RPSBLAST alignment of GI: 254780710 and MMDB domain: 1s7j_A_

>1s7j_A (A:) Phenazine biosynthesis protein PHZF family; bacteria, structural genomics, PSI, protein structure initiative; 2.30A {Enterococcus faecalis V583}Length = 262
 Score =  120 bits (300), Expect = 3e-28
 Identities = 34/280 (12%), Positives = 70/280 (25%), Gaps = 36/280 (12%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           FA+    GN   V  +      +    +  ++ ++N       +            +R  
Sbjct: 11  FAEEVFKGNPAAVYVLE---KWLPEAVMQNIAIENNLSETAFTVKEGQ-----SYALRWF 62

Query: 68  NCDGSEVQSCGNGMRCVVRFL--TSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPIL 125
             +  E+  CG+        L     +  ++  F +  G L   +  +            
Sbjct: 63  TPER-EIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPE 121

Query: 126 DWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGN 185
                               +           +   +G        +++     +A    
Sbjct: 122 RI----------------PILPEYEAALGTKIYEAYLGRDLFFVLKDEE----TVAKITP 161

Query: 186 LLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAA----CGSAACASVVASGCLHK 241
             +       GV + +           RT+   + +          A             
Sbjct: 162 DFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQT 221

Query: 242 TNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI 281
           T  A  V   GG L  E    N V + G AK   +G+  +
Sbjct: 222 TLSAYQVSPRGGFLTCEV-KENRVIIGGTAKLFAKGEAYL 260