RPSBLAST alignment for GI: 254780710 and conserved domain: PLN02536

>gnl|CDD|178151 PLN02536, PLN02536, diaminopimelate epimerase. Length = 267
 Score =  170 bits (432), Expect = 4e-43
 Identities = 87/233 (37%), Positives = 119/233 (51%), Gaps = 23/233 (9%)

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRF---LTSRMKRKSFTFETIRGILVAKENRDGSIS 117
           D  +RI N DGSE + CGNG+RC  RF   L +   + S+   T  G+++ +   DG + 
Sbjct: 42  DYTMRIFNSDGSEPEMCGNGIRCFARFIAELENLQGKNSYKIHTGAGLIIPEMQADGQVK 101

Query: 118 VDMGEPILDWKLIP--LARSFDK------MDRDRFHIGPVNHLFLRNPFVVSMGNPHAIF 169
           VDMGEPIL    +P  LA + D       +D D    G    +       VSMGNPH + 
Sbjct: 102 VDMGEPILKGPEVPTKLAATKDGAVVQAELDVD----GKTWLVT-----CVSMGNPHCVT 152

Query: 170 FVEDDLY--HYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGS 227
           F E +L      L   G     H MF    N    +V S   L +R WERG G T ACG+
Sbjct: 153 FGEKELKVDDLPLEKIGPKFEHHEMFPARTNTEFVQVVSRSHLKMRVWERGAGATLACGT 212

Query: 228 AACASVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKL 279
            ACA VVA+    + +R  +V + GG L IEW   +NH++MTG A+  + G++
Sbjct: 213 GACALVVAAVLEGRADRNCTVDLPGGPLEIEWRESDNHIYMTGPAELVFYGEI 265