RPSBLAST alignment for GI: 254780710 and conserved domain: pfam01678

>gnl|CDD|145037 pfam01678, DAP_epimerase, Diaminopimelate epimerase. Diaminopimelate epimerase contains two domains of the same alpha/beta fold, both contained in this family. Length = 121
 Score = 88.1 bits (219), Expect = 3e-18
 Identities = 36/120 (30%), Positives = 51/120 (42%), Gaps = 4/120 (3%)

Query: 158 FVVSMGNPHAIFFVED-DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWE 216
           F    GNPH +  V+D +  +      G  L     F    N+   +V+    + +R + 
Sbjct: 1   FAKMHGNPHDVVVVDDVEGANLLEPELGPALCHRHFFPGADNVLFVQVSGELDIKMRIFN 60

Query: 217 RGVGLTAACGSAACASVVASGCLHK--TNRAVSVKMLGGGLLIEWHDNNHV-FMTGEAKK 273
           R    T ACG+ A A   A+  L    T + V V+  GG L IE  D+ HV  M G A  
Sbjct: 61  RDGSETEACGNGAVACFAAAVYLGGLVTKKPVLVETPGGDLEIEVKDDGHVIVMMGPAVL 120