RPSBLAST alignment of GI: 254780710 and MMDB domain: 1w61_A_

>1w61_A (A:) B-cell mitogen; racemase, racemase pyridoxal phosphate-independent, stereo inversion, acid/base catalysis, homodimer, alpha/beta domains; 2.1A {Trypanosoma cruzi} PDB: 1w62_ALength = 414
 Score = 98.1 bits (243), Expect = 1e-21
 Identities = 34/321 (10%), Positives = 74/321 (23%), Gaps = 43/321 (13%)

Query: 3   SSMVDFAKMEGIGNKILVIDMRG-CHDNITSDAINALSTDDNTHFDQI------------ 49
                   M   G    ++                A   ++  +  +             
Sbjct: 43  KKSFTCIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMF 102

Query: 50  -MLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFL--------TSRMKRKSFTFE 100
              + D  +   D  I  ++  G  +  CG+     V            ++        +
Sbjct: 103 GAFLFDPIEEGADLGIVFMDTGG-YLNMCGHNSIAAVTAAVETGIVSVPAKATNVPVVLD 161

Query: 101 TIRGILVAKENRDGSISVDMGEPILDWKLIPLARS-FDKMDRDRFHIGPVNHLFLRNPFV 159
           T  G++    +       ++    +      L +     +    +    V+  F  N F 
Sbjct: 162 TPAGLVRGTAHLQSGTESEVSNASIINVPSFLYQQDVVVVLPKPYGEVRVDIAFGGNFFA 221

Query: 160 VSMGNPHAIFFVEDDLYHY-----DLASFGNL--LAKHPMFSEGVNLSIARVTSLESLD- 211
           +       I     +L         L +  N     +HP       +    +    +   
Sbjct: 222 IVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPE 281

Query: 212 -----LRTWERGVGLTAACGSAACASVV---ASGCLHKTNRAVSVKMLGGGLLIEW---H 260
                +  +       + CG+   A +    A G L      V   +LG           
Sbjct: 282 ANYKNVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEE 341

Query: 261 DNNHVFMTGEAKKEWEGKLDI 281
               V +      E    +  
Sbjct: 342 RIPGVKVPVTKDAEEGMLVVT 362