVLEPSDVA--DVRM 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           RI N DGSEV++CGN  R V   L          F    G L+  E R   +SVDMG P 
Sbjct: 67  RIFNNDGSEVEACGNASRAVGLLLGG------TQFIETLGGLIRSEARPDGVSVDMGAPR 120

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L W  IP++ + D ++       PV    L NP  V++GNPH IFFV+ D    DLA  G
Sbjct: 121 LRWDEIPVSYAMDTLE------MPVGWEDLENPVGVNVGNPHVIFFVD-DADAVDLARLG 173

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+   P+F E +N+++A V   + L LR WERG GLT ACG+ ACA+ VA+     T R
Sbjct: 174 PLIENDPLFPERINVNVASVVGPDHLKLRVWERGAGLTRACGTGACATAVAAIRRKLTGR 233

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            V + + GG L I W +   + MTG A   +EG  +
Sbjct: 234 KVRIDLPGGPLTITWPEGGTIDMTGPATLSFEGAFE 269


>gi|86608845|ref|YP_477607.1| diaminopimelate epimerase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123502491|sp|Q2JLR0|DAPF_SYNJB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|86557387|gb|ABD02344.1| diaminopimelate epimerase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 285

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 94/286 (32%), Positives = 138/286 (48%), Gaps = 15/286 (5%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDASV 60
           +  + F K +G+GN  +++D R      ++ +   AL         D ++ +   Q+   
Sbjct: 2   TPRLSFHKYQGLGNDFILVDNRWQSQPCLSPEEAVALCNRRFGVGADGVIFLLPGQE-GA 60

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS---FTFETIRGILVAKENRDGSIS 117
           D  +R+ N DGSE + CGNG+RC+ RFL           +   T+ G +V +   DG ++
Sbjct: 61  DFSMRLFNSDGSEAEMCGNGIRCLARFLQDLGIPGRDGAYQIHTLAGRIVPQVRADGLVT 120

Query: 118 VDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           VDMG P L  K IP  L    +K+ R    +             VSMGNPH + F+E++ 
Sbjct: 121 VDMGIPRLLAKQIPTTLVEPDEKVIRQPLAVAGRE----WRVTAVSMGNPHCVVFLEEEG 176

Query: 176 YHYDL--ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
              +L  A+ G L   HP F E  N    +V S   L LR WERG G T ACG+ ACA +
Sbjct: 177 SLEELDLAAVGPLFEHHPAFPERTNTEFVQVLSPTRLRLRVWERGAGATLACGTGACAVL 236

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGK 278
           VA+    +     +V++ GG L I W     HV+MTG A   + G 
Sbjct: 237 VAAVLEERAESQATVELPGGNLEIRWDPSTQHVWMTGPALHVFSGT 282


>gi|254708920|ref|ZP_05170731.1| diaminopimelate epimerase [Brucella pinnipedialis B2/94]
 gi|256030446|ref|ZP_05444060.1| diaminopimelate epimerase [Brucella pinnipedialis M292/94/1]
 gi|256158430|ref|ZP_05456328.1| diaminopimelate epimerase [Brucella ceti M490/95/1]
 gi|256253850|ref|ZP_05459386.1| diaminopimelate epimerase [Brucella ceti B1/94]
 gi|261220988|ref|ZP_05935269.1| diaminopimelate epimerase [Brucella ceti B1/94]
 gi|261316419|ref|ZP_05955616.1| diaminopimelate epimerase [Brucella pinnipedialis B2/94]
 gi|265987490|ref|ZP_06100047.1| diaminopimelate epimerase [Brucella pinnipedialis M292/94/1]
 gi|265996947|ref|ZP_06109504.1| diaminopimelate epimerase [Brucella ceti M490/95/1]
 gi|260919572|gb|EEX86225.1| diaminopimelate epimerase [Brucella ceti B1/94]
 gi|261295642|gb|EEX99138.1| diaminopimelate epimerase [Brucella pinnipedialis B2/94]
 gi|262551415|gb|EEZ07405.1| diaminopimelate epimerase [Brucella ceti M490/95/1]
 gi|264659687|gb|EEZ29948.1| diaminopimelate epimerase [Brucella pinnipedialis M292/94/1]
          Length = 303

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 146/285 (51%), Positives = 194/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|325662281|ref|ZP_08150896.1| diaminopimelate epimerase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471533|gb|EGC74754.1| diaminopimelate epimerase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 279

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 136/282 (48%), Gaps = 15/282 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++         +  A            D ++LI   +    D  +
Sbjct: 3   MKFTKMQGLGNDYVYVNCLKEKVESPSEMARRVSDRHFGVGSDGLILICPSE--CADFEM 60

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILV----AKENRDGSISV 118
           ++ N DGS  + CGNG+RCV    +      +   + ET+ GI       +E +   + V
Sbjct: 61  KMYNADGSRGEMCGNGIRCVGKYVYDYGLTDQTEISVETLGGIKHLSLTVEEGKVALVKV 120

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PI   + IP+    D        +    +        VSMGNPHA+ +++ D+ + 
Sbjct: 121 DMGSPIFVPEQIPVKVEGDHAVNVPISVDGDEYRM----TCVSMGNPHAVVYLD-DIQNM 175

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++   G     HP F   VN   ARV   E++++R WERG G T ACG+ ACA  VAS  
Sbjct: 176 EIEKIGPKFEHHPCFPNRVNTEFARVLDRETVEMRVWERGSGETLACGTGACAVAVASMV 235

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              T   V+V++LGG L IEW  + N V+MTG A   ++G+L
Sbjct: 236 NGLTEDCVTVQLLGGNLKIEWDREKNVVYMTGPATVVFDGEL 277


>gi|295696033|ref|YP_003589271.1| diaminopimelate epimerase [Bacillus tusciae DSM 2912]
 gi|295411635|gb|ADG06127.1| diaminopimelate epimerase [Bacillus tusciae DSM 2912]
          Length = 277

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 139/280 (49%), Gaps = 13/280 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           + F KM G+GN  +V++      +  + A N          D ++ +     A  D  +R
Sbjct: 1   MKFVKMHGLGNDFIVVEGHALPLDPGALARNWCDRHFGIGADGLVFVLPSDRA--DVQMR 58

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDG----SISVD 119
           I N DGSE + CGN +RCV ++   R   +R+    ET+ G+       +G     ++VD
Sbjct: 59  IFNADGSEAEQCGNAVRCVGKYAFERGLVRRRDLVVETLAGVQRIVLGGNGSRVEEVTVD 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MGEPIL+   IP+A +       R         F      VSMGNPHA+ FV+ D+   D
Sbjct: 119 MGEPILEPGRIPVALAEGGTPSGRVEAAGREWAF----TAVSMGNPHAVIFVD-DVEGTD 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G+ +  + +F   VN+          + +R WERG G T ACG+ ACA+VVA    
Sbjct: 174 VRGVGSEVETNRLFPNRVNVEFVETLDPGEIRVRVWERGCGETLACGTGACAAVVAGALE 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            ++ R V V + GG L IEW ++  V+MTG A + + G++
Sbjct: 234 GRSGRKVRVHLPGGTLKIEWAEDGRVYMTGPAVEVFRGEI 273


>gi|253997559|ref|YP_003049623.1| diaminopimelate epimerase [Methylotenera mobilis JLW8]
 gi|253984238|gb|ACT49096.1| diaminopimelate epimerase [Methylotenera mobilis JLW8]
          Length = 279

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 96/285 (33%), Positives = 140/285 (49%), Gaps = 12/285 (4%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVD 61
           ++M+ F KM+G GN  +VID      ++++D I  L+       FDQ++L+     A  D
Sbjct: 2   ANMIKFTKMQGAGNDFMVIDGVTQSISLSADTIKKLANRQFGIGFDQLLLVESS--AVAD 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              RI N DGSEV  CGNG RC VRF+  +   +++  + ET  GI+  K    G ++V+
Sbjct: 60  FKYRIFNADGSEVSQCGNGARCFVRFVVDQGLTQQREISVETASGIITPKLEDHGLVTVN 119

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG P      IP   +         H     +    N   VSMGNPHA+  V+ D+    
Sbjct: 120 MGAPRFKPDAIPFVAA-----SAATHYALEVNDQAFNIAAVSMGNPHAVLTVD-DVETAP 173

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G+ +  HP F E VN+   +V     + LR +ERG G T ACG+ ACA+ V     
Sbjct: 174 VLPLGSAIEHHPRFPERVNVGFMQVMDEHHIKLRVFERGSGETLACGTGACAAAVTGIQS 233

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKT 283
            + +  V V   GG L I W   +  V MTG A   + G++D+  
Sbjct: 234 GRLSSPVKVSARGGELSIAWQGADTPVMMTGPAVTVFTGEIDLDA 278


>gi|225575185|ref|ZP_03783795.1| hypothetical protein RUMHYD_03274 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037593|gb|EEG47839.1| hypothetical protein RUMHYD_03274 [Blautia hydrogenotrophica DSM
           10507]
          Length = 278

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 87/285 (30%), Positives = 137/285 (48%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM GIGN  + ++      +  S+    +S        D ++LI   Q A  D  +
Sbjct: 1   MKFTKMHGIGNDYVYVNCFQEKVDNPSEVAKFVSDRHFGVGSDGLILIKPSQIA--DCEM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
            + N DGS+   CGNG+RCV +++         T        +       +  +   + V
Sbjct: 59  DMYNLDGSQGAMCGNGIRCVAKYVYDYGIVPKTTLRIATKSGIKELNLTVENGKVSLVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG PIL+   IP+     +       +    + F      VSMGNPHA+ +++ D+ + 
Sbjct: 119 NMGSPILEASKIPVVSDQSQAVNQPIKVNGHTYYFTG----VSMGNPHAVVYLD-DVDNL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G    KHP+F + VN    +V   ++L +R WERG G T ACG+ ACA  V+S  
Sbjct: 174 DIEKIGPAFEKHPVFPDRVNTEFVKVIDRKTLKMRVWERGSGETLACGTGACAVAVSSIL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
            + T   V+VK+LGG L I W    N V+MTG A   ++G++ + 
Sbjct: 234 NNLTGEEVTVKLLGGDLKIHWDRLENLVYMTGPATTVFDGEITLP 278


>gi|302771151|ref|XP_002968994.1| hypothetical protein SELMODRAFT_170203 [Selaginella moellendorffii]
 gi|300163499|gb|EFJ30110.1| hypothetical protein SELMODRAFT_170203 [Selaginella moellendorffii]
          Length = 298

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 96/289 (33%), Positives = 132/289 (45%), Gaps = 14/289 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDA 58
           +Q   +DF K  G+GN  +++D R          DAI     +     D ++        
Sbjct: 7   LQQRTLDFVKYHGLGNDFILVDNRDSSAPKVSPEDAIKLCDRNFGVGGDGVIFAMPGTQ- 65

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMK---RKSFTFETIRGILVAKENRDGS 115
             D  +RI N DGSE + CGNG+RC+ RF+         +S+   T+ G ++ +   DG 
Sbjct: 66  GCDYSMRIYNSDGSEPEMCGNGIRCMARFVARLEGTLEPRSYKIHTLAGTIIPELRPDGQ 125

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD- 174
           ++VDMG P L    +P     +  D        V          VSMGNPH + F E D 
Sbjct: 126 VAVDMGPPTLKGAEVPTKLPVN-ADGAVVKQPLVVDGKTWLVTCVSMGNPHCVTFGEQDA 184

Query: 175 -----LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAA 229
                +    L   G L   H +F    N    +V S   L +R WERG G T ACG+ A
Sbjct: 185 KGDLEVNKLPLEKIGPLFEHHEVFPARTNTEFIQVLSDTHLRMRVWERGAGPTLACGTGA 244

Query: 230 CASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
           CA VVA+    +  R   V + GG L IEW + NNHV+MTG AK  + G
Sbjct: 245 CAVVVAAVLEGRAQRRCVVDLPGGPLEIEWKEANNHVYMTGPAKPVFSG 293


>gi|254512917|ref|ZP_05124983.1| diaminopimelate epimerase [Rhodobacteraceae bacterium KLH11]
 gi|221532916|gb|EEE35911.1| diaminopimelate epimerase [Rhodobacteraceae bacterium KLH11]
          Length = 280

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 95/278 (34%), Positives = 139/278 (50%), Gaps = 16/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +++D R     IT      +        FDQ+ +I        DA +
Sbjct: 12  LPFMKMHGLGNDFVIVDARAHTVPITPAMARGIGHRRFGVGFDQLAVIE---QGQADAHL 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ RFL +   + +    T RG L+A++  DG  S++MG+P 
Sbjct: 69  VFYNADGSTSAACGNATRCIARFLMNESGKSNLALTTERGTLLARDAGDGLTSINMGQPQ 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   + ++                P    MGNPH  FFV  D     L  FG
Sbjct: 129 LDWQEIPLAEDVNTLEL----------PIEGGPTATGMGNPHCTFFV-VDAEAIPLEEFG 177

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A+VT  + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 178 ARYEYHPLYPERTNVQVAQVTGPDRIRMRVWERGVGITLASGSSSCATAVAAARRGLTGR 237

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
            V + + GG + I+W D+  V+MTG       G L  +
Sbjct: 238 EVQIDLDGGTIWIDWRDDG-VWMTGPTCHVLSGTLTPE 274


>gi|254418556|ref|ZP_05032280.1| diaminopimelate epimerase [Brevundimonas sp. BAL3]
 gi|196184733|gb|EDX79709.1| diaminopimelate epimerase [Brevundimonas sp. BAL3]
          Length = 279

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 109/275 (39%), Positives = 146/275 (53%), Gaps = 6/275 (2%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFIR 65
            F KM G GN  +VID        T D I AL+       FDQ++ I   + A  DAF+R
Sbjct: 7   PFIKMNGAGNDFIVIDALETPFRPTEDQIRALADRASGEGFDQLIAIEPSETA--DAFMR 64

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
           + N DGS V++CGN +RCV   L         T +T  G   A    D  ++VDMG P L
Sbjct: 65  VWNADGSMVETCGNALRCVGWLLMEAGGGDRVTIDTAAGPTTATRAGDRRVTVDMGRPRL 124

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           DW  +PLA   D    +   +GP++   L  P  VSMGNPH +FF +       +   G+
Sbjct: 125 DWTQVPLAEEMDTRGIE-LQVGPIDAPLLHTPGAVSMGNPHVVFFTDRQ-DDGFVTGSGS 182

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
           L+  HP+F EGVN+  A V   + + LR WERG GLT ACG+ ACA+ VA+     T+R 
Sbjct: 183 LVEHHPLFPEGVNVGFAHVLDRDHIRLRVWERGAGLTKACGTGACAAQVAAARRGLTDRK 242

Query: 246 VSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            +V + GG L+I+W    +HV MTG  + E  G L
Sbjct: 243 ATVVVDGGELVIDWDPATDHVLMTGPVEIERTGAL 277


>gi|56695194|ref|YP_165542.1| diaminopimelate epimerase [Ruegeria pomeroyi DSS-3]
 gi|56676931|gb|AAV93597.1| diaminopimelate epimerase [Ruegeria pomeroyi DSS-3]
          Length = 269

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 94/278 (33%), Positives = 134/278 (48%), Gaps = 16/278 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     IT      ++       FDQ+ +I        DA +
Sbjct: 1   MTFMKMHGLGNDFVVVDARLHPVRITGALARGIAHRHLGVGFDQLAVIEP---GKGDAHL 57

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R L     +      T RG L A++  DG  SV+MG P 
Sbjct: 58  VFYNADGSTSAACGNATRCIARHLMDETGKTELHLTTDRGDLYARDAGDGLTSVNMGAPQ 117

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           L W  IPLA   D ++                P    MGNPH  FFV  D     LA FG
Sbjct: 118 LLWHEIPLAEEMDTLEL----------PIEGGPTATGMGNPHCTFFV-ADAEAIPLAEFG 166

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ +  NL +A++T  + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 167 ARYEHHPLYPQRTNLQVAQITGPDRIRMRVWERGVGITLASGSSSCATAVAAARRGLTGR 226

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
            V + + GG + I+W ++  V+MTG     +   L  +
Sbjct: 227 KVQIDLDGGTIWIDWREDG-VWMTGPTMHVFSATLTPE 263


>gi|45655988|ref|YP_000074.1| diaminopimelate epimerase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|59797812|sp|Q72W63|DAPF_LEPIC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|45599221|gb|AAS68711.1| diaminopimelate epimerase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 281

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 145/284 (51%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KMEGIGN  + ID       +T + I  +S        D ++ I + +    D  +
Sbjct: 4   LKFTKMEGIGNDYVYIDSTRNDIRLTPEQIQKISDRNFGIGSDGVIFIRNSKQG--DFMM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE-----NRDGSIS 117
            + N DGS  + CGNG+RCV +++        K+   ET  GIL         N+   +S
Sbjct: 62  DMYNSDGSSSEMCGNGIRCVAKYIYDHGLTSSKNPKIETGAGILEVDLKIGSGNKVDLVS 121

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG+P+L    IP+    ++   D+       +L       VSMGNPH + FV+ D   
Sbjct: 122 VDMGKPVLVPSQIPVVWKNEETIIDQPLEIGDKNL---KFTAVSMGNPHCVIFVD-DSDE 177

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G L+ +H +F + VN+    +   + L  RTWERG G T ACG+ ACA +VA  
Sbjct: 178 FPVRGIGPLIERHSIFPKRVNVEFVTIRGKDHLYQRTWERGAGETLACGTGACAVMVAGN 237

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              ++ + V + + GG L I+W ++ ++ MTG A++ + G+++I
Sbjct: 238 LTGRSGKDVQIDLRGGTLRIQWQESGNILMTGPAREIFSGEIEI 281


>gi|303242859|ref|ZP_07329323.1| diaminopimelate epimerase [Acetivibrio cellulolyticus CD2]
 gi|302589605|gb|EFL59389.1| diaminopimelate epimerase [Acetivibrio cellulolyticus CD2]
          Length = 277

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 94/284 (33%), Positives = 150/284 (52%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++      +  S+    +S        D ++LI   Q    D  +
Sbjct: 1   MKFTKMQGLGNDYIYVNCFTEKVDNPSEVAKFVSDRHFGVGSDGLVLIMPSQM--CDFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRG----ILVAKENRDGSISV 118
           R+ N DGSE + CGN +RCV +F+      +      ET+ G     +  K+N+   + V
Sbjct: 59  RMFNSDGSEAEMCGNAIRCVGKFVYDNGMTQKSVIKVETLAGIKVLDMTVKDNKVELVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL+   IP+  + +        I             VSMGNPHA+ +V+ D+  +
Sbjct: 119 DMGEPILEPAKIPVDSNKELFVSQPVVIDGREFK----VTCVSMGNPHAVTYVD-DVEKF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G  +  + ++ + +N    +V   ++L +R WERG G T ACG+ ACA +V+S  
Sbjct: 174 PLEVVGPKMENNSLYPKRINAEFVQVIDRDTLKMRVWERGAGETLACGTGACAVLVSSVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              +NR V VK+LGG L+IEW++ +NHV+MTG A K ++G +D+
Sbjct: 234 NDISNRKVVVKLLGGDLIIEWNEKDNHVYMTGPATKVFDGDIDV 277


>gi|254488147|ref|ZP_05101352.1| diaminopimelate epimerase [Roseobacter sp. GAI101]
 gi|214045016|gb|EEB85654.1| diaminopimelate epimerase [Roseobacter sp. GAI101]
          Length = 298

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 101/301 (33%), Positives = 148/301 (49%), Gaps = 30/301 (9%)

Query: 1   MQSSM---VDFAKMEGIGNKILVIDMRGC--------HDNITSDAINAL-STDDNTHFDQ 48
           M S M   + F KM G+GN  +V+D R             +T     A+        FDQ
Sbjct: 14  MYSDMTNGLPFMKMHGLGNDFVVLDARDSALLGKDGDSLQVTPALAQAVGHRHFGVGFDQ 73

Query: 49  IMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVA 108
           + +I      + DA +   N DGS   +CGN  RC+ RFL     + S    T RG L A
Sbjct: 74  LAVI---TTGTGDAHLTFYNSDGSLSAACGNATRCIARFLMDETGKSSLHLTTDRGDLAA 130

Query: 109 KENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAI 168
           ++  D   +V+MG+P LDW+ IPLA + + ++                P    MGNPH  
Sbjct: 131 QDMGDRLTAVNMGQPQLDWQDIPLAHAMETLEL----------PIDGAPTATGMGNPHCT 180

Query: 169 FFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSA 228
           FFV  DL   DL  FG  +  HP++ E  N+ IA++   + + +R WERGVG+T A GS+
Sbjct: 181 FFV-ADLAAIDLERFGPGIEHHPLYPERTNVQIAQIIGPDHIRMRVWERGVGITLASGSS 239

Query: 229 ACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
           +CA+ VA+     T R V + + GG L I+W ++  V+MTG     + G L   T +++ 
Sbjct: 240 SCATAVAAARRGLTGRKVRIDLDGGTLHIDWREDG-VWMTGPTAHVFSGTL---TREFLD 295

Query: 289 K 289
            
Sbjct: 296 G 296


>gi|110635719|ref|YP_675927.1| diaminopimelate epimerase [Mesorhizobium sp. BNC1]
 gi|122965555|sp|Q11CW3|DAPF_MESSB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|110286703|gb|ABG64762.1| diaminopimelate epimerase [Chelativorans sp. BNC1]
          Length = 293

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 149/288 (51%), Positives = 190/288 (65%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
            FAKM G+GN I+V DMRG  D +  +A   L++D  THFDQIM IHD +    + +I I
Sbjct: 6   QFAKMNGLGNAIIVADMRGRADRVRPEAAQRLASDPATHFDQIMAIHDPRLEGTENYIEI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILD 126
           IN DGS  Q+CGNGMRCVV+ L +   R SFTFETI G+L A+E+ +G ISVDMG+P   
Sbjct: 66  INSDGSVAQACGNGMRCVVQRLAAETGRPSFTFETIAGVLSAEEHANGLISVDMGKPRFG 125

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F    +    +GP++   L +P V SMGNPHAIF+VEDD Y YDL  FG +
Sbjct: 126 WQDIPLAEEFHDTRKIELQVGPIDKPVLHSPSVASMGNPHAIFWVEDDPYSYDLERFGPM 185

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N++IARV S E L +RTWERG GLT ACGSAACA+ V++    +T R V
Sbjct: 186 LENHPIFPERANITIARVDSPEELTMRTWERGAGLTLACGSAACAAAVSAARTGRTGRGV 245

Query: 247 SVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDE 294
            V + GG L I W D++HV MTG A+ E+ G+ D  TG W ++ E   
Sbjct: 246 KVNLPGGSLEILWRDDDHVIMTGPAEWEFSGRFDPATGAWERETEGAA 293


>gi|225175575|ref|ZP_03729569.1| Diaminopimelate epimerase [Dethiobacter alkaliphilus AHT 1]
 gi|225168904|gb|EEG77704.1| Diaminopimelate epimerase [Dethiobacter alkaliphilus AHT 1]
          Length = 290

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 132/281 (46%), Gaps = 14/281 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  ++++         ++    L         D + L+   + A+    +
Sbjct: 1   MRFTKMHGLGNDFVIVEDFDLGLTNYAELAMGLCNRNFGIGADGLALLQPSEQAA--FRV 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
           RI N DGSE + CGN +RC  ++L  +               +        +    S+ V
Sbjct: 59  RIFNPDGSEAELCGNLLRCAGKYLYEKGHTGETVIPVEMYDKIKVLRLAVTDGVVQSVEV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMGEPIL+  L+P+A    +   +         +       VSMGNPH + FV+ +    
Sbjct: 119 DMGEPILESDLVPVAGKRRQAVNEEVTASGEKFVM----TAVSMGNPHCVIFVD-ETAAV 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L ++G  L  HP F +  N+    V S +    R WERG G T ACGS ACA +VA   
Sbjct: 174 PLETWGPALEAHPDFPKKTNVEFVEVRSRDEAAFRVWERGAGATLACGSGACAVLVAGVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
             K NR  ++ + GG L IEW D+NHV+MTG A + + G+L
Sbjct: 234 SDKLNRKATLHLPGGSLEIEWRDDNHVYMTGPAAEVFRGEL 274


>gi|254476623|ref|ZP_05090009.1| diaminopimelate epimerase [Ruegeria sp. R11]
 gi|214030866|gb|EEB71701.1| diaminopimelate epimerase [Ruegeria sp. R11]
          Length = 281

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 96/285 (33%), Positives = 142/285 (49%), Gaps = 19/285 (6%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R    +IT      ++       FDQ+ +I        DA +
Sbjct: 12  LPFMKMHGLGNDFVVVDARDQSWDITPAMAEGIAHRQMGIGFDQLTVI---TKGDEDAHL 68

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R+L            T RG+L+A++  +G  SV+MG+P 
Sbjct: 69  TFYNADGSTSGACGNATRCIARYLLDESGTSKLRLTTDRGLLLAEDVGNGLTSVNMGQPQ 128

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW+ IPLA   D ++                P    MGNPH  FFVE +     LA FG
Sbjct: 129 LDWQDIPLAEDVDTLEL----------PIEGTPTATGMGNPHCTFFVE-NAEVIPLAEFG 177

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A V   + L +R WERGVG+T A GS++CA+ VA+     T  
Sbjct: 178 ARYEHHPLYPERTNVQVAHVVGPDHLRMRVWERGVGITLASGSSSCATAVAAVRRGLTGH 237

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKK 289
            V + + GG L ++W D+  V+MTG      +G     T ++++ 
Sbjct: 238 KVRIDLDGGTLWVDWRDDG-VWMTGPTMHVADGHF---TREFLES 278


>gi|89067276|ref|ZP_01154789.1| diaminopimelate epimerase [Oceanicola granulosus HTCC2516]
 gi|89046845|gb|EAR52899.1| diaminopimelate epimerase [Oceanicola granulosus HTCC2516]
          Length = 284

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 100/275 (36%), Positives = 141/275 (51%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R  H    +D I A++       +DQ+ +I     A  DA +
Sbjct: 23  LPFMKMHGLGNDFVVLDRRDGHAMPGADVIRAMADRRRGVGYDQLAVIEGA--ADADARL 80

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS+  +CGN  RC+   L     R      T RG L A+ +  G ++V+MG P 
Sbjct: 81  TFWNSDGSQSAACGNATRCIAAHLMDETGRDDLALVTARGRLAAERHG-GVVAVNMGAPS 139

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
            DW+ +PLAR  D +                +P    MGNPH  FFVE D    DLASFG
Sbjct: 140 TDWQGVPLAREVDTLHL----------PIPGDPVATGMGNPHCTFFVE-DAESVDLASFG 188

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP+F E  N+ +A+V     + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 189 AEHEHHPLFPERTNVQLAQVLDRARIRMRVWERGVGITEASGSSSCATAVAAARRGLTER 248

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V+V + GG L I+W D+  V+M G     ++G  
Sbjct: 249 RVTVLLDGGELEIDWRDDG-VWMAGPTAHVFDGVW 282


>gi|331083711|ref|ZP_08332822.1| diaminopimelate epimerase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330403922|gb|EGG83474.1| diaminopimelate epimerase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 277

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 141/284 (49%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  + ++    H    S+    +S        D ++LI   + A  D  +
Sbjct: 1   MKFTKMQGIGNDYVYVNCFQEHIENPSEVSRRISDRHFGIGSDGLILIKSSEKA--DFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
            + N DGS+   CGNGMRCV +++                  +       +  +   + V
Sbjct: 59  EMYNADGSQGAMCGNGMRCVGKYVYDYGLTDKTRISVDTKSGIKYLDLTVENKKVKQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MGEP+L+ K IP+    +K+    F++G   +        VSMGNPHA+ +V+ ++ + 
Sbjct: 119 NMGEPVLETKAIPMIYEGEKVISQPFNVGQDIYEI----TAVSMGNPHAVVYVD-NVKNL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G    KH  F E VN    RV    ++++R WERG G T ACG+ ACA  VAS  
Sbjct: 174 PLEEIGPKFEKHTAFPESVNTEFVRVIDRRTVEMRVWERGSGETLACGTGACAVAVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              T   V+V++LGG L I W    N V+MTG A+  +EG+++I
Sbjct: 234 NGYTEDEVTVRLLGGDLKIFWDRAENFVYMTGPAEVVFEGEIEI 277


>gi|291524551|emb|CBK90138.1| diaminopimelate epimerase [Eubacterium rectale DSM 17629]
          Length = 285

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 135/287 (47%), Gaps = 14/287 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + +++      +    +I           D ++ I     A  D  +
Sbjct: 1   MKFTKMHGCGNDYVYVNLFEEKLGDPARVSIYVSDRHFGIGSDGLITIGPSDKA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
           RI N DGSE + CGNG+RCV +++               G  +       +EN+   + V
Sbjct: 59  RIYNADGSEAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVEENKVSQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVN---HLFLRNPFVVSMGNPHAIFFVEDDL 175
           DMGEPIL    IP+ ++      D + +            +   VSMGNPHA+ FV+ D+
Sbjct: 119 DMGEPILTPGDIPVVKADGSAYGDDYRVIDEPISAGNREWHMTCVSMGNPHAVVFVD-DV 177

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
             ++L  +G L   H MF +  N     + S     +R WERG   T ACG+  CA+V+A
Sbjct: 178 AGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWERGSAETWACGTGTCATVMA 237

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKLDI 281
                KT+  V V + GG L IE+    NHVFMTG A + + G++DI
Sbjct: 238 CILNKKTDNKVLVHLRGGDLTIEYIPKTNHVFMTGPATEVFSGEIDI 284


>gi|251797753|ref|YP_003012484.1| diaminopimelate epimerase [Paenibacillus sp. JDR-2]
 gi|247545379|gb|ACT02398.1| diaminopimelate epimerase [Paenibacillus sp. JDR-2]
          Length = 278

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 98/285 (34%), Positives = 146/285 (51%), Gaps = 16/285 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGC-HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M+ F KM G+GN  +VI        N+   A N  +       D ++ I   + A  D  
Sbjct: 1   MMKFTKMHGLGNDFIVIAGEQQLPGNVAELAKNQCNRFFGIGADGLVYILPSEVA--DFR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG-----ILVAKENRDGSI 116
           +RIIN DGSE + CGN +RC  +++       ++  T ET+        L   + +   +
Sbjct: 59  MRIINSDGSEAEQCGNAIRCAAKYIYDNGLTDKEELTIETLGAGAQTVQLEVADGKVQQV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMG PIL+   +P     D++      +      F      VSMGNPH + +V+ D  
Sbjct: 119 RVDMGAPILNGLQVPTTVDEDRVIEHPIEVDGREFRF----TAVSMGNPHCVIYVD-DAA 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
           ++DLA++G  L  HPMF   +N+    V S E  ++R WERG G T ACG+ ACA+VV+S
Sbjct: 174 NFDLATWGPKLETHPMFPRKINVEFVTVISREHAEMRVWERGAGPTLACGTGACATVVSS 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
                T+R   V + GG L IEW++ +NHV+MTG A + + G+  
Sbjct: 234 VLNGLTDRTAVVTLKGGDLTIEWNEADNHVYMTGPAAEVYRGEWK 278


>gi|255262180|ref|ZP_05341522.1| diaminopimelate epimerase [Thalassiobium sp. R2A62]
 gi|255104515|gb|EET47189.1| diaminopimelate epimerase [Thalassiobium sp. R2A62]
          Length = 271

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 90/277 (32%), Positives = 140/277 (50%), Gaps = 15/277 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D RG    + S    A+        FDQ+ ++        D  +
Sbjct: 9   LPFMKMHGLGNDFVVVDERGITPRVDSTIAKAIGDRHRGVGFDQLAVL--SNTDDADVQL 66

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+   L  +   ++ T +T RG+L A  +  G  SV+M  P+
Sbjct: 67  TFYNADGSTAGACGNATRCIANHLLEQTSTRAMTLQTERGLLSAMSDVAGVTSVNMLHPL 126

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  +PLA + D +                 P    MGNPH  FFV+ D+    L +FG
Sbjct: 127 LDWAYVPLAENVDTLAL----------PIDGGPTATGMGNPHCTFFVD-DVEAVALETFG 175

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +  HP+F E  N+ +A++   + + +R WERGVG+T + GS++CA+ VA+     T  
Sbjct: 176 ARMEHHPLFPERTNVQVAQIIGPDHIRMRVWERGVGITLSSGSSSCATAVAAARRGLTGC 235

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           +V + + GG L I+W D+  V+MTG     ++G   +
Sbjct: 236 SVQIDLDGGTLHIDWRDDG-VWMTGPTAHVFDGVWHL 271


>gi|260587431|ref|ZP_05853344.1| diaminopimelate epimerase [Blautia hansenii DSM 20583]
 gi|260542298|gb|EEX22867.1| diaminopimelate epimerase [Blautia hansenii DSM 20583]
          Length = 277

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 140/284 (49%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  + ++    H    S+    +S        D ++LI   + A  D  +
Sbjct: 1   MKFTKMQGIGNDYVYVNCFQEHIENPSEVSRRISDRHFGIGSDGLILIKSSEKA--DFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
            + N DGS+   CGNGMRCV +++                  +       +  +   + V
Sbjct: 59  EMYNADGSQGAMCGNGMRCVGKYVYDYGLTDKTRISVDTKSGIKYLDLTVENKKVKQVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MGEP+L+ K IP+    +K+    F++G   +        VSMGNPHA+ +V+ ++   
Sbjct: 119 NMGEPVLETKAIPMIYDGEKVISQPFNVGQDIYEI----TAVSMGNPHAVVYVD-NVKSL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G    KH  F E VN    RV    ++++R WERG G T ACG+ ACA  VAS  
Sbjct: 174 PLEEIGPKFEKHTAFPESVNTEFVRVIDRRTVEMRVWERGSGETLACGTGACAVAVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              T   V+V++LGG L I W    N V+MTG A+  +EG+++I
Sbjct: 234 NGYTEDEVTVRLLGGDLKIFWDRAENFVYMTGPAEVVFEGEIEI 277


>gi|325579220|ref|ZP_08149176.1| diaminopimelate epimerase [Haemophilus parainfluenzae ATCC 33392]
 gi|325159455|gb|EGC71589.1| diaminopimelate epimerase [Haemophilus parainfluenzae ATCC 33392]
          Length = 285

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 139/280 (49%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 12  MQFSKMHGLGNDFVVVDAVTQNAYFTPETIKRLADRHRGIGFDQLLIVEPPYDPDLDFHY 71

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K     T +G +V     DG I V+MGE
Sbjct: 72  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGKMVLTVKEDGQIRVNMGE 131

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP        ++   +      +       VSMGNPH +  V+ ++   ++A 
Sbjct: 132 PIWEPNKIPFTA-----NKFEKNYILRTDVQTVLCGAVSMGNPHCVVQVD-NIETANVAE 185

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    +V +   + LR +ERG G T ACGS ACA+          
Sbjct: 186 LGPLLENHERFPERVNAGFMQVVNRNHIKLRVYERGAGETQACGSGACAAAAVGIMQGLL 245

Query: 243 NRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           +  V V + GG LLIEW    + ++MTG+A   ++G + +
Sbjct: 246 DNKVQVDLPGGSLLIEWEGVGSPLYMTGDATHIYDGNIHL 285


>gi|53804981|ref|YP_113353.1| diaminopimelate epimerase [Methylococcus capsulatus str. Bath]
 gi|53758742|gb|AAU93033.1| diaminopimelate epimerase [Methylococcus capsulatus str. Bath]
          Length = 275

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 93/279 (33%), Positives = 129/279 (46%), Gaps = 10/279 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           M+ F KM+G+GN  +VID      N+   A+  L+        DQI+L+       VD  
Sbjct: 1   MLRFTKMQGLGNDFVVIDAIHQTVNLDEAALRRLADRHYGIGCDQILLVEPPASDEVDFR 60

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DG EV  CGNG RC  RF+  +  + R     ET  G +V      G + V+MG
Sbjct: 61  YRIFNADGGEVSQCGNGARCFARFVREKGLIDRDEIRVETAAGRMVLWLEAGGEVRVEMG 120

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      +PL       DR+R                VS+GNPHA+  V  D+    +A
Sbjct: 121 VPRHAPAEVPLLA-----DRERSVYTVNVEGVDWQFGAVSVGNPHAVITV-ADVDEAPVA 174

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G +L +H +F E  N+   +V  L    LR +ERG G T ACGS ACA+ V       
Sbjct: 175 RVGTVLERHELFPERANIGFMQVLDLHHARLRVYERGTGETLACGSGACAAAVVGILQGT 234

Query: 242 TNRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
               V + + GG L I W      V+++G A   +EG++
Sbjct: 235 LESPVRIDLPGGTLRIGWQGRGTPVYLSGPAVTVFEGRM 273


>gi|210617578|ref|ZP_03291634.1| hypothetical protein CLONEX_03858 [Clostridium nexile DSM 1787]
 gi|210149243|gb|EEA80252.1| hypothetical protein CLONEX_03858 [Clostridium nexile DSM 1787]
          Length = 289

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 83/284 (29%), Positives = 142/284 (50%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++          +    +S        D +++I+    A  D  +
Sbjct: 13  MKFTKMQGLGNDYVYVNCFKETIENPPEMAKKVSNRNFGIGSDGLIMINPSDVA--DFEM 70

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGIL----VAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +     +++  + ET+ GI       ++ +   + V
Sbjct: 71  EMYNADGSRSEMCGNGIRCVGKYVYDYGLTEKEHISVETLAGIKYLDLTVEDGKVKLVKV 130

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG P L  + IP+    +++  +  ++    +        VSMGNPHA+ +VE D+   
Sbjct: 131 DMGSPELVPENIPIVADGNRVIDEPINVNGTEYRMTG----VSMGNPHAVVYVE-DVKGL 185

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+ + G     H  F   VN    +V    ++++R WERG G T ACG+ ACA  VA   
Sbjct: 186 DIETIGPAFENHERFPNRVNTEFVKVLDRNTVEMRVWERGSGETMACGTGACAVAVACIL 245

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              T   V+VK+LGG L IEW  + + ++MTG A+  ++G++++
Sbjct: 246 NGFTEDKVTVKLLGGDLQIEWDKEADKIYMTGPAEVSFDGEINL 289


>gi|212702610|ref|ZP_03310738.1| hypothetical protein DESPIG_00637 [Desulfovibrio piger ATCC 29098]
 gi|212674051|gb|EEB34534.1| hypothetical protein DESPIG_00637 [Desulfovibrio piger ATCC 29098]
          Length = 306

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 91/300 (30%), Positives = 126/300 (42%), Gaps = 18/300 (6%)

Query: 2   QSSM--VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-----DDNTHFDQIMLIHD 54
           +++M  + F KMEG GN  + +D       +    I  L+            D ++LI  
Sbjct: 5   RTTMRKIAFTKMEGCGNDYVYLDGVSEDLRLAEGDIPVLARAVSDRHYGVGSDGLVLILP 64

Query: 55  FQDAS-VDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKE- 110
                  D  +R+ N DGSE + CGN  RCV RF              ET+ GI + +  
Sbjct: 65  PTSPDSADLRMRMFNADGSEAEMCGNASRCVGRFAWEHALTDRPVIRLETLAGIKLLQRV 124

Query: 111 ----NRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGP-VNHLFLRNPFVVSMGNP 165
                    + VDMG P L  + IP+               P            VSMGNP
Sbjct: 125 DDAGGCPSRVCVDMGTPELARQRIPVCPDTASDPESPCIGQPIRVLDREWTMTCVSMGNP 184

Query: 166 HAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAAC 225
           HA+ FV+ D+   DL   G     HP F    N    ++     + +R WERG G T AC
Sbjct: 185 HAVVFVD-DVDSLDLPVVGPAFEHHPWFPSRTNTEFVQLIDAGHVRMRVWERGAGETLAC 243

Query: 226 GSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIKTG 284
           G+ ACA  VA      T R V+V++ GG L I W +   H+ MTG A+  + G+     G
Sbjct: 244 GTGACAVAVACHLTGHTGREVAVQLRGGTLDIRWDERTGHILMTGPARTVFSGEYSPAQG 303


>gi|20807956|ref|NP_623127.1| diaminopimelate epimerase [Thermoanaerobacter tengcongensis MB4]
 gi|22256735|sp|Q8R9S4|DAPF_THETN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|20516527|gb|AAM24731.1| Diaminopimelate epimerase [Thermoanaerobacter tengcongensis MB4]
          Length = 274

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 88/282 (31%), Positives = 143/282 (50%), Gaps = 14/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           + F KM G+GN  +VI+      + +  A+           D ++++     A  D  +R
Sbjct: 1   MRFTKMHGLGNDFIVIEAVEG-VDYSELAVKLCDRHFGIGADGLLVVEPSHIA--DIKMR 57

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKE----NRDGSISVD 119
           I N DGSE + CGNG RC  +++  +    ++  T ET+ G+++ +      +  S+ V 
Sbjct: 58  IFNADGSEAEMCGNGSRCFAKYVYEKGIVSKQKMTVETLAGVIMPELFVENGKIKSVKVY 117

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MG PI +   IP+     K   +   I    +        V +G PH I FV        
Sbjct: 118 MGSPIFESSKIPVKSEKQKFIDEPVKIDGKTYRLSS----VRVGVPHTILFVS-SFEESF 172

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +   G  + K  +F EG N+   +V   E++ +RTWERGVGLT ACGS A AS V S  L
Sbjct: 173 MKELGPKIEKSSLFPEGTNVDFVKVEDEENISVRTWERGVGLTLACGSGASASAVVSSLL 232

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
            +T R+V+V    G LL+EW ++N ++++GE ++ + G+++I
Sbjct: 233 GRTRRSVNVHFKAGVLLVEWKEDNSIYLSGEVEEVFRGEIEI 274


>gi|99082649|ref|YP_614803.1| diaminopimelate epimerase [Ruegeria sp. TM1040]
 gi|99038929|gb|ABF65541.1| diaminopimelate epimerase [Ruegeria sp. TM1040]
          Length = 275

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 98/277 (35%), Positives = 132/277 (47%), Gaps = 14/277 (5%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQ-DASVDA 62
           M+ F KM G+GN  +VID R     IT      ++       FDQ+ +I         DA
Sbjct: 1   MLPFMKMHGLGNDFVVIDARESDIEITPAMAKGIAHRQMGLGFDQLAVIATADASTEADA 60

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
            +   N DGS   +CGN  RC+ R+L  +  + S    T RG+L+A +  +G  SV+MG 
Sbjct: 61  HLVFYNADGSTSGACGNATRCIARYLMDQSNKPSLRLTTDRGVLIATDAGEGLTSVNMGA 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L W  IP              +  +       P    MGNPH  FFVE D     LA 
Sbjct: 121 PQLSWDEIP----------LAEELETLELPIEGAPSATGMGNPHCTFFVE-DAEVIPLAE 169

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           FG     HP++ E  N+ IA V     L +R WERGVG+T A GS++CA+ VA+     T
Sbjct: 170 FGPRYEHHPLYPERTNVQIAHVVGPNHLRMRVWERGVGITLASGSSSCATAVAAARKGLT 229

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            R V + + GG L I+W D+  V+MTG       G  
Sbjct: 230 GRKVQIDLDGGTLWIDWRDDG-VWMTGPTMHVANGSF 265


>gi|294668983|ref|ZP_06734069.1| diaminopimelate epimerase [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291308975|gb|EFE50218.1| diaminopimelate epimerase [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 282

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 94/279 (33%), Positives = 133/279 (47%), Gaps = 7/279 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      +  S  I A +       FDQ++L+        D   
Sbjct: 4   LKFTKMHGLGNDFIVIDGISSPFDPASAPIAAWADRHTGIGFDQLLLVERPTSEQADFRY 63

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  +    ++    ET RGI+V K    G ++V+MG+
Sbjct: 64  RIFNADGGEVEQCGNGARCFARFVADKGLSGKQEIRVETARGIIVPKLAEHGLVTVNMGQ 123

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP     +    +                 V+MGNPHA+  VE +     +A 
Sbjct: 124 PRFRPSEIPF-LPLENTSGETLQYDVRLDGGNVTVGCVNMGNPHAVLTVE-NTESAAVAE 181

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  HP F E VN+   ++ +   + LR +ERGVG T ACG+ ACA+ V        
Sbjct: 182 LGAQIEPHPQFPEKVNVGFMQILNRRHIKLRVFERGVGETRACGTGACAAAVYGVRAGWL 241

Query: 243 NR--AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           +    + V + GG LLI W     VFMTG A+  +EG+L
Sbjct: 242 DEGEDIRVSLPGGDLLIAWQSGGDVFMTGPAETVFEGEL 280


>gi|313891958|ref|ZP_07825559.1| diaminopimelate epimerase [Dialister microaerophilus UPII 345-E]
 gi|313119601|gb|EFR42792.1| diaminopimelate epimerase [Dialister microaerophilus UPII 345-E]
          Length = 286

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 88/282 (31%), Positives = 144/282 (51%), Gaps = 9/282 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F+K +  GN  ++ +        +S+ +  L         D ++ +    DA  D  +
Sbjct: 1   MYFSKWQACGNDFIIFNSFKNKFIFSSEFVKKLCNRNFGIGADGVIYVLPSLDA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSE + CGNG+RC  +F      + + SF+ ET  GIL  +  ++G++ VDMG 
Sbjct: 59  RIFNSDGSEAEMCGNGIRCFAKFVVNQKLINKSSFSVETGAGILFPEILKNGNVCVDMGI 118

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L+   IP+     K+  D        +   R    VSMGNPH + F +  +   ++ +
Sbjct: 119 PNLNSDDIPVKGFSKKVIIDELLNISHENKAYR-INCVSMGNPHCVIFTDK-IDGINIEA 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G+++  H  F +  N+   +  S   L ++ WERG G+T ACG+ +CA+VVA+   +  
Sbjct: 177 DGSIIENHKQFPKKTNVEFVQKISDSILRMKVWERGAGITLACGTGSCAAVVAAILNNLV 236

Query: 243 NRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
           N    V + GG L I W  +  NHVFMTG A+K ++G +++ 
Sbjct: 237 NNKADVILDGGKLNIFWDKDKTNHVFMTGPAEKVFDGNIEVD 278


>gi|329120939|ref|ZP_08249570.1| diaminopimelate epimerase [Dialister micraerophilus DSM 19965]
 gi|327471101|gb|EGF16555.1| diaminopimelate epimerase [Dialister micraerophilus DSM 19965]
          Length = 290

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 89/283 (31%), Positives = 145/283 (51%), Gaps = 9/283 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAF 63
           ++ F+K +  GN  ++ +        +S+ +  L         D I+ +    DA  D  
Sbjct: 4   LMYFSKWQACGNDFIIFNSFKNKFIFSSEFVKKLCNRNFGIGADGIIYVLPSLDA--DFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSISVDMG 121
           +RI N DGSE + CGNG+RC  +F      + + SF+ ET  GIL  +  ++G++ VDMG
Sbjct: 62  MRIFNSDGSEAEMCGNGIRCFAKFVVNQKLINKSSFSVETGAGILFPEILKNGNVCVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L+   IP+     K+  D        +   R    VSMGNPH + F +  +   ++ 
Sbjct: 122 IPNLNSDDIPVKGFSKKVVIDELLNISHENTAYR-INCVSMGNPHCVIFTDK-IDSINIE 179

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G+++  H  F +  N+   +  S   L ++ WERG G+T ACG+ +CA+VVA+   + 
Sbjct: 180 ADGSIIENHKQFPKKTNVEFVQKISDSILRMKVWERGAGITLACGTGSCAAVVAATLNNL 239

Query: 242 TNRAVSVKMLGGGLLIEWHDN--NHVFMTGEAKKEWEGKLDIK 282
            N    V + GG L I W  +  NHVFMTG A+K ++G +++ 
Sbjct: 240 VNNKADVILDGGKLNIFWDKDKTNHVFMTGPAEKVFDGNIEVD 282


>gi|331086087|ref|ZP_08335170.1| diaminopimelate epimerase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330407010|gb|EGG86515.1| diaminopimelate epimerase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 277

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 87/282 (30%), Positives = 135/282 (47%), Gaps = 15/282 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++         +  A            D ++LI   +    D  +
Sbjct: 1   MKFTKMQGLGNDYVYVNCLKEKVESPSEMARRVSDRHFGVGSDGLILICPSE--CADFEM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGILV----AKENRDGSISV 118
           ++ N DGS  + CGNG+RCV    +      +   + ET+ GI       +E +   + V
Sbjct: 59  KMYNADGSRGEMCGNGIRCVGKYVYDYGLTDQTEISVETLGGIKHLSLTVEEGKVALVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PI   + IP+    D        +    +        +SMGNPHA+ +++ D+ + 
Sbjct: 119 DMGSPIFVPEQIPVKVEGDHAVNVPISVDGDEYRM----TCISMGNPHAVVYLD-DIQNM 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           ++   G     HP F   VN   A V   E++++R WERG G T ACG+ ACA  VAS  
Sbjct: 174 EIEKIGPKFEHHPCFPNRVNTEFACVLDRETVEMRVWERGSGETLACGTGACAVAVASMV 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
              T   V+V++LGG L IEW  + N V+MTG A   ++G+L
Sbjct: 234 NGLTKDCVTVQLLGGNLKIEWDREKNVVYMTGPATVVFDGEL 275


>gi|167747179|ref|ZP_02419306.1| hypothetical protein ANACAC_01893 [Anaerostipes caccae DSM 14662]
 gi|167654139|gb|EDR98268.1| hypothetical protein ANACAC_01893 [Anaerostipes caccae DSM 14662]
          Length = 285

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 86/288 (29%), Positives = 135/288 (46%), Gaps = 14/288 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASV 60
           +S  + F KM G GN  + ++         ++    +S        D ++ IH    A  
Sbjct: 4   RSDSMKFTKMHGCGNDYVYVNCFEETIENPNETAKFVSDRHFGIGSDGMICIHPSDKA-- 61

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDG 114
           D  + + N DG+E   CGNG+RC+ +++         T        +       ++ +  
Sbjct: 62  DFRMAMYNSDGTEGAMCGNGVRCIAKYVYDYGLTDKTTITIETKGGIKELDLTVEDGKVT 121

Query: 115 SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD 174
            ++VDM  P+L+   IP+    +K   D+  I             VSMGNPH + FV+  
Sbjct: 122 WVNVDMEAPVLEADKIPVIYDEEKKVIDKPVIVD---GREYRITCVSMGNPHGVVFVD-S 177

Query: 175 LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVV 234
           +   D+   G +   HPMF + VN    +V    ++ +R WERG G T ACG+ ACAS  
Sbjct: 178 VDDLDIEKLGPMFEHHPMFPDRVNTEFIQVVDDHTIRMRVWERGAGETLACGTGACASAY 237

Query: 235 ASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           AS    KT   V V +LGG L IE+ +  H +FM G A K ++G++D+
Sbjct: 238 ASYLNQKTGNKVLVHLLGGDLQIEYDEEKHTIFMKGPATKVFDGEIDL 285


>gi|87124461|ref|ZP_01080310.1| diaminopimelate epimerase [Synechococcus sp. RS9917]
 gi|86168033|gb|EAQ69291.1| diaminopimelate epimerase [Synechococcus sp. RS9917]
          Length = 360

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 83/285 (29%), Positives = 125/285 (43%), Gaps = 14/285 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHD-----NITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  ++++ R               +  L         D +++      A
Sbjct: 1   MLQFSKYQGLGNDFILLEGRSGQLSAAICEPDPAWVRRLCDRRFGIGADGLIVALPPAAA 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKR---KSFTFETIRGILVAKENRDGS 115
             +  +RI N DGSE + CGNG+RC+ RFL         +++  ET  G+++     DG 
Sbjct: 61  G-ELRMRIFNADGSEAEMCGNGIRCLARFLADSDGDASGRTWRIETAAGLIIPTLLADGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P L  + +P A             G V     R     +      +    DDL
Sbjct: 120 IQVDMGRPFLQPEQVPTALPVGAAG---LPQGEVELDGRRLALAAAGMGNPHVVVTVDDL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                  +G  L   P+F    N+   +V S   L +R WERG G T ACG+ ACA++VA
Sbjct: 177 DQIPFERWGAALEVDPLFPAKTNVHFLQVLSPSRLQIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +  L        V + GG L I W D +  + MTG A+  ++G L
Sbjct: 237 AHLLGLAEATAEVLLPGGPLTISWPDRSGSILMTGPAEAVFDGVL 281


>gi|322417972|ref|YP_004197195.1| diaminopimelate epimerase [Geobacter sp. M18]
 gi|320124359|gb|ADW11919.1| diaminopimelate epimerase [Geobacter sp. M18]
          Length = 276

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 76/282 (26%), Positives = 128/282 (45%), Gaps = 14/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  + ++       +    AI   + +     D ++LI   + A  D  +
Sbjct: 1   MKFTKMQGAGNDYVYVNCFEETVQDPAKVAIKVSNRNFGIGSDGLILIMPSEVA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD-------GSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +               + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVAGKEITAETGAGILTLQLFTGQDSKVEKVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L  K IP+  + D+   +       +     +    SMGNPH + FV+ D+  
Sbjct: 119 VNMGPPRLTRKEIPMLGNPDEKVINEPLNILHS---TFHITCASMGNPHCVIFVD-DVDK 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G ++  H MF    N+   +V S   +  RTWERG G T ACG+ + A   A  
Sbjct: 175 FPVEKYGPVIENHEMFPRRTNVEFVQVISRSEVRQRTWERGAGETLACGTGSSAVTAACV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
               T + +   + GG L +EW ++ +++MTG A + + G++
Sbjct: 235 LNGLTGKKILNHLSGGDLEMEWSEDGNIYMTGPAVEVFSGEI 276


>gi|166030591|ref|ZP_02233420.1| hypothetical protein DORFOR_00254 [Dorea formicigenerans ATCC
           27755]
 gi|166029593|gb|EDR48350.1| hypothetical protein DORFOR_00254 [Dorea formicigenerans ATCC
           27755]
          Length = 288

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 88/285 (30%), Positives = 146/285 (51%), Gaps = 12/285 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  + ++      +   +    +S        D +++I+  + A  D  +
Sbjct: 7   MKFTKMQGLGNDYVYVNCFKEKIDNPPEVAKIVSNRHFGIGSDGLIMINPSKVA--DFEM 64

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRGIL----VAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +      +   + ET+ GI       K+ +   + V
Sbjct: 65  EMYNADGSRGEMCGNGIRCVAKYVYDYGLTDKTHISVETLGGIKYLDLTVKDGKVALVRV 124

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVN-HLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           DMGEP LD + IP+       + DR     +       +   VSMGNPH + +++ ++  
Sbjct: 125 DMGEPELDPEKIPIIMKGYSDETDRVLNAQIKVDGKEYHMTGVSMGNPHDVVYID-NVQG 183

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+   G     H  F + +N   ARV   +++++R WERG G T ACG+ ACA  VAS 
Sbjct: 184 LDIEKIGPKFENHERFPQRINTEFARVIDRKTVEMRVWERGSGETLACGTGACAVAVASI 243

Query: 238 CLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
               T R V +++LGG L IEW+ ++NHV+MTG A   ++G++++
Sbjct: 244 LNGYTEREVEIRLLGGNLQIEWNEEDNHVYMTGPATVVFDGEIEL 288


>gi|160892976|ref|ZP_02073764.1| hypothetical protein CLOL250_00513 [Clostridium sp. L2-50]
 gi|156865059|gb|EDO58490.1| hypothetical protein CLOL250_00513 [Clostridium sp. L2-50]
          Length = 278

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 146/283 (51%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KMEG+GN  + I+      +N    AI           D ++LI     A  D  +
Sbjct: 1   MKFTKMEGLGNDYVYINCFSEKVENPEKLAIAMSDRHFGVGSDGVILIKPSDKA--DFTM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRG----ILVAKENRDGSISV 118
            + N DGS  + CGNG+RCV    +      + S + ET+ G      V K+ +   ++V
Sbjct: 59  DMYNADGSRSEMCGNGIRCVGKYVYDYGLTDKTSISVETLAGIKYLDFVIKDGKVDMVTV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DMG PIL    +P+    +++  ++  +  V++        VSMGNPHA+ FV+ D  H+
Sbjct: 119 DMGAPILKADQVPVRSDKEQVIDEKITVAGVDYHM----TCVSMGNPHAVMFVD-DTEHF 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
            L   G L   H +F   VN    +V    ++ +R WERG G T ACG+ ACA+ VA   
Sbjct: 174 PLEEAGPLFEHHEVFPNRVNAEFVQVIDRHTVKMRVWERGTGETLACGTGACATAVACVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
             KT+  V+VK+LGG L+I +  +NN V+MTG A+  ++G+ D
Sbjct: 234 NGKTDDEVTVKLLGGDLIIRFDRENNKVYMTGPARVVFDGETD 276


>gi|37520384|ref|NP_923761.1| diaminopimelate epimerase [Gloeobacter violaceus PCC 7421]
 gi|35211377|dbj|BAC88756.1| diaminopimelate epimerase [Gloeobacter violaceus PCC 7421]
          Length = 283

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 92/278 (33%), Positives = 130/278 (46%), Gaps = 10/278 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F K EG+GN  ++ID R   + +    +A            D ++ +    +   D  
Sbjct: 8   LSFVKYEGLGNDFVLIDNRTAAEPVLSAEEAAAVCDRHFGVGADGVIFLL-SAETGADFR 66

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKR---KSFTFETIRGILVAKENRDGSISVDM 120
           +RI N DGSE Q CGNG+RC+  F            +  ET  G+L      DG + VDM
Sbjct: 67  MRIYNNDGSEAQMCGNGIRCLAHFARELGMGGTGSGYRVETGAGLLNIDLLADGRVRVDM 126

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L    IP   +    D+                  V+MGNPHA+ FV+ +L   DL
Sbjct: 127 GPPHLLADEIPTTLA--PADQKAVAASIPVGGVDWRVTCVNMGNPHAVVFVD-ELATVDL 183

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
             FG L  +   F E VN   A V S   L ++ WERG G T ACG+ ACA +VA+    
Sbjct: 184 HRFGPLFERDRHFPERVNTHFAEVISPTHLRVKAWERGAGPTLACGTGACAVLVAAVLNG 243

Query: 241 KTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEG 277
            ++   +V++ GG + I W    NH+ MTG A+K + G
Sbjct: 244 LSHTEATVELPGGPIEIRWDGATNHLLMTGPARKVFSG 281


>gi|149204847|ref|ZP_01881809.1| diaminopimelate epimerase [Roseovarius sp. TM1035]
 gi|149141717|gb|EDM29772.1| diaminopimelate epimerase [Roseovarius sp. TM1035]
          Length = 277

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 99/275 (36%), Positives = 137/275 (49%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D RG    +T   I A++       FDQ+ +I        DA +
Sbjct: 9   LPFFKMHGLGNDFVVLDGRGRDLGLTPALIMAIADRHRGIGFDQLAVI---SQGMGDAHL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R L     +      T RG LVA +   G  SV+MG+P 
Sbjct: 66  TFYNADGSTSAACGNATRCIARHLMDESGKARLELSTARGALVAVDAGGGLTSVNMGQPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA + D ++                P    MGNPH  FFV  D     LA FG
Sbjct: 126 LDWAEIPLAEAMDTLEL----------PIEGGPVATGMGNPHCTFFV-ADAEAVPLAQFG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A V   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 PRYEHHPLYPERTNVQVATVIGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
           AV V + GG + ++W ++  V+MTGE      G  
Sbjct: 235 AVRVDLDGGTIHVDWREDG-VWMTGETAHVASGVF 268


>gi|302854253|ref|XP_002958636.1| hypothetical protein VOLCADRAFT_108222 [Volvox carteri f.
           nagariensis]
 gi|300256025|gb|EFJ40302.1| hypothetical protein VOLCADRAFT_108222 [Volvox carteri f.
           nagariensis]
          Length = 323

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 86/293 (29%), Positives = 137/293 (46%), Gaps = 15/293 (5%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNI-TSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
            +S + F+K +G+GN  ++ID R   + + T +    +         D ++         
Sbjct: 33  SASPLSFSKYQGLGNDFILIDNRHSSNPVVTPEQAVKICDRNFGVGGDGVIFALPP-VGD 91

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRF--LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
            D  +RI N DGSE + CGNG+RC+ +F     +   + +   T+ G++  +   DG + 
Sbjct: 92  TDLTMRIFNSDGSEPEMCGNGIRCLAKFVADVDKAAPRKYKIHTLAGLIQPELLADGQVR 151

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFV------ 171
           VDMGEPIL+   +P   +             +          VSMGNPHA+ +       
Sbjct: 152 VDMGEPILEGAKVPTTLA-PTQGSTVVQQDLIVDGKTYKVSCVSMGNPHAVIYSCDGDTI 210

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
           + D    DLA  G    ++ +F    N     V +   + +  WERG G T ACG+ ACA
Sbjct: 211 KIDDLEKDLAVLGPKFERNAVFPARTNTEFVEVVNRSHVRMVVWERGAGRTLACGTGACA 270

Query: 232 SVVASGCLHKTNRA--VSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            VVA     + +R     V + GG L IEW+ ++NH++MTG A+  + G L +
Sbjct: 271 LVVAGILEGRVDREKTCRVDLPGGPLQIEWNTEDNHIYMTGPAELVFNGALRV 323


>gi|159029708|emb|CAO87786.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 281

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 93/285 (32%), Positives = 145/285 (50%), Gaps = 15/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F K +G+GN  ++ID R   + +     A+           D ++     Q A+ D  
Sbjct: 3   IPFTKYQGLGNDFILIDNRHSPEPLITPEIAVAMCDRHFGIGADGVIFALPGQ-AATDYT 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLT----SRMKRKSFTFETIRGILVAKENRDGSISVD 119
           +RI N DGSE + CGNG+RC+ +F+     +    +++   T+ G ++ +   +  ++VD
Sbjct: 62  MRIFNSDGSEPEMCGNGIRCLAQFIARLEANNTIGRTYRIHTLAGTIIPRLEANEQVTVD 121

Query: 120 MGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           MG P L    IP  L +  +K+      +   + L       VSMGNPH + FV+ DL  
Sbjct: 122 MGPPQLLGSEIPTTLVKGSEKVLAVPLEVEGKDWLI----TCVSMGNPHCVTFVD-DLAS 176

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
             L + G     HP+F +  N+    V   + + +R WERG G+T ACG+ ACA VVA+ 
Sbjct: 177 IPLETIGPKFEHHPVFPQRTNVEFVEVIGPDYMKMRVWERGAGITLACGTGACAVVVAAV 236

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
              K +R  +V++ GG L I W D +N V+MTG AK  +EG   I
Sbjct: 237 STAKCDRHCTVELPGGCLQIHWSDTDNRVYMTGPAKAVFEGIYAI 281


>gi|329926558|ref|ZP_08280971.1| diaminopimelate epimerase [Paenibacillus sp. HGF5]
 gi|328939099|gb|EGG35462.1| diaminopimelate epimerase [Paenibacillus sp. HGF5]
          Length = 286

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 93/286 (32%), Positives = 148/286 (51%), Gaps = 16/286 (5%)

Query: 5   MVDFAKMEGIGNKILVIDM-RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +V+   R    + +  A+   +       D ++ I     A  D  
Sbjct: 8   MMEFTKMHGLGNDFVVVYGERELPSDASELAVKLCNRFFGIGADGLVYILPS--AKADFM 65

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFET-------IRGILVAKENRDGSI 116
           +RI+N DGSE + CGN +RCV +++                     +  L  ++ +  S+
Sbjct: 66  MRIMNSDGSEAEQCGNAIRCVAKYVYDHGHIDREEITIETIGAGVQQVRLTVQDGQVSSV 125

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEP+L+   +P     + +      +      F      VSMGNPH + +V+D + 
Sbjct: 126 RVDMGEPVLNGLSVPTLVDLNPVVNHPVEVEGREFRF----TAVSMGNPHCVIYVDDAVN 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            +DL  +G  L  HP+F   +N+  A V S   +D+R WERG G T ACG+ ACA++V+S
Sbjct: 182 -FDLGVWGPKLEVHPLFPRKINVEFATVNSRGQVDMRVWERGAGPTLACGTGACATLVSS 240

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                T+R+ ++ + GG L IEW + +NHV+MTG A+  ++GKL I
Sbjct: 241 VLNGATDRSATISLKGGDLFIEWDELDNHVYMTGPAEVVYKGKLAI 286


>gi|253575768|ref|ZP_04853103.1| diaminopimelate epimerase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251844811|gb|EES72824.1| diaminopimelate epimerase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 278

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 98/285 (34%), Positives = 152/285 (53%), Gaps = 16/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGC-HDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  LV        DN++  AI           D ++ I     A  D  +
Sbjct: 1   MEFTKMHGLGNDFLVFYGEQQLPDNVSELAIRWCDRYFGVGGDGLVFILPSDKA--DFKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRG-----ILVAKENRDGSIS 117
           RIIN DG+E + CGN +RCV +++     + + S T ET+        L  ++    ++ 
Sbjct: 59  RIINSDGTEAEQCGNAIRCVAKYVYDNRLVDKDSVTIETLGAGVQQVTLQVEDGVVKTVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPILD   IP   + + +             F      VSMGNPH + +V+ D  +
Sbjct: 119 VDMGEPILDGLTIPTTLNQNPVVSQPIETNGQEFKF----TAVSMGNPHCVIYVD-DAPN 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           +D+ ++G  L  HP F   +N+  A VT+ + +++R WERG G T ACG+ ACA++V+S 
Sbjct: 174 FDVTTWGPKLEVHPYFPRKINVEFATVTNRQRVEMRVWERGAGPTLACGTGACATLVSSV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               T+RA  + + GG L IEW + +NHV+MTG A+  ++G ++I
Sbjct: 234 LNGLTDRAAWIGLKGGDLFIEWDERDNHVYMTGPAEAVYKGSVEI 278


>gi|297183608|gb|ADI19735.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 274

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 84/276 (30%), Positives = 140/276 (50%), Gaps = 4/276 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           +   KM+G+GN  ++ID R  +  ++ D I  +   +    DQ+++I   ++  +DA + 
Sbjct: 3   IKAFKMDGLGNDFVIIDQRIENIELSKDQIIKICNRNFIGCDQLIIIK--KNPKLDAELE 60

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             N DGS   +CGNG RCV  FL+    +K  T  T  G+L +       +  ++G P  
Sbjct: 61  FYNSDGSPTGACGNGTRCVADFLSKENNQKEITVWTSSGVLKSNILGSNLVETEIGTPKT 120

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
           +W  IPL+++ D  + +   I   N+        V++GNPH +FFV+ D+ ++DL   G 
Sbjct: 121 NWNEIPLSKNLDTKNLN-IKILSKNNTEHIGGAAVNVGNPHIVFFVK-DIENFDLKKIGP 178

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA 245
            +  H +F E  N+++A+V +   + ++ WERG GLT ACG+AACAS +A        + 
Sbjct: 179 EIENHKLFPEKCNVTLAKVINKNLIKVKVWERGSGLTKACGTAACASAIAGNINGFVEKK 238

Query: 246 VSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
             ++   G L I     N V M G        ++ I
Sbjct: 239 TDIEFKLGKLSIFIDAKNSVHMKGSVSDIKNIEIKI 274


>gi|24212783|ref|NP_710264.1| diaminopimelate epimerase [Leptospira interrogans serovar Lai str.
           56601]
 gi|29839327|sp|Q8F9V5|DAPF_LEPIN RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|24193430|gb|AAN47282.1|AE011200_1 diaminopimelate epimerase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 281

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 145/284 (51%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTD-DNTHFDQIMLIHDFQDASVDAFI 64
           + F KMEGIGN  + ID       +T + I  +S        D ++ I + +    D  +
Sbjct: 4   LKFTKMEGIGNDYVYIDSTRNDIRLTPEQIQKISDRNFGIGSDGVIFIRNSKQG--DFMM 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKE-----NRDGSIS 117
            + N DGS  + CGNG+RCV +++        K+   ET  GIL         N+   +S
Sbjct: 62  DMYNSDGSSSEMCGNGIRCVAKYIYDHGLTSSKNPKIETGAGILEVDLKIGSGNKVDLVS 121

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG+P+L    IP+    ++   D+       +L       VSMGNPH + FV+ D   
Sbjct: 122 VDMGKPVLVPSQIPVVWKNEETIIDQPLEIGDKNL---KFTAVSMGNPHCVIFVD-DSDE 177

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +   G L+ +H +F + VN+    +   + L  RTWERG G T ACG+ ACA +VA  
Sbjct: 178 FPVRGIGPLIERHSIFPKRVNVEFVTIRGKDHLYQRTWERGAGETLACGTGACAVMVAGN 237

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
              ++ + V + + GG L I+W ++ ++ MTG A++ + G+++I
Sbjct: 238 LTRRSGKDVQIDLRGGTLRIQWQESGNILMTGPAREIFSGEIEI 281


>gi|303256277|ref|ZP_07342293.1| diaminopimelate epimerase [Burkholderiales bacterium 1_1_47]
 gi|330998973|ref|ZP_08322698.1| diaminopimelate epimerase [Parasutterella excrementihominis YIT
           11859]
 gi|302861006|gb|EFL84081.1| diaminopimelate epimerase [Burkholderiales bacterium 1_1_47]
 gi|329575715|gb|EGG57241.1| diaminopimelate epimerase [Parasutterella excrementihominis YIT
           11859]
          Length = 284

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 77/283 (27%), Positives = 124/283 (43%), Gaps = 7/283 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      ++T   +  L+        DQI+++   +    D   
Sbjct: 3   IKFTKMHGAGNDFVVLDCTREPFSLTPQQLRFLADRHFGIGADQILVVEPAEAGEADFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTF--ETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+ ++   +      +T++G++  +   DG + V MG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFVKFVYNKGLTEKKRIRAKTMKGVIELELKEDGMVRVSMGT 122

Query: 123 PILDWKLIPLARSFDKMDRDRF--HIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P  +   +P           R            L    V SMGNPH +  V DD+    +
Sbjct: 123 PSFEPSSLPFNPQGLPSREIRGFKQWAVRYKGELVWFSVCSMGNPH-VTIVTDDIESAPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G  +  HP F   VN+   +  +    ++R WERG G T ACG+  CA+   S  L 
Sbjct: 182 KELGPFIENHPAFPRRVNVGFIQPITEHEANVRVWERGAGETLACGTGNCAAAATSIELG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIK 282
             +  +     GG L + W      V + G A   ++ ++++ 
Sbjct: 242 VLSSPILTHNRGGDLRLAWEGEGEDVELFGPAVTVFDSEIEVP 284


>gi|170751705|ref|YP_001757965.1| diaminopimelate epimerase [Methylobacterium radiotolerans JCM 2831]
 gi|170658227|gb|ACB27282.1| Diaminopimelate epimerase [Methylobacterium radiotolerans JCM 2831]
          Length = 325

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 120/279 (43%), Positives = 160/279 (57%), Gaps = 6/279 (2%)

Query: 7   DFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRI 66
            F KM G GN I+V+D+RG    +  +   A++ D  + FDQ+M++HD      DAF+RI
Sbjct: 38  RFLKMHGAGNAIVVLDLRGSAAKVRPEEARAIAQDPGSTFDQLMVLHDPVSPGADAFMRI 97

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKRKSF------TFETIRGILVAKENRDGSISVDM 120
            N DGSE  +CGNG RCV   +                 ET  G+L  +   + + +VDM
Sbjct: 98  YNTDGSESGACGNGTRCVAYAMLDDPAMARPAEGGRLVLETRAGLLGVRRVSERAFTVDM 157

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           G P L W  IPL+  F    R    IGP++   L +P  V+MGNPHA+FFVE D   +DL
Sbjct: 158 GRPRLAWDEIPLSEPFPDTRRIELQIGPIDDPILHSPGAVNMGNPHAVFFVEQDPDSFDL 217

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           A  G +L  HP+F E  N+S+A+VT  E++ LR WERG GLT ACG+AACA+VVA+  L 
Sbjct: 218 ARIGPMLENHPLFPERANISVAQVTGRETIKLRVWERGAGLTLACGTAACATVVAASRLR 277

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
              R  SV + GG L +EW  ++HV MTG      EG L
Sbjct: 278 MIGRQASVALPGGELFVEWRADDHVLMTGPVALVAEGTL 316


>gi|197116758|ref|YP_002137185.1| diaminopimelate epimerase [Geobacter bemidjiensis Bem]
 gi|197086118|gb|ACH37389.1| diaminopimelate epimerase [Geobacter bemidjiensis Bem]
          Length = 278

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 76/284 (26%), Positives = 130/284 (45%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  + ++       +  + AI   + +     D ++LI   + A  D  +
Sbjct: 1   MKFTKMQGAGNDYVYVNCFEEAVHDPAAVAIKVSNRNFGIGSDGLILIMPSEVA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD-------GSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +               + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVTKNEITAETGAGILTLQLFTDAGCKVEKVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L  K IP+    ++   +       +     N    SMGNPH + FV+ D+  
Sbjct: 119 VNMGPPRLTRKEIPMLGEPEERVVNVPLNVLHSS---FNITCASMGNPHCVIFVD-DVDT 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G L+  H +F    N+   ++ S   +  RTWERG G T ACG+ + A   A  
Sbjct: 175 FQVEKYGPLIENHELFPRRTNVEFVQIVSRTEVRQRTWERGAGETLACGTGSSAVTAACV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               T + +   + GG L +EW ++ +++MTG A + + G++D+
Sbjct: 235 LNGLTEKRILNHLTGGDLEMEWGEDGNIYMTGPAVEVFTGEIDL 278


>gi|148242289|ref|YP_001227446.1| diaminopimelate epimerase [Synechococcus sp. RCC307]
 gi|147850599|emb|CAK28093.1| Diaminopimelate epimerase [Synechococcus sp. RCC307]
          Length = 357

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 89/277 (32%), Positives = 127/277 (45%), Gaps = 10/277 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           F K +G+GN  +++D R           A            D ++L    Q    D  ++
Sbjct: 19  FRKYQGLGNDFILMDGRTTPLPEMGGDPAKELCDRRFGIGGDGLILALPPQQGG-DVRMQ 77

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRMKR---KSFTFETIRGILVAKENRDGSISVDMGE 122
           I+N DGSE + CGNG+RC  RFL           +  ET  G+++ +      ++VDMGE
Sbjct: 78  ILNADGSEAEMCGNGIRCFARFLADLDGSASGTQWRVETPAGLMIPRLLEGDQVTVDMGE 137

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P L+   IP   +                        V MGNPHA+  V+ DL   D   
Sbjct: 138 PFLEPASIPTNLA---AGTPLPDGELQVAGISLQVAAVGMGNPHAVVQVD-DLESLDFDR 193

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  L +HP F    N+   +V + + L +R WERG G T ACG+ ACA+VVA+      
Sbjct: 194 LGPALEQHPAFPARTNVHFVQVHAPDQLQVRVWERGAGPTLACGTGACATVVATHLRGAC 253

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            R  +V++ GG L I+W   NH+ M G A   +EG L
Sbjct: 254 ARQATVQLPGGPLQIDWDSTNHIQMAGPAVFVFEGVL 290


>gi|294851174|ref|ZP_06791847.1| diaminopimelate epimerase [Brucella sp. NVSL 07-0026]
 gi|294819763|gb|EFG36762.1| diaminopimelate epimerase [Brucella sp. NVSL 07-0026]
          Length = 294

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 145/282 (51%), Positives = 192/282 (68%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCD 70
           M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I IINCD
Sbjct: 1   MNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAIINCD 60

Query: 71  GSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLI 130
           G++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW+ I
Sbjct: 61  GTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDI 120

Query: 131 PLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKH 190
           PLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL  H
Sbjct: 121 PLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLLENH 180

Query: 191 PMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKM 250
           P+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+V +
Sbjct: 181 PIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVTVNV 240

Query: 251 LGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
            GG LLIEW D++HV MTG A+ E+ G  D  TG+W +  + 
Sbjct: 241 PGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDTQG 282


>gi|194700330|gb|ACF84249.1| unknown [Zea mays]
          Length = 308

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 131/289 (45%), Gaps = 13/289 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDAS 59
               + F K +G+GN  +++D R          +A      +     D ++ +    +  
Sbjct: 20  SERALHFVKYQGLGNDFIMVDNRDSSVPKVTPEEAAKLCDRNFGIGADGVIFVMPGVN-G 78

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +      FT  T  G +V +   DG +
Sbjct: 79  ADYTMRIFNSDGSEPEMCGNGVRCFARFIAEIENLQGTNRFTIHTGAGKIVPEIQSDGQV 138

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMGEPIL    IP        ++              +   VSMGNPH + F  ++  
Sbjct: 139 KVDMGEPILSGLDIPTKL-LATKNKAVVQAELAVEGLTWHVTCVSMGNPHCVTFGANELK 197

Query: 175 ---LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    L+  G     H MF    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 198 VLQVDDLKLSEIGPKFEHHEMFPARTNTEFVQVLSRSHLKMRVWERGAGATLACGTGACA 257

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            VVA+    +  R   V + GG L IEW + +NHV+MTG A+  + G +
Sbjct: 258 VVVAAVLEGRAERKCVVDLPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 306


>gi|261405790|ref|YP_003242031.1| diaminopimelate epimerase [Paenibacillus sp. Y412MC10]
 gi|261282253|gb|ACX64224.1| diaminopimelate epimerase [Paenibacillus sp. Y412MC10]
          Length = 279

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 97/286 (33%), Positives = 151/286 (52%), Gaps = 16/286 (5%)

Query: 5   MVDFAKMEGIGNKILVIDM-RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           M++F KM G+GN  +V+   R    + +  A+   +       D ++ I     A  D  
Sbjct: 1   MMEFTKMHGLGNDFVVVYGERELPSDASELAVKLCNRFFGIGADGLVYILPS--AKADFM 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSF--TFETIRG-----ILVAKENRDGSI 116
           +RI+N DGSE + CGN +RCV +++           T ETI        L  ++ +  S+
Sbjct: 59  MRIMNSDGSEAEQCGNAIRCVAKYVYDHGHIDREEITIETIGAGVQQVRLTVQDGQVSSV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEP+L+   +P     + +      +      F      VSMGNPH + +V+D + 
Sbjct: 119 RVDMGEPVLNGLSVPTLVDLNPVVNHPVEVDGREFRF----TAVSMGNPHCVIYVDDAVN 174

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
            +DL  +G  L  HP+F   +N+  A V S   +D+R WERG G T ACG+ ACA++V+S
Sbjct: 175 -FDLGVWGPKLEVHPLFPRKINVEFATVNSRGQVDMRVWERGAGPTLACGTGACATLVSS 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                T+R+ ++ + GG L IEW + +NHV+MTG A+  ++GKL I
Sbjct: 234 VLNGATDRSATISLKGGDLFIEWDELDNHVYMTGPAEVVYKGKLAI 279


>gi|116074845|ref|ZP_01472106.1| diaminopimelate epimerase [Synechococcus sp. RS9916]
 gi|116068067|gb|EAU73820.1| diaminopimelate epimerase [Synechococcus sp. RS9916]
          Length = 372

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 88/285 (30%), Positives = 135/285 (47%), Gaps = 14/285 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDN-----ITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  ++I+ R    +          +  +         D I+L    +  
Sbjct: 1   MLQFSKYQGLGNDFVLIEGRDGRLDASITSPDPQWVRRICDRRFGVGGDGIILALPPEGP 60

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             +  +RI N DGSE + CGNG+RC+ RF          +S++ ET  G+++     DG 
Sbjct: 61  G-ELRMRIFNADGSEAEMCGNGIRCLARFLADSDGDAPGRSWSIETPAGLIIPVLQEDGQ 119

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P+L    +P   +  +    +  +       L     V MGNPH +  V  DL
Sbjct: 120 IKVDMGAPMLAPDTVPTTLAVGEQGLPQGELTINGD--LLKVAAVGMGNPHVVVPV-PDL 176

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
                 ++G  L   P F    N+   +V   ++LD+R WERG G T ACG+ ACA++VA
Sbjct: 177 ASIPFDAWGAALEVDPSFPAKTNVHFLQVKGSDALDIRVWERGAGPTLACGTGACATLVA 236

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +  L  +     V + GG L I W D    VFMTG A+  ++G +
Sbjct: 237 AHLLGLSEATAEVMLPGGPLQISWPDRGGSVFMTGPAEAVFDGVV 281


>gi|225628131|ref|ZP_03786166.1| diaminopimelate epimerase [Brucella ceti str. Cudo]
 gi|260169356|ref|ZP_05756167.1| diaminopimelate epimerase [Brucella sp. F5/99]
 gi|261758874|ref|ZP_06002583.1| diaminopimelate epimerase [Brucella sp. F5/99]
 gi|225616956|gb|EEH14003.1| diaminopimelate epimerase [Brucella ceti str. Cudo]
 gi|261738858|gb|EEY26854.1| diaminopimelate epimerase [Brucella sp. F5/99]
          Length = 303

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 145/285 (50%), Positives = 193/285 (67%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +  R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRAGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG  + E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPTEWEFSGTFDPATGEWSRDTQG 291


>gi|118602558|ref|YP_903773.1| diaminopimelate epimerase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166225752|sp|A1AWJ5|DAPF_RUTMC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|118567497|gb|ABL02302.1| diaminopimelate epimerase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 271

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 83/280 (29%), Positives = 132/280 (47%), Gaps = 13/280 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +++D         ++ I  L+       FDQ++L+      +VD  
Sbjct: 2   LINFVKMHGLGNDFMMVDNLAGDITFNAEQIANLANRHLGIGFDQLLLVETSNTKNVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGSISVDMG 121
             I N DG EV+ CGNG RC   F++ +          ET  GI+    N D ++ VDMG
Sbjct: 62  YVIYNADGLEVEQCGNGARCFAFFVSKKGLSNNNPIVVETRSGIINLYLNDDNTVRVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
           +P  +   I L                   +   +   VS+GNPH +  VE D+   D++
Sbjct: 122 KPSFNPADILLLVPQQSTYYQ---------IEGFDLGAVSIGNPHCVMLVE-DVNTVDVS 171

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S    + +  +     N+   ++ +   ++LR +ERG G T ACGS ACA+VV       
Sbjct: 172 SIALRIQQSELLPNQANIGFMQILNTHEINLRVYERGSGETLACGSGACAAVVYGVEQGL 231

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               V   + GG  LIE+    HVF++G  +  +EGK++I
Sbjct: 232 LKENVVAHLNGGDTLIEYIQGGHVFLSGPVQFVFEGKVEI 271


>gi|326388654|ref|ZP_08210247.1| diaminopimelate epimerase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206905|gb|EGD57729.1| diaminopimelate epimerase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 269

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 104/275 (37%), Positives = 145/275 (52%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALST-DDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID R     +++    AL+        DQ++L+   + A  D  +
Sbjct: 3   IPFRKMHGLGNDFVVIDARERAVEMSARRAAALADRHTGIGCDQLILLEPSETA--DVRM 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
           RI N DG EV++CGN  R V  +L    + +        G ++A    D  ISV MG P 
Sbjct: 61  RIFNPDGGEVEACGNASRAVGLYLGGDKRIE------TLGGIIAASTSDTGISVAMGRPR 114

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
             W  IPLA   D +        PV    L  P  V++GNPH IFFV  D +  DLA  G
Sbjct: 115 FGWDEIPLAYPMDTL------TMPVGWEDLVEPVAVNVGNPHVIFFV-PDTHSVDLARLG 167

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
            L+   P+F   +N+++A +T  ++LDLR WER  GLT ACG+ ACAS +A+     T R
Sbjct: 168 PLIENDPLFPRRINVNVATLTGPDALDLRVWERAAGLTRACGTGACASAIAAMRRKLTGR 227

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V+V + GG L+IEW D + + MTG A   +EG  
Sbjct: 228 RVTVTLPGGPLVIEWTDADEIIMTGPATTSFEGSF 262


>gi|265750458|ref|ZP_06086521.1| diaminopimelate epimerase [Bacteroides sp. 3_1_33FAA]
 gi|263237354|gb|EEZ22804.1| diaminopimelate epimerase [Bacteroides sp. 3_1_33FAA]
          Length = 280

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 90/283 (31%), Positives = 144/283 (50%), Gaps = 8/283 (2%)

Query: 3   SSMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++ + F KM+G GN  + ++ +R    +    +I   S       D ++LI     A  D
Sbjct: 2   ATTIKFTKMQGAGNDYIYVNTLRHPIADPVRTSIKWSSCHTGIGSDGLVLIGKSTKA--D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
             +RI N DGSE   CGN  RC+ +++      +++  T ET+ GI + K + +    V+
Sbjct: 60  FSMRIFNADGSEAMMCGNASRCIGKYVYDNKLTQKEVITLETLSGIKILKLHTENG-LVE 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
                +D  L+  +R  +  D                   V MGNPH + F++ D+ + +
Sbjct: 119 EVTVDMDLPLLTNSRQINTPDGKMLAKTITVDGKEYKGTFVCMGNPHLVIFID-DIKNVN 177

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L + G  L  HP+F E  N+    V    SL +R WERG G+T ACG+ ACA+ VA+   
Sbjct: 178 LPAIGPKLENHPLFPERTNVEFVEVLPDGSLRMRVWERGSGITMACGTGACATAVAAYLN 237

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           HKT R   V+M GG L + W++ + HV+MTG A K ++G+++I
Sbjct: 238 HKTGRKSRVRMDGGDLQVHWNETDGHVYMTGPAVKVFDGEIEI 280


>gi|317473618|ref|ZP_07932907.1| diaminopimelate epimerase [Anaerostipes sp. 3_2_56FAA]
 gi|316898908|gb|EFV20933.1| diaminopimelate epimerase [Anaerostipes sp. 3_2_56FAA]
          Length = 278

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 85/284 (29%), Positives = 133/284 (46%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ++         ++    +S        D ++ IH    A  D  +
Sbjct: 1   MKFTKMHGCGNDYVYVNCFEETIENPNETAKFVSDRHFGIGSDGMICIHPSDKA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
            + N DG+E   CGNG+RC+ +++         T        +       ++ +   ++V
Sbjct: 59  AMYNSDGTEGAMCGNGVRCIAKYVYDYGLTDKTTITIETKGGIKELDLTVEDGKVTWVNV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           DM  P+L+   IP+    +K   D+  I             VSMGNPH + FV+  +   
Sbjct: 119 DMEAPVLEADKIPVIYDEEKKVIDKPVIVD---GREYRITCVSMGNPHGVVFVD-SVDDL 174

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G +   HPMF + VN    +V    ++ +R WERG G T ACG+ ACAS  AS  
Sbjct: 175 DIEKLGPMFEHHPMFPDRVNTEFIQVVDDHTIRMRVWERGAGETLACGTGACASAYASYL 234

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
             KT   V V +LGG L IE+ +  H +FM G A K ++G++D+
Sbjct: 235 NQKTGNKVLVHLLGGDLQIEYDEEKHTIFMKGPATKVFDGEIDL 278


>gi|226952076|ref|ZP_03822540.1| diaminopimelate epimerase [Acinetobacter sp. ATCC 27244]
 gi|226837168|gb|EEH69551.1| diaminopimelate epimerase [Acinetobacter sp. ATCC 27244]
          Length = 284

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 141/280 (50%), Gaps = 5/280 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  +V+D+      + +  I  L+       FDQ++L+       VD   
Sbjct: 3   LEFTKMHGLGNDFMVVDLITQRAYLDTVTIQRLADRHFGVGFDQLLLVEPPDFPDVDFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG+RC  RF+  R    +     +T  GI+  +   +G + V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGVRCFARFVHERRLTTKTKIRVQTKAGIVEPELGANGWVRVNMGP 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP     D  D +  +   +      N  VV+MGNPHA+  V  D+   D+A 
Sbjct: 123 PKFLPDEIPFVTQVD-EDIEGLYSLELADDKSINIDVVNMGNPHAVTIV-PDVLTADVAG 180

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  H  F E VN    ++   + + LR +ERGVG T ACG+ ACA+ V+       
Sbjct: 181 IGPQVESHVRFPERVNAGFMQILDEKHVRLRVFERGVGETLACGTGACAAAVSGMRRGLL 240

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              V V++ GG L I W + + V+MTG     +EG+LD++
Sbjct: 241 ASEVEVQLAGGKLHIAWREGDVVWMTGPTAYVYEGRLDLR 280


>gi|17544856|ref|NP_518258.1| diaminopimelate epimerase [Ralstonia solanacearum GMI1000]
 gi|21362465|sp|Q8Y344|DAPF_RALSO RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|17427145|emb|CAD13665.1| diaminopimelate epimerase (dap epimerase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 292

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 91/286 (31%), Positives = 130/286 (45%), Gaps = 7/286 (2%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +V+D      + T +   A++        DQ++L+       VD   
Sbjct: 3   LHFTKMHGAGNDFVVLDGIATPIDFTPEQWRAIADRHFGVGADQLLLVERSTRPDVDFRY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC V+F+T R    +++   E + GI       DG ++VDMG 
Sbjct: 63  RIFNHDGGEVEQCGNGARCFVKFVTDRGLTDKRTIRVEVMNGISTLTMQPDGQVTVDMGA 122

Query: 123 PILDWKLIPLARSFDKMDRD--RFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           P+ +   +P          +          +        VSMGNPHA+  V+ D   + +
Sbjct: 123 PVFEAARLPFVPDALPTRVEGRDTQHALQINGRTAWLSTVSMGNPHAVQVVD-DAEAFPV 181

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
              G L+  H +F   VN     +    ++ LR +ERG G T ACG+ ACA+ VA     
Sbjct: 182 REDGPLIESHAVFPRRVNAGFMEIADRHAIRLRVYERGAGETLACGTGACAAAVAGIRRG 241

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDIKTGK 285
             +  V V   GG L I W      V MTG A   +EG LD+   K
Sbjct: 242 LLDSPVKVTTHGGDLTIAWAGEGEPVMMTGPATTVFEGTLDLDALK 287


>gi|260888468|ref|ZP_05899731.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
 gi|330838220|ref|YP_004412800.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
 gi|260862004|gb|EEX76504.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
 gi|329745984|gb|AEB99340.1| diaminopimelate epimerase [Selenomonas sputigena ATCC 35185]
          Length = 279

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 143/281 (50%), Gaps = 14/281 (4%)

Query: 8   FAKMEGIGNKILVIDMR--GCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIR 65
           F K +G GN  ++++       D++ + +            D ++L+   Q A  D  +R
Sbjct: 5   FTKWQGCGNDFVLVNGFREQLPDDLAALSRRVCDRHYGIGADGLILVLPSQQA--DFRMR 62

Query: 66  IINCDGSEVQSCGNGMRCVVRFLTSRM--KRKSFTFETIRGILVAKENRDGS----ISVD 119
           I N DG+E + CGNG+RC    + +        FT ET  GILV +    GS    + VD
Sbjct: 63  IFNADGTEAEMCGNGIRCFAGVVHAEGLSGEAEFTVETGAGILVPRLQLAGSRLTGVRVD 122

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
           MGEPIL+ + IP+         ++            +   VSMGNPH + FVE D     
Sbjct: 123 MGEPILEGERIPVLGFGASRVIEQPIEA---EGETFSMTCVSMGNPHCVIFVE-DAQDVP 178

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           +  FG LL +H  F +  N+  A +     + +R WERG  +T ACG+ +CA++VA+   
Sbjct: 179 MEKFGPLLERHEKFPKKTNVEFAEIKDASHIRMRVWERGAAVTLACGTGSCATLVAAALT 238

Query: 240 HKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
            +T R   V++ GG L IEW +N+HV+MTG A+K + G+ +
Sbjct: 239 GRTKREAEVQLDGGRLQIEWAENHHVYMTGPAEKVFAGRYE 279


>gi|320101594|ref|YP_004177185.1| diaminopimelate epimerase [Isosphaera pallida ATCC 43644]
 gi|319748876|gb|ADV60636.1| diaminopimelate epimerase [Isosphaera pallida ATCC 43644]
          Length = 293

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 94/288 (32%), Positives = 135/288 (46%), Gaps = 14/288 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD--NITSDAINALSTDDNTHFDQIMLIHDFQD-ASVDA 62
           + F KM GIGN  + I         + ++ A+           D ++L+   +  +  DA
Sbjct: 3   LRFVKMHGIGNDYIYISGFDQPIPDDPSALAVRIADRHFGVGGDGLILVLPPEPGSEADA 62

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFET-IRGILVAKEN--------RD 113
            +R+ N DGSE   CGNG+RCV +FL      ++       +G  V   +        R 
Sbjct: 63  VMRMFNADGSEGGMCGNGIRCVAKFLYDSGYVRAPRIRVKTKGAGVLSLDLEIDPASDRV 122

Query: 114 GSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
             + V+MG PIL    IP     D        +             VSMGNPH + FVE 
Sbjct: 123 RRVRVEMGAPILRASAIPTTLPGDPPLDYPIAVTYDGKTITYRGTAVSMGNPHLVMFVE- 181

Query: 174 DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASV 233
           D+   DL   G LL +H  F + VN+ +A+V + +   +RTWERG G+T ACG+ ACA +
Sbjct: 182 DVASIDLERIGPLLERHEAFPDRVNVHVAQVDAPDVARMRTWERGSGITLACGTGACAVL 241

Query: 234 VASGCLHKTNRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLD 280
           VA     +T RA  + + GG L +EW  +   V MTG A   +EG  D
Sbjct: 242 VAGVLTGRTARAARIHLPGGALDLEWPRDGETVIMTGPAVTVFEGVWD 289


>gi|310642749|ref|YP_003947507.1| diaminopimelate epimerase [Paenibacillus polymyxa SC2]
 gi|309247699|gb|ADO57266.1| Diaminopimelate epimerase [Paenibacillus polymyxa SC2]
          Length = 276

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 97/283 (34%), Positives = 142/283 (50%), Gaps = 16/283 (5%)

Query: 6   VDFAKMEGIGNKILVIDMR-GCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  +V         + +  A+           D ++ I     A  D  +
Sbjct: 1   MEFTKMNGLGNDFIVWYGHQELPSDASELAVRLCDRHFGIGADGLVYILPSDKA--DFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCV--VRFLTSRMKRKSFTFETIRG-----ILVAKENRDGSIS 117
           RIIN DGSE + CGN +RC     +    + R+  T ET+        L  +      + 
Sbjct: 59  RIINSDGSEAEQCGNAIRCAAKYVYDRKHINREQITIETLGAGVQQVELTVENGAVRMVK 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMGEPIL+   IP       +  +    G     F      VSMGNPH + +VE D   
Sbjct: 119 VDMGEPILEGLKIPTTLDLTNVIDEPIEAGGSGFRF----TAVSMGNPHCVIYVE-DAPS 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           +DL ++G  L  HP+F +  N+  A V S + +D+R WERG G T ACG+ ACA++VAS 
Sbjct: 174 FDLEAWGPKLECHPLFPKKTNVEFATVRSRKHIDMRVWERGAGPTLACGTGACATLVASV 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEW-HDNNHVFMTGEAKKEWEGKL 279
               ++R   V + GG L IEW  D+NH++MTG A+  +EG++
Sbjct: 234 LNGYSDRRAMVSLKGGDLDIEWSEDDNHIYMTGPAEIVFEGRI 276


>gi|297741545|emb|CBI32677.3| unnamed protein product [Vitis vinifera]
          Length = 307

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 95/291 (32%), Positives = 138/291 (47%), Gaps = 13/291 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALSTD-DNTHFDQIMLIHDFQDAS 59
           +S  + F K  G+GN  +++D R   +  +T +    L         D ++         
Sbjct: 19  ESGFLHFVKYHGLGNDFILVDNRDSSEPKLTPEQAVKLCDRNFGIGADGVIFAMPG-ING 77

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +   ++SFT  T  G++V +   DG +
Sbjct: 78  TDYTMRIFNSDGSEPEMCGNGVRCFARFIAELENLHGKQSFTLHTGAGLIVPEIQDDGKV 137

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFF-----V 171
            VDMG+PIL    +P     +  D+              N   VSMGNPH + F      
Sbjct: 138 KVDMGKPILKALDVPTKLPAN-KDQSVVKSELNVDGVSWNVTCVSMGNPHCVTFGTKGGQ 196

Query: 172 EDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +   +LA  G     H MF    N    +V S   L +R WERG G T ACG+ ACA
Sbjct: 197 NLQVDELNLADIGPKFEHHAMFPARTNTEFVQVISRSHLKMRVWERGAGATLACGTGACA 256

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
            VVA+       R+ +V + GG L IEW  ++NHV+MTG A+  + G + +
Sbjct: 257 VVVAAVLEGHAGRSCTVDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 307


>gi|255282869|ref|ZP_05347424.1| diaminopimelate epimerase [Bryantella formatexigens DSM 14469]
 gi|255266643|gb|EET59848.1| diaminopimelate epimerase [Bryantella formatexigens DSM 14469]
          Length = 277

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 134/284 (47%), Gaps = 15/284 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCH-DNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM GIGN  + ++      ++    AI           D ++LI     A  D  +
Sbjct: 1   MKFTKMHGIGNDYVYVNCFKETVEDPEKTAILVSDRHFGIGSDGLILIKPSSVA--DGKM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILV------AKENRDGSISV 118
            + N DGS+   CGNG+RCV +++         +        +       +  +  ++ V
Sbjct: 59  EMYNADGSQGAMCGNGIRCVAKYMYDYGITDKTSISVETKSGIKYLDLTVENGKVSAVRV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG P+L    IP     + +  +   +             VSMGNPHA+ +VE D+ H 
Sbjct: 119 NMGSPVLQAAAIPAVSEKETVIDEPVTVNGREWRL----TCVSMGNPHAVTYVE-DVKHL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G     HPMF + VN   A V    ++++R WERG G T ACG+ ACA+ VAS  
Sbjct: 174 DIEKIGPEFEHHPMFPDRVNTEFAHVIDRHTVEMRVWERGSGETLACGTGACATAVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
              T   V+VK+LGG L I W    N+V+MTG A   ++G++ +
Sbjct: 234 NGYTEDEVTVKLLGGDLKIFWDRKENNVYMTGSATTVFDGEIAL 277


>gi|33862988|ref|NP_894548.1| diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9313]
 gi|81577635|sp|Q7V7M5|DAPF_PROMM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33634905|emb|CAE20891.1| Diaminopimelate epimerase [Prochlorococcus marinus str. MIT 9313]
          Length = 303

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 136/285 (47%), Gaps = 14/285 (4%)

Query: 5   MVDFAKMEGIGNKILVIDMRG-----CHDNITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M+ F+K +G+GN  L+ID R         N     +  +         D ++L    + A
Sbjct: 4   MLQFSKYQGLGNDFLLIDGREDQLTQQVINPDPAWVRKICDRHFGIGADGLILALPPR-A 62

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGS 115
             D  ++I N DGS  + CGNG+RC+ RF   +   +  + +  ET+ GI+      DG 
Sbjct: 63  DGDLRMQIFNADGSLAEMCGNGIRCLTRFLADIEGDLCVQRWNIETLAGIICPVLQEDGQ 122

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDL 175
           I VDMG P LD + IP   +       +            +   V MGNPH I  VE DL
Sbjct: 123 ICVDMGTPFLDPESIPTTLTIGSAGLPQGEC--HLGSTSLHVAAVGMGNPHLIVPVE-DL 179

Query: 176 YHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA 235
            +    ++G  L KH  F    N+   ++ S   L++R WERG G T ACG+ ACAS+VA
Sbjct: 180 ENIPFENWGQRLEKHHAFPAKTNVHFLKIHSPNQLEIRVWERGSGPTLACGTGACASLVA 239

Query: 236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
           +  L  ++    V + GG L I W      VFMTG A+  ++G L
Sbjct: 240 TCLLGLSDDHAEVLLPGGVLQISWPGRRGSVFMTGPAEPIFDGVL 284


>gi|220904420|ref|YP_002479732.1| Diaminopimelate epimerase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254767100|sp|B8IZX7|DAPF_DESDA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|219868719|gb|ACL49054.1| Diaminopimelate epimerase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 287

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 92/286 (32%), Positives = 134/286 (46%), Gaps = 13/286 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+GIGN  + I+      +   +    +S        D ++LI     A+ D  +
Sbjct: 5   LRFTKMQGIGNDYVYINGFQERIDSPGELARKISDRHFGIGSDGLVLILPS--ATADVRM 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKR--KSFTFETIRGILVAKENRD----GSISV 118
           R+ N DGSE + CGN +RCV +++     +     T ET  G+ + +   +       +V
Sbjct: 63  RMFNADGSESEMCGNAVRCVGKYVYDHGIQVKDVITVETRAGVKIVRLLFEAGKVCGATV 122

Query: 119 DMGEPILDWKLIPLARS--FDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
           DMGEP L    IP+      D   +         +  L     VSMGNPHA+ F++  + 
Sbjct: 123 DMGEPELHPARIPVLTETSGDGSQQRFVARPVDVNGQLYEITAVSMGNPHAVIFMKG-ID 181

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
             DL   G     HP+F +  N   A V S   + +R WERG G T ACG+ ACA  VA 
Sbjct: 182 DLDLPRIGPRFEHHPLFPKRTNTEFAEVISSTKVRMRVWERGAGETLACGTGACAVAVAC 241

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
                  R V V++ GG L I W + +NHV+MTG A   + G+  I
Sbjct: 242 VLNGYAGRDVEVELKGGSLHIHWDEASNHVYMTGGAVTVFSGEYYI 287


>gi|82703657|ref|YP_413223.1| diaminopimelate epimerase [Nitrosospira multiformis ATCC 25196]
 gi|123543877|sp|Q2Y5Z0|DAPF_NITMU RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|82411722|gb|ABB75831.1| diaminopimelate epimerase [Nitrosospira multiformis ATCC 25196]
          Length = 277

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 133/281 (47%), Gaps = 11/281 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +VID      +++ + +  L+        DQI+LI   +    D   
Sbjct: 3   LKFTKMHGLGNDFIVIDAVNQQISLSPEQLRRLADRHLGVGCDQILLIEKAE-GDADFRY 61

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSF--TFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VR++             ET+ G+++ +   DG ++V+MG 
Sbjct: 62  RIFNADGGEVEQCGNGARCFVRYVHDHGMTDKQQVRIETLSGVVIPELEADGEVTVNMGV 121

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P  D   IP                    +       VSMGNPHA+  V  DL +  + +
Sbjct: 122 PKFDPVEIPFIAEQRAPTYSLSLDDRQVEI-----SSVSMGNPHAVQVVS-DLDNAPVLT 175

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G ++ KH  F + VN    +V     + LR +ERG G T ACG+ ACA+ VA       
Sbjct: 176 EGPVIEKHSRFPQRVNAGYMQVVDPHHIRLRVYERGAGETLACGTGACAAAVAGIQRGLL 235

Query: 243 NRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDIK 282
              V V    G L I W  +N  V+MTG A   ++G+++++
Sbjct: 236 ESPVRVSFSTGDLFIRWEGENQPVWMTGPAVAVFDGEIELQ 276


>gi|122203466|sp|Q2QNF7|DAPF_ORYSJ RecName: Full=Diaminopimelate epimerase, chloroplastic; Short=DAP
           epimerase; Flags: Precursor
 gi|77556798|gb|ABA99594.1| Diaminopimelate epimerase, putative, expressed [Oryza sativa
           Japonica Group]
 gi|125579760|gb|EAZ20906.1| hypothetical protein OsJ_36545 [Oryza sativa Japonica Group]
          Length = 354

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 127/288 (44%), Gaps = 13/288 (4%)

Query: 2   QSSMVDFAKMEGIGNKILVIDMRGCHDNI--TSDAINALSTDDNTHFDQIMLIHDFQDAS 59
               + F K +G+GN  +++D R          +A      +     D ++ +    +  
Sbjct: 66  SERALHFVKYQGLGNDFIMVDNRDSAVPKVTPEEAAKLCDRNFGVGADGVIFVMPGVN-G 124

Query: 60  VDAFIRIINCDGSEVQSCGNGMRCVVRFL---TSRMKRKSFTFETIRGILVAKENRDGSI 116
            D  +RI N DGSE + CGNG+RC  RF+    +     SF   T  G+++ +   DG +
Sbjct: 125 ADYTMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGTHSFKIHTGAGLIIPEIQNDGKV 184

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDD-- 174
            VDMG+PIL    IP        +                   VSMGNPH + F   +  
Sbjct: 185 KVDMGQPILSGPDIPTKLPS-TKNEAVVQADLAVDGSTWQVTCVSMGNPHCVTFGTKELK 243

Query: 175 ---LYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              +    L+  G     H MF    N     V S   L +R WERG G T ACG+ ACA
Sbjct: 244 VLHVDDLKLSDIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWERGAGATLACGTGACA 303

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGK 278
            VVA+    +  R   V + GG L IEW + +NH++MTG A+  + G 
Sbjct: 304 VVVAAVLEGRAERKCVVDLPGGPLEIEWREDDNHIYMTGPAEAVFYGS 351


>gi|86606001|ref|YP_474764.1| diaminopimelate epimerase [Synechococcus sp. JA-3-3Ab]
 gi|123506579|sp|Q2JUV6|DAPF_SYNJA RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|86554543|gb|ABC99501.1| diaminopimelate epimerase [Synechococcus sp. JA-3-3Ab]
          Length = 285

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 99/288 (34%), Positives = 142/288 (49%), Gaps = 16/288 (5%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDN-ITSDAINALS-TDDNTHFDQIMLIHDFQDA 58
           M S  + F K +G+GN  +++D R      +T +   AL         D ++ +   Q+ 
Sbjct: 1   MPSR-LSFHKYQGLGNDFILVDNRHQPQPCLTPEEAVALCNRRFGVGADGVIFLLPGQE- 58

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKS---FTFETIRGILVAKENRDGS 115
             D  +R+ N DGSE + CGNG+RC+ RFL           +   T+ G +V +   DG 
Sbjct: 59  GADFSMRLFNSDGSEAEMCGNGIRCLARFLQDLGIPGQDGAYQIHTLAGRIVPQVRPDGL 118

Query: 116 ISVDMGEPILDWKLIP--LARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED 173
           ++VDMG P L    IP  LA+  +K+ R    +G            VSMGNPH + F+E+
Sbjct: 119 VTVDMGIPRLLAGQIPTTLAKPEEKVVRQPLQVGGRE----WAVTAVSMGNPHCVVFLEE 174

Query: 174 --DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACA 231
              L   DL   G L   HP F E  N   A+V     L LR WERG G+T ACG+ ACA
Sbjct: 175 GGSLEELDLERVGPLFEHHPAFPERTNTEFAQVLGPNYLRLRVWERGAGVTLACGTGACA 234

Query: 232 SVVASGCLHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGK 278
           ++VA+    +     +V++ GG L I W  +  HV+MTG A   + G 
Sbjct: 235 ALVAAVLEERAEPQATVELPGGNLEIRWDPDTQHVWMTGPALPVFSGT 282


>gi|254717991|ref|ZP_05179802.1| diaminopimelate epimerase [Brucella sp. 83/13]
 gi|265982937|ref|ZP_06095672.1| diaminopimelate epimerase [Brucella sp. 83/13]
 gi|306839770|ref|ZP_07472571.1| diaminopimelate epimerase [Brucella sp. NF 2653]
 gi|264661529|gb|EEZ31790.1| diaminopimelate epimerase [Brucella sp. 83/13]
 gi|306405125|gb|EFM61403.1| diaminopimelate epimerase [Brucella sp. NF 2653]
          Length = 303

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 147/285 (51%), Positives = 193/285 (67%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+IT  A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITPAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GPV+   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPVDAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++     T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGHTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV MTG A+ E+ G  D  TG+W +    
Sbjct: 247 VNVPGGPLLIEWRDDDHVMMTGPAEWEFSGTFDPATGEWSRDMHG 291


>gi|134299550|ref|YP_001113046.1| diaminopimelate epimerase [Desulfotomaculum reducens MI-1]
 gi|229807506|sp|A4J568|DAPF_DESRM RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|134052250|gb|ABO50221.1| diaminopimelate epimerase [Desulfotomaculum reducens MI-1]
          Length = 284

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 89/285 (31%), Positives = 144/285 (50%), Gaps = 16/285 (5%)

Query: 6   VDFAKMEGIGNKILVIDM---RGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDA 62
           + F K+ G+GN  ++++    +G  D+ ++ A            D ++L++D      D 
Sbjct: 1   MYFTKVHGLGNDFILVNAGTGQGFTDDCSTLAKEVCDRKFGIGADGLVLLYDS--GVADV 58

Query: 63  FIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRD----GSI 116
            ++I+N DGSE + CGN +RCV ++L     +K+     ET+ GI+V +  +      ++
Sbjct: 59  RMKIVNSDGSEAEMCGNAIRCVAKYLYDHGIIKKDEIKVETLAGIIVPQIIQQEGSVKAV 118

Query: 117 SVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLY 176
            VDMGEP ++   IP+     ++  +   +    +L       VSMGNPH I FV  DL 
Sbjct: 119 RVDMGEPRVERAEIPMIGPPGQVIGEELAVNGKVYL----VTAVSMGNPHCIIFV-PDLE 173

Query: 177 HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVAS 236
              L   G  +  HP F +  N+   +V     + +  WERG G T ACG+ ACA  VA 
Sbjct: 174 DISLTQVGPQIEVHPAFPKKTNVEFVQVLGPNEVRMVVWERGAGPTMACGTGACAVAVAG 233

Query: 237 GCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
                T R V+V + GG L+IEW +N  ++MTG A + + G+  +
Sbjct: 234 VLNGFTERMVTVHLPGGSLMIEWAENGRIYMTGPATEVFSGEYTV 278


>gi|294651117|ref|ZP_06728453.1| diaminopimelate epimerase [Acinetobacter haemolyticus ATCC 19194]
 gi|292823011|gb|EFF81878.1| diaminopimelate epimerase [Acinetobacter haemolyticus ATCC 19194]
          Length = 284

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 93/280 (33%), Positives = 141/280 (50%), Gaps = 5/280 (1%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           ++F KM G+GN  +V+D+      + +  I  L+       FDQ++++       VD   
Sbjct: 3   LEFTKMHGLGNDFMVVDLITQRAYLDTVTIQRLADRHFGVGFDQLLIVEPPDFPDVDFKY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV+ CGNG+RC  RF+  R    +     +T  GI+  +   +G + V+MG 
Sbjct: 63  RIFNADGSEVEQCGNGVRCFARFVHERRLTTKTKIRVQTKAGIVEPELGANGWVRVNMGP 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP     D  D +  +   +      N  VV+MGNPHA+  V  D+   D+A 
Sbjct: 123 PKFLPDEIPFVTQVD-EDIEGLYSLELADDKSINIDVVNMGNPHAVTIV-PDVLTADVAG 180

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G  +  H  F E VN    ++   + + LR +ERGVG T ACG+ ACA+ V+       
Sbjct: 181 IGPQVESHVRFPERVNAGFMQILDEKHVRLRVFERGVGETLACGTGACAAAVSGMRRGLL 240

Query: 243 NRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
              V V++ GG L I W + + V+MTG     +EG+LD++
Sbjct: 241 ANEVEVQLAGGKLHIAWREGDVVWMTGPTAYVYEGRLDLR 280


>gi|262369522|ref|ZP_06062850.1| diaminopimelate epimerase [Acinetobacter johnsonii SH046]
 gi|262315590|gb|EEY96629.1| diaminopimelate epimerase [Acinetobacter johnsonii SH046]
          Length = 281

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 144/281 (51%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  L+       FDQ++++      +VD  
Sbjct: 2   LLEFTKMHGLGNDFMVVDLISQRAFLDTVTIQRLADRHFGIGFDQLLIVEPPDLPNVDFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC  RF+  R    +     +T  GI+  +  ++G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERQLTTKTKIKVQTKAGIVEPELGQNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P    + IP          +  +   + +       VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFLPQEIPFIADAP----EALYDIALANNEQLTIDVVNMGNPHAVTIV-PDVITADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  +  H  F + VN    ++   +   LR +ERGVG T ACG+ ACA+ ++      
Sbjct: 177 RLGPQVESHERFPQRVNAGFMQIIDEKHARLRVFERGVGETLACGTGACAAAISGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
            + +V +++ GG L IEW + + V+MTG     +EG++D+ 
Sbjct: 237 LDSSVEIELAGGKLHIEWREGDVVWMTGPTSNVYEGRIDLS 277


>gi|50085727|ref|YP_047237.1| diaminopimelate epimerase [Acinetobacter sp. ADP1]
 gi|81613095|sp|Q6F950|DAPF_ACIAD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|49531703|emb|CAG69415.1| diaminopimelate epimerase [Acinetobacter sp. ADP1]
          Length = 281

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 144/281 (51%), Gaps = 8/281 (2%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           +++F KM G+GN  +V+D+      + +  I  ++       FDQ++++      +VD  
Sbjct: 2   LLEFTKMHGLGNDFVVLDLISQRAYLDTTTIQRMADRHFGIGFDQLLIVEPPDYPNVDFK 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG+RC  RF+  R   K+     +T  GI+  +   +G + V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGVRCFARFVHERQLTKKTKIKVQTKAGIVEPELGPNGWVRVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P      IP        + +  +   + +       VV+MGNPHA+  V  D+   D+A
Sbjct: 122 YPKFMPHEIPFVTE----EFEALYTLELANEQSLKIDVVNMGNPHAVTIV-PDVLTADVA 176

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G  +  H  F + VN    ++   + + LR +ERGVG T ACG+ ACA+ V+      
Sbjct: 177 TMGPQVESHVRFPQRVNAGFMQIVDEKHIRLRVFERGVGETLACGTGACAAAVSGMRRGL 236

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK 282
               V V++ GG L I W + + V+MTG     +EG+LD++
Sbjct: 237 LANEVEVELAGGKLQIAWQEGDVVWMTGPTANVYEGRLDLR 277


>gi|51891372|ref|YP_074063.1| diaminopimelate epimerase [Symbiobacterium thermophilum IAM 14863]
 gi|51855061|dbj|BAD39219.1| diaminopimelate epimerase [Symbiobacterium thermophilum IAM 14863]
          Length = 272

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 125/281 (44%), Gaps = 19/281 (6%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDN---ITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           MV F KMEG GN  + ++          + + A            D +++I    +   D
Sbjct: 1   MVRFTKMEGAGNDYIYVNNLVEQVPEERLPALARALSDRHFGVGADGLIVILPPAEPGYD 60

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
              R+ N DGSE + CGNGMRC  R+   R    R+    +T  G +V +   D + S  
Sbjct: 61  FRFRMFNADGSEGEMCGNGMRCFARYCYERGLTARRRMRVQTAAGCVVPEVLVDDAGSFA 120

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
                L    I        +   R       +       VV  G PH + FV+ D+   D
Sbjct: 121 GVRVDLGPPRI--------LGDRRIAAEGREYP----VTVVDTGVPHIVIFVD-DVDAVD 167

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           LA  G  L +HP F   VN++ A       L  RTWERG GLT ACG+ A A +VA+   
Sbjct: 168 LAKVGPQLERHPDFPARVNVNFAEAQGPAELRARTWERGSGLTLACGTGASAVLVAACLK 227

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            +T RA  V+M GG L +EW +   HVF+TG A+   +G  
Sbjct: 228 GRTGRAARVRMPGGDLQVEWDEATGHVFLTGPAEFVCDGVF 268


>gi|254430557|ref|ZP_05044260.1| diaminopimelate epimerase [Cyanobium sp. PCC 7001]
 gi|197625010|gb|EDY37569.1| diaminopimelate epimerase [Cyanobium sp. PCC 7001]
          Length = 394

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 93/314 (29%), Positives = 142/314 (45%), Gaps = 31/314 (9%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHD--------------------NITSDAINALS-TDDN 43
           M+ + K +G+GN  L++D RG  D                     +T + I  L      
Sbjct: 1   MLQYCKYQGLGNDFLMVDGRGATDAATDVATEAATETPTDDTCLGLTPERIRRLCDRRFG 60

Query: 44  THFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFE 100
              D +++    ++   +  +RI N DGSE + CGNG+RC+ RF       +  + +  E
Sbjct: 61  IGADGLIVAAPPREGG-ELRMRIFNADGSEPEMCGNGIRCLARFLADSDGDLPGRRWQVE 119

Query: 101 TIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVV 160
           T+ G +V +   DGS+ VDMG+P L  + +P           +  +      F       
Sbjct: 120 TLAGRIVPELQPDGSVRVDMGQPFLAPETVPTTLEIGDAGIPQGSLEAAGESF--QVGAA 177

Query: 161 SMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVG 220
            MGNPH +  V  DL   DL  FG  L  HP F    N+   +V +   L +R WERG G
Sbjct: 178 GMGNPHVVIPV-PDLEAVDLERFGAALEVHPAFPARTNVHFVQVLTPAHLVMRVWERGAG 236

Query: 221 LTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKL 279
            T ACG+ ACA++V    L    R+  + + GG L I W   ++HV+MTG A+  ++  +
Sbjct: 237 PTLACGTGACATLVVCHALGLAERSARLDLPGGPLQISWDPADDHVWMTGPAEAVFDAVI 296

Query: 280 DIKTGKWIKKNEDD 293
                 W  +  DD
Sbjct: 297 --APSLWDPEGVDD 308


>gi|148251980|ref|YP_001236565.1| diaminopimelate epimerase [Bradyrhizobium sp. BTAi1]
 gi|166224244|sp|A5E915|DAPF_BRASB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|146404153|gb|ABQ32659.1| diaminopimelate epimerase [Bradyrhizobium sp. BTAi1]
          Length = 289

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 122/277 (44%), Positives = 171/277 (61%), Gaps = 4/277 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F KM GIGN+I+V+D+R     +T D   A++      +DQ+M++   +    +AFIRI 
Sbjct: 9   FVKMNGIGNEIVVLDLRDVKHVVTPDEARAVAAR--VPYDQLMVLQPPRLDGTEAFIRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR-DGSISVDMGEPILD 126
           N DGSE  +CGNGMRCVVR +  +  + S TFET  G+L   +       +VDMG P   
Sbjct: 67  NNDGSESGACGNGMRCVVRQVFEKTGQASATFETRAGLLNCWQGPAPDLYTVDMGVPKFG 126

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           W+ IPLA  F         IGP++   L +P VV+MGNPHA+F+V+ D+  YDL  FG L
Sbjct: 127 WQEIPLAEEFRDTRYIELQIGPIDAPILHSPSVVNMGNPHAVFWVDGDVNSYDLERFGPL 186

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L + NR V
Sbjct: 187 LENHPIFPERANITLAHIVDRDHITMRTWERGAGLTKACGSAACATAVAAARLKRANRIV 246

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDIK 282
            + + GG L IEW + ++HV MTG A  E+EG+ + +
Sbjct: 247 QMTLPGGELTIEWRERDDHVLMTGTATFEFEGRFEPQ 283


>gi|258543859|ref|ZP_05704093.1| diaminopimelate epimerase [Cardiobacterium hominis ATCC 15826]
 gi|258520899|gb|EEV89758.1| diaminopimelate epimerase [Cardiobacterium hominis ATCC 15826]
          Length = 280

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 83/277 (29%), Positives = 125/277 (45%), Gaps = 9/277 (3%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFIRI 66
           F+KM G+GN  +V++      +     I AL+       FDQ+++I    DA+ D   RI
Sbjct: 6   FSKMHGLGNDFIVLNALQQPFDWPRARICALADRHSGIGFDQLLIIEPAPDAAHDYAYRI 65

Query: 67  INCDGSEVQSCGNGMRCVVRFLTSRMKR---KSFTFETIRGILVAKENRDGSISVDMGEP 123
            N DGSEV+ CGNG RC  ++L         +       RG +        S   +    
Sbjct: 66  YNADGSEVEHCGNGARCFGKYLRDHSLHPLDRPLRVAIKRGSITIAYVGTDSDGSEQYRV 125

Query: 124 ILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASF 183
            +     P    F     +R +             +VSMGNPHA+  V+ D+    +A+ 
Sbjct: 126 DMGE---PDFTPFTPAQTERLYQPVSAAGETLEMGIVSMGNPHAVCVVD-DVATAPVAAV 181

Query: 184 GNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTN 243
           G  L +HP+F   VN    ++     + LR +ERG G T ACG+ ACA+V         +
Sbjct: 182 GAALQQHPLFPAAVNAGFMQIRDRRHIRLRVYERGAGETQACGTGACAAVAVGIMRGLLD 241

Query: 244 RAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKL 279
           R V V++  G L I+W      ++MTG A   + G+L
Sbjct: 242 REVQVELPRGNLTIQWQGTGQPLYMTGPAATVYHGEL 278


>gi|212551077|ref|YP_002309394.1| diaminopimelate epimerase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|254767088|sp|B6YS11|DAPF_AZOPC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|212549315|dbj|BAG83983.1| diaminopimelate epimerase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 275

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 139/282 (49%), Gaps = 15/282 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSD-AINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  + ID      +   + AI           D ++LI           +
Sbjct: 1   MKFTKMHGAGNDYIYIDCFKEKIDCPEELAIRLSDRHKGIGSDGLVLIMPSDK--CSFRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRK--SFTFETIRGILVAKE----NRDGSISV 118
           R+ N DGSE Q CGN +RCV +++      +  + T ET+ G+   +     ++   + V
Sbjct: 59  RMFNSDGSEAQMCGNAIRCVGKYVYDNGYTRKLNITIETLAGVKQLELFPTNDKIRKVKV 118

Query: 119 DMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHY 178
           +MG+PIL  K IP+    +K+  +         +       VSMGNPH + FVE  +   
Sbjct: 119 NMGKPILLAKDIPVIWEKEKLIYETIDFSSEQWIL----TAVSMGNPHVVIFVEK-VSRL 173

Query: 179 DLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGC 238
           D+   G  +  HPMF E +N+    + SL    +R WERG G T ACG+ ACA++VAS  
Sbjct: 174 DVKRIGKEIEHHPMFPEKINVDFVEILSLYHAKMRVWERGSGETQACGTGACAALVASVL 233

Query: 239 LHKTNRAVSVKMLGGGLLIEWHDN-NHVFMTGEAKKEWEGKL 279
             K NR  ++ +LGG L +EW +   HVFMTG+A   + G+ 
Sbjct: 234 NGKLNRKATISLLGGDLELEWDEKTEHVFMTGDASLVFIGEF 275


>gi|212694865|ref|ZP_03302993.1| hypothetical protein BACDOR_04399 [Bacteroides dorei DSM 17855]
 gi|212662618|gb|EEB23192.1| hypothetical protein BACDOR_04399 [Bacteroides dorei DSM 17855]
          Length = 280

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 89/283 (31%), Positives = 143/283 (50%), Gaps = 8/283 (2%)

Query: 3   SSMVDFAKMEGIGNKILVID-MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVD 61
           ++ + F KM+G GN  + ++ +R    +    +I   S       D ++LI     A  D
Sbjct: 2   ATTIKFTKMQGAGNDYIYVNTLRHPIADPVRTSIKWSSCHTGIGSDGLVLIGKSTKA--D 59

Query: 62  AFIRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVD 119
             +RI N DGSE   CGN  RC+ +++      +++  T ET+ GI + K + +    V+
Sbjct: 60  FSMRIFNADGSEAMMCGNASRCIGKYVYDNKLTQKEVITLETLSGIKILKLHTENG-LVE 118

Query: 120 MGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYD 179
                +D  L+  +R  +  D                   V MGNPH + F++ D+ + +
Sbjct: 119 EVTVDMDLPLLTNSRQINTPDGKMLAKTITVDGKEYKGTFVCMGNPHLVIFID-DIKNVN 177

Query: 180 LASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCL 239
           L + G  L  HP+F E  N+    V    SL +R WERG G+T ACG+ ACA+ VA+   
Sbjct: 178 LPAIGPKLENHPLFPERTNVEFVEVLPDGSLRMRVWERGSGITMACGTGACATAVAAYLN 237

Query: 240 HKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
           HK  R   V+M GG L + W++ + HV+MTG A K ++G+++I
Sbjct: 238 HKAGRKSRVRMDGGDLQVHWNETDGHVYMTGPAVKVFDGEIEI 280


>gi|90421739|ref|YP_530109.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisB18]
 gi|122477672|sp|Q21CU6|DAPF_RHOPB RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|90103753|gb|ABD85790.1| diaminopimelate epimerase [Rhodopseudomonas palustris BisB18]
          Length = 288

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 123/274 (44%), Positives = 172/274 (62%), Gaps = 4/274 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM GIGN+I+V+D+R     +++    A++++    +DQ+M++   +    +AF+RI 
Sbjct: 9   FSKMNGIGNEIVVLDLRDHPVAVSAADARAIASE--VPYDQLMVLQPPRTPGTEAFVRIY 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           N DGSE  +CGNGMRCV R + +     + TFET  G+L          +VDMG P L W
Sbjct: 67  NNDGSESSACGNGMRCVARQVFATSASDALTFETRAGLLNCWRPAPNLYTVDMGPPKLGW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           K IPLA  F         IGP++   L  P VVSMGNPHAIF+V+ D+  +DLA FG LL
Sbjct: 127 KDIPLAEEFRDTRSIELQIGPIDAPVLHTPSVVSMGNPHAIFWVD-DVNAHDLARFGPLL 185

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+++A++   + + +RTWERGVGLT ACGSAACA+ VA+  L + NR V 
Sbjct: 186 ENHPIFPERANITLAQIVDRDHIVIRTWERGVGLTKACGSAACATAVAAARLRRVNRVVH 245

Query: 248 VKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLD 280
           + + GG L IEW   ++HV MTG A  E+EG+ D
Sbjct: 246 ITLPGGELGIEWRASDDHVLMTGPAAFEFEGRFD 279


>gi|77163849|ref|YP_342374.1| diaminopimelate epimerase [Nitrosococcus oceani ATCC 19707]
 gi|254435289|ref|ZP_05048796.1| diaminopimelate epimerase [Nitrosococcus oceani AFC27]
 gi|123595094|sp|Q3JEA2|DAPF_NITOC RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|76882163|gb|ABA56844.1| diaminopimelate epimerase [Nitrosococcus oceani ATCC 19707]
 gi|207088400|gb|EDZ65672.1| diaminopimelate epimerase [Nitrosococcus oceani AFC27]
          Length = 276

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G+GN  +VID      ++T+  +  ++        DQ++L+      ++D   
Sbjct: 3   IAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGY 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC  RF+  +    +     +T  GI+  +   DG I+VDMG 
Sbjct: 63  RIFNADGGEVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGV 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      IP     +         G    +       VSMGNPH +  V   +    +A 
Sbjct: 123 PRFAPHQIPFKVDQEADYYSLELDGQQVEIG-----AVSMGNPHCVLRVPA-VDTAPVAH 176

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
           +G LL  HP F + VN+  A++ S   L LR +ERG G T ACG+ ACA+ V        
Sbjct: 177 WGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYERGAGETPACGTGACAAAVIGKRRGWL 236

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
           +  V+V + GG L I W  +   V+M+G A+  ++G +++
Sbjct: 237 SGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL 276


>gi|332980959|ref|YP_004462400.1| diaminopimelate epimerase [Mahella australiensis 50-1 BON]
 gi|332698637|gb|AEE95578.1| diaminopimelate epimerase [Mahella australiensis 50-1 BON]
          Length = 277

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 88/283 (31%), Positives = 141/283 (49%), Gaps = 15/283 (5%)

Query: 6   VDFAKMEGIGNKILVID--MRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           + F KM G+GN  +V+D        +    A            D I+++     A  DA 
Sbjct: 1   MHFVKMHGLGNDFIVVDEFNAQSDRDYNKLAPMLCDRHFGIGADGIIIVLPSDIA--DAR 58

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFT--FETIRGILVAKE----NRDGSIS 117
           +RI+N DGSE + CGNG+RC  +++      K      ET+ GI+  +     +    + 
Sbjct: 59  MRIVNADGSEAEMCGNGIRCFAKYVYESGIIKKQVLSVETLAGIMKPELFVEGDEVQKVK 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           VDMG+P  +   IP      ++      +    +        +SMG PH + FV+ D+  
Sbjct: 119 VDMGKPDFEPGAIPAFMPGTRIVERPLEVDSQPYAITS----MSMGVPHTVIFVD-DVDE 173

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
            D+   G  + KHP+F +  N++   V +   + +RTWERG G T ACG+ +CAS VA+ 
Sbjct: 174 VDIIGLGPKIEKHPIFPKKTNVNFVEVLNDHEIKVRTWERGAGATLACGTGSCASAVAAA 233

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLD 280
              +T RAV+V ++ G L I W +++ VFMTG A K ++G ++
Sbjct: 234 ITGRTGRAVTVHLIAGQLEIRWAEDDTVFMTGPAAKVFQGDIE 276


>gi|85704066|ref|ZP_01035169.1| diaminopimelate epimerase [Roseovarius sp. 217]
 gi|85671386|gb|EAQ26244.1| diaminopimelate epimerase [Roseovarius sp. 217]
          Length = 277

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 97/275 (35%), Positives = 137/275 (49%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V+D R     +T   I A++       FDQ+ +I        DA +
Sbjct: 9   LPFFKMHGLGNDFVVLDGRARDLGLTPGLIMAIADRHRGIGFDQLAVI---TQGMGDAHL 65

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RC+ R+L     +      T RG LVA +   G  SV+MG+P 
Sbjct: 66  TFYNADGSTSAACGNATRCIARYLMDESGKARLELSTARGALVAVDAGGGLTSVNMGQPQ 125

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  IPLA + D ++                P    MGNPH  FFV  D     LA FG
Sbjct: 126 LDWAEIPLAEAMDTLEL----------PIEGGPVATGMGNPHCTFFV-ADAEAVPLAQFG 174

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
                HP++ E  N+ +A V   + + +R WERGVG+T A GS++CA+ VA+     T R
Sbjct: 175 PRYEHHPLYPERTNVQVATVIGPDHIRMRVWERGVGVTLASGSSSCATAVAAARRGLTGR 234

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V + + GG + ++W ++  V+MTGE      G L
Sbjct: 235 RVRIDLDGGTIHVDWREDG-VWMTGETAHVASGVL 268


>gi|226946777|ref|YP_002801850.1| diaminopimelate epimerase [Azotobacter vinelandii DJ]
 gi|259595050|sp|C1DJ56|DAPF_AZOVD RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226721704|gb|ACO80875.1| diaminopimelate epimerase [Azotobacter vinelandii DJ]
          Length = 276

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 137/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNI-TSDAINALSTDDNTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +VID+   H +I    A           FDQ++++       VD  
Sbjct: 2   LLRFTKMHGLGNDFMVIDLVTQHAHIQPKHAKQWGDRHTGIGFDQLLIVEPPSRPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +K    ET  G++      DG + VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVLDKRLTVKKRIRVETRSGVIELDVRPDGQVCVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L+ + IP       +D      G    L       +SMGNPHA+  VE ++    + 
Sbjct: 122 PPRLEPREIPFQAENAALDYQVEVDGCEVELA-----ALSMGNPHAVLRVE-NVESAPVH 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
             G  L  HP F + VN+   +V   +   LR WERG G T ACG+ ACA+ VA+     
Sbjct: 176 ELGPKLEHHPRFPQRVNVGFLQVVDRQHARLRVWERGAGETQACGTGACAAAVAAIRQGW 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
            +  V V + GG L I W   +  V MTG A + +EG++ +
Sbjct: 236 MDSPVLVDLPGGRLSIAWAGPDQSVMMTGPAVRVYEGQVRL 276


>gi|87121332|ref|ZP_01077222.1| diaminopimelate epimerase [Marinomonas sp. MED121]
 gi|86163489|gb|EAQ64764.1| diaminopimelate epimerase [Marinomonas sp. MED121]
          Length = 269

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 130/275 (47%), Gaps = 10/275 (3%)

Query: 11  MEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFIRIINC 69
           M G+GN  +V+D          D I  L        FDQ++++    +  +D   RI NC
Sbjct: 1   MHGLGNDFVVVDAVSRKVYFNKDMIARLGDRHTGIGFDQLLVVEPPTNPDMDFRYRIFNC 60

Query: 70  DGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           DG+EV+ CGNG RC   F+  +  +       ET  G +  +   +G ++VDMG P  + 
Sbjct: 61  DGTEVEHCGNGARCFATFVQDKELISNDIINVETKNGPIQLRVLANGQVTVDMGVPSFEP 120

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
             +P   + +    D    G            VS+GNPHA+  V+ +L    +   G  +
Sbjct: 121 ADLPFTGTANGAFYDIPVAG-----ESYPITPVSVGNPHAVHKVD-ELSDEYVERIGEAI 174

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             H +F   VN+   ++ S   ++LR +ERGVG T ACG+  CA+VVA          V 
Sbjct: 175 ESHDLFPNNVNVGFMQLVSDSEINLRVYERGVGETQACGTGTCAAVVAGIKQGWLAAKVK 234

Query: 248 VKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
             +LGG L IEW  +   + MTG   K +EG++ +
Sbjct: 235 ANLLGGELTIEWQGEGQPILMTGPTAKVFEGQIYL 269


>gi|254690073|ref|ZP_05153327.1| diaminopimelate epimerase [Brucella abortus bv. 6 str. 870]
 gi|256258326|ref|ZP_05463862.1| diaminopimelate epimerase [Brucella abortus bv. 9 str. C68]
 gi|260755611|ref|ZP_05867959.1| diaminopimelate epimerase [Brucella abortus bv. 6 str. 870]
 gi|260884637|ref|ZP_05896251.1| diaminopimelate epimerase [Brucella abortus bv. 9 str. C68]
 gi|297247173|ref|ZP_06930891.1| diaminopimelate epimerase [Brucella abortus bv. 5 str. B3196]
 gi|260675719|gb|EEX62540.1| diaminopimelate epimerase [Brucella abortus bv. 6 str. 870]
 gi|260874165|gb|EEX81234.1| diaminopimelate epimerase [Brucella abortus bv. 9 str. C68]
 gi|297174342|gb|EFH33689.1| diaminopimelate epimerase [Brucella abortus bv. 5 str. B3196]
          Length = 303

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 146/285 (51%), Positives = 194/285 (68%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+M G+GN+I+V DMRG  D+ITS A   L++D  T FDQIM IHD +    D +I II
Sbjct: 7   FARMNGLGNQIIVADMRGRADSITSAAAIRLASDSETAFDQIMAIHDPRTPGTDYYIAII 66

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDW 127
           NCDG++ Q+CGNG RCVV+ L +   R +FTFET  GIL A E+ DG ISVDMG P  DW
Sbjct: 67  NCDGTQAQACGNGTRCVVQALAAETGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDW 126

Query: 128 KLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLL 187
           + IPLA++     +    +GP +   L +P + SMGNPHA+F+V+ D++ Y+L  FG LL
Sbjct: 127 QDIPLAQAVADTRKIELQVGPADAPVLHSPSIASMGNPHAVFWVDKDVWSYELDKFGPLL 186

Query: 188 AKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVS 247
             HP+F E  N+SIA VTS +++DLRTWERG GLT ACGSAACA+ V++    +T R V+
Sbjct: 187 ENHPIFPERANISIAHVTSSDTIDLRTWERGAGLTRACGSAACAAAVSAARTGRTGRKVT 246

Query: 248 VKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNED 292
           V + GG LLIEW D++HV  TG A+ E+ G  D  TG+W +  + 
Sbjct: 247 VNVPGGPLLIEWRDDDHVMKTGPAEWEFSGTFDPATGEWSRDTQG 291


>gi|253698989|ref|YP_003020178.1| diaminopimelate epimerase [Geobacter sp. M21]
 gi|251773839|gb|ACT16420.1| diaminopimelate epimerase [Geobacter sp. M21]
          Length = 278

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 75/284 (26%), Positives = 129/284 (45%), Gaps = 14/284 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHD-NITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM+G GN  + ++       +  + AI   + +     D ++LI   + A  D  +
Sbjct: 1   MKFTKMQGAGNDYVYVNCFEEAVHDPAAVAIKVSNRNFGIGSDGLILIMPSEVA--DVRM 58

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRD-------GSIS 117
           R+ N DGSE + CGNG+RCV ++                G  +               + 
Sbjct: 59  RMFNSDGSESEMCGNGIRCVAKYAYDHGIVSKNEITAETGAGILTLQLFTGAGGKVEKVR 118

Query: 118 VDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYH 177
           V+MG P L  K IP+    ++   +       +     N    SMGNPH + FV+ D+  
Sbjct: 119 VNMGPPRLTRKEIPMLGEPEERVVNVPLNVLHSS---FNITCASMGNPHCVIFVD-DVDS 174

Query: 178 YDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASG 237
           + +  +G L+  H +F    N+   ++ S   +  RTWERG G T ACG+ + A   A  
Sbjct: 175 FQVEKYGPLIENHELFPRRTNVEFVQIVSRTEVRQRTWERGAGETLACGTGSSAVTAACV 234

Query: 238 CLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
               T + +   + GG L +EW ++ +++MTG A + + G++ +
Sbjct: 235 LNGLTEKRILNHLTGGDLEMEWGEDGNIYMTGPAVEVFSGEIGL 278


>gi|49083432|gb|AAT51031.1| PA5278 [synthetic construct]
          Length = 277

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 136/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H ++    +      +    FDQ++++       VD  
Sbjct: 2   LLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGIGFDQLLIVEAPSSPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +KS   ET  GI+      DG ++VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L    IP     + +  +    G    L       VSMGNPH +  VE ++    + 
Sbjct: 122 PPRLAPAEIPFQAEREALSYEIEVNGQRVELA-----AVSMGNPHGVLRVE-NVDSAPVH 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S G  L  HP F +  N+   +V       LR WERGVG T ACG+ ACA+ VA      
Sbjct: 176 SLGPQLEVHPRFPKKANIGFLQVLDPHHARLRVWERGVGETQACGTGACAAAVAGIRQGW 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V + + GG L IEW      V MTG A + +EG++ +
Sbjct: 236 LQSPVQIDLPGGRLHIEWAGPGQPVMMTGPAVRVYEGQVRL 276


>gi|15600471|ref|NP_253965.1| diaminopimelate epimerase [Pseudomonas aeruginosa PAO1]
 gi|218894381|ref|YP_002443251.1| diaminopimelate epimerase [Pseudomonas aeruginosa LESB58]
 gi|254238025|ref|ZP_04931348.1| diaminopimelate epimerase [Pseudomonas aeruginosa C3719]
 gi|254243835|ref|ZP_04937157.1| diaminopimelate epimerase [Pseudomonas aeruginosa 2192]
 gi|12230928|sp|Q51564|DAPF_PSEAE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|226724215|sp|B7V5G9|DAPF_PSEA8 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|9951591|gb|AAG08663.1|AE004940_7 diaminopimelate epimerase [Pseudomonas aeruginosa PAO1]
 gi|126169956|gb|EAZ55467.1| diaminopimelate epimerase [Pseudomonas aeruginosa C3719]
 gi|126197213|gb|EAZ61276.1| diaminopimelate epimerase [Pseudomonas aeruginosa 2192]
 gi|218774610|emb|CAW30427.1| diaminopimelate epimerase [Pseudomonas aeruginosa LESB58]
          Length = 276

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 136/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H ++    +      +    FDQ++++       VD  
Sbjct: 2   LLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGIGFDQLLIVEAPSSPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +KS   ET  GI+      DG ++VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L    IP     + +  +    G    L       VSMGNPH +  VE ++    + 
Sbjct: 122 PPRLAPAEIPFQAEREALSYEIEVNGQRVELA-----AVSMGNPHGVLRVE-NVDSAPVH 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           S G  L  HP F +  N+   +V       LR WERGVG T ACG+ ACA+ VA      
Sbjct: 176 SLGPQLEVHPRFPKKANIGFLQVLDPHHARLRVWERGVGETQACGTGACAAAVAGIRQGW 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V + + GG L IEW      V MTG A + +EG++ +
Sbjct: 236 LQSPVQIDLPGGRLHIEWAGPGQPVMMTGPAVRVYEGQVRL 276


>gi|33520022|ref|NP_878854.1| diaminopimelate epimerase [Candidatus Blochmannia floridanus]
 gi|81666875|sp|Q7VRM5|DAPF_BLOFL RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|33504368|emb|CAD83261.1| diaminopimelate epimerase [Candidatus Blochmannia floridanus]
          Length = 276

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 137/282 (48%), Gaps = 12/282 (4%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  ++ID         SD I +LS       FDQ++++    D ++D   
Sbjct: 1   MRFSKMHGLGNDFVIIDSITQKVYFNSDKIRSLSNRFYGIGFDQLLVVEPPYDPNIDFHC 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG+RCV RF+  +    ++     T    ++        ISV+MGE
Sbjct: 61  RIYNADGSEVYQCGNGIRCVARFVCIKKLTNKQHIKISTDTYSMMLSVLDSEFISVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI D   IP   +  +     F        F     VVS+GNPH +  VE  +    +  
Sbjct: 121 PIFDPIKIPFFSTQYQKMYVLFVPN-----FTILCGVVSIGNPHCVILVEQ-VDLVPVTV 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G++L  H  F +  N+S  ++ S  ++ LR +ERG G T ACGSAACA+V         
Sbjct: 175 LGSILENHHCFPKKANISFMQIISQNNIKLRVYERGSGETKACGSAACAAVAIGIQQGLL 234

Query: 243 NRA--VSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
            +   V V + GG L I W      ++M G A   ++G +++
Sbjct: 235 KKNISVQVNLPGGDLFISWKGLGYPLYMIGSATYIYDGCINL 276


>gi|74318544|ref|YP_316284.1| diaminopimelate epimerase [Thiobacillus denitrificans ATCC 25259]
 gi|74058039|gb|AAZ98479.1| diaminopimelate epimerase [Thiobacillus denitrificans ATCC 25259]
          Length = 288

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 131/280 (46%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G+GN  +V D       +T +    ++        DQI+++       VD   
Sbjct: 14  LRFTKMHGLGNDFVVFDGVNQTVTLTPERCRRIADRHFGVGCDQILVVEKPTRPDVDFRY 73

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DG EV+ CGNG RC VRF+       + +   ET  G++  +   DG ++VDMG 
Sbjct: 74  RIFNADGGEVEQCGNGARCFVRFVHDHGLTDKTAIRVETASGVIEPRLLADGRVTVDMGA 133

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           P      +P     +                  +  VVSMGNPHA+  V +DL    +  
Sbjct: 134 PRFAPAEVPFVAEAEA-----LTYPLKIGQHRLDIAVVSMGNPHAVLRV-NDLDSAPVDI 187

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G ++  H  F + VN    +V +   + LR +ERG G T ACG+ ACA+ V+       
Sbjct: 188 LGAVIESHSRFPQRVNAGFMQVLTPHDIRLRVFERGAGETLACGTGACAAAVSGIRQGAL 247

Query: 243 NRAVSVKMLGGGLLIEWHDNN-HVFMTGEAKKEWEGKLDI 281
              VSV   GG L+IEW      V MTG A+  +EG+L++
Sbjct: 248 ASPVSVHTRGGDLVIEWAGAGAPVLMTGPAETVFEGELEL 287


>gi|84503501|ref|ZP_01001556.1| Diaminopimelate epimerase [Oceanicola batsensis HTCC2597]
 gi|84388179|gb|EAQ01132.1| Diaminopimelate epimerase [Oceanicola batsensis HTCC2597]
          Length = 289

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 97/275 (35%), Positives = 142/275 (51%), Gaps = 16/275 (5%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINAL-STDDNTHFDQIMLIHDFQDASVDAFI 64
           + F KM G GN  +++D RG     T     A+        FDQ+  I D +  + D  +
Sbjct: 21  LPFRKMHGAGNDFVILDSRGMAPVCTPGLARAVGDRHRGVGFDQLAEIRDGE--NCDIAL 78

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
              N DGS   +CGN  RCV     +   +   T  T RG+L  +  R  ++ V+MG P+
Sbjct: 79  DFWNSDGSRAGACGNATRCVAAEWMTETGQDRVTIRTTRGVLRGEM-RGEAVWVNMGPPV 137

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFG 184
           LDW  +PLAR  D +                +P  V MGNPHA+FFVE D+   D+A+ G
Sbjct: 138 LDWAQVPLAREVDLLHL----------PIAGDPCGVGMGNPHAVFFVE-DIDAVDVAARG 186

Query: 185 NLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNR 244
             +   P++ E  N+   +V S + + +R WERG G+T ACGS ACA  VA+     T R
Sbjct: 187 AEVEHDPLYPEATNVEFVQVRSHDEVRMRVWERGTGITLACGSGACAVAVAAHRRGLTGR 246

Query: 245 AVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKL 279
            V +++ GG L ++W D+  V+MTG   + +EG+L
Sbjct: 247 HVRIEVDGGWLELDWRDDG-VWMTGPVARVFEGRL 280


>gi|330827983|ref|YP_004390935.1| diaminopimelate epimerase [Aeromonas veronii B565]
 gi|328803119|gb|AEB48318.1| Diaminopimelate epimerase [Aeromonas veronii B565]
          Length = 276

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 136/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++DF+KM G+GN  +V+D        ++D I  L+       FDQ++L+    D  +D  
Sbjct: 2   LIDFSKMHGLGNDFMVVDGVTQKVFFSNDVIKKLADRHFGIGFDQLLLVEPPYDPELDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +           T RG +V +   +  ++V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTARGRIVLQLEGENQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IP      +  +                 VVSMGNPH +  V   +    + 
Sbjct: 122 VPQFEPGKIPF-----RAQKAEKTYLLRAQEHTVMCGVVSMGNPHCVIEV-PSVADAPVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G ++ +H  F E VN+    + +   + LR +ERG G T ACG+ ACA+ V      K
Sbjct: 176 TLGAIMERHERFPERVNVGFMEMVNATEIKLRVFERGCGETLACGTGACAAAVIGISQGK 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V+V + GG L I W      V+MTG A+  ++G++++
Sbjct: 236 LKERVTVSLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEV 276


>gi|75676960|ref|YP_319381.1| diaminopimelate epimerase [Nitrobacter winogradskyi Nb-255]
 gi|74421830|gb|ABA06029.1| diaminopimelate epimerase [Nitrobacter winogradskyi Nb-255]
          Length = 297

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 123/275 (44%), Positives = 170/275 (61%), Gaps = 3/275 (1%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F+KM GIGN+I+V+D+R     +T+    A+++     +DQ+M++   +    +AF+RI 
Sbjct: 16  FSKMNGIGNEIVVVDLRDNPATVTAGEARAVASPGGVPYDQLMVLQPPRTPGTEAFVRIY 75

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENR-DGSISVDMGEPILD 126
           N DGSE  +CGNGMRCV R +     + + TFET  G+L        G  SVDMG P   
Sbjct: 76  NNDGSEANACGNGMRCVARQIFEATDKTALTFETRAGLLNCWRGSAPGLYSVDMGSPKFG 135

Query: 127 WKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNL 186
           WK IPLA  F         +GP++   L +P VVSMGNPHAIF+V+ D++ YDLA FG L
Sbjct: 136 WKDIPLAEEFRDTRYIELQVGPIDAPVLHSPSVVSMGNPHAIFWVD-DIHAYDLARFGPL 194

Query: 187 LAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAV 246
           L  HP+F E  N+++A +   + + +RTWERG GLT ACGSAACA+ VA+  L +  R V
Sbjct: 195 LENHPVFPERANITLAHIVDRDHITMRTWERGAGLTKACGSAACATAVAAARLKRVERIV 254

Query: 247 SVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLD 280
            + + GG L IEW + ++HV MTG A  E+EG  D
Sbjct: 255 HMTLPGGSLTIEWRERDDHVLMTGPAIFEYEGAFD 289


>gi|145300548|ref|YP_001143389.1| diaminopimelate epimerase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166224238|sp|A4SRW9|DAPF_AERS4 RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase
 gi|142853320|gb|ABO91641.1| diaminopimelate epimerase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 276

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 136/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAF 63
           ++DF+KM G+GN  +V+D        ++D I  L+       FDQ++L+    D  +D  
Sbjct: 2   LIDFSKMHGLGNDFMVVDGVTQKVFFSNDVIKKLADRHFGIGFDQLLLVEPPYDPELDFH 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFE--TIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +           T RG +  +   +  ++V+MG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTARGRISLQLEGENQVTVNMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P  +   IP      +  +                 VVSMGNPH +  V   +    + 
Sbjct: 122 VPQFEPGKIPF-----RAQKAEKTYLLRAQEHTVMCGVVSMGNPHCVIEV-PSVADAPVE 175

Query: 182 SFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHK 241
           + G ++ +H  F E VN+    + +   + LR +ERGVG T ACG+ ACA+ V      K
Sbjct: 176 TLGAIMERHERFPERVNVGFMEMVNATEIRLRVFERGVGETLACGTGACAAAVIGISQGK 235

Query: 242 TNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI 281
               V+V + GG L I W      V+MTG A+  ++G++++
Sbjct: 236 LKERVTVSLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL 276


>gi|313106694|ref|ZP_07792912.1| diaminopimelate epimerase [Pseudomonas aeruginosa 39016]
 gi|310879414|gb|EFQ38008.1| diaminopimelate epimerase [Pseudomonas aeruginosa 39016]
          Length = 276

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 135/281 (48%), Gaps = 10/281 (3%)

Query: 5   MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDD-NTHFDQIMLIHDFQDASVDAF 63
           ++ F KM G+GN  +V+D+   H ++    +      +    FDQ++++       VD  
Sbjct: 2   LLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGVGFDQLLIVEAPSSPDVDFR 61

Query: 64  IRIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMG 121
            RI N DGSEV+ CGNG RC  RF+  +    +KS   ET  GI+      DG ++VDMG
Sbjct: 62  YRIFNADGSEVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMG 121

Query: 122 EPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLA 181
            P L    IP         R+        +  L     VSMGNPH +  VE ++    + 
Sbjct: 122 PPRLAPAEI